Вы находитесь на странице: 1из 12

16

Genes

que causan prdidas

Estructura tridimensional del sitio activo de la polifenol oxidasa (PPO) de batata (Ipomoea batatas). El tomo central de cobre (azul claro) se encuentra unido a dos residuos de histidina. Tomada de Mercern (2005), Enzimologa aplicada a los procesos industriales.

El Astrolabio

17

ARTCULO

oRIGINAL

AISLAMIENTO Y SECUENCIACIN DE UN FRAGMENTO DE DNA GENMICO CORRESPONDIENTE A LA REGIN 3DE UN CANDIDATO A GEN ppo DE LULO (Solanum quitoense Lam.)

Mauricio Pulido Jimnez1 y Vctor Manuel Nez Zarante2 1. Director CEBM, Gimnasio Campestre. 2. Investigador Centro de Biotecnologa y Bioindustria, CORPOICA. Correspondencia para el autor: centrobiomol@campestre.edu.co Recibido: 16 de abril de 2010 Aprobado: Mayo 20 de 2010

RESUMEN
Se aisl y determin la secuencia nucleotdica de un fragmento de DNA genmico correspondiente a la regin 3 de un candidato a gen ppo de lulo (Solanum quitoense Lam.). El contenido de guaninas-citosinas del fragmento es de 45.13%, valor que est dentro del rango que ha sido determinado previamente para los genomas de papa y tomate. En el segmento de DNA estudiado se identific un marco de lectura abierto de 252 aminocidos. La secuencia caracterizada presenta valores de similitud superiores al 75% y 66% a nivel de nucletidos y aminocidos respectivamente con los genes ppo y las protenas PPO de papa, tomate, tabaco y berenjena. Pa l a b ra s c l a v e : Pa r d e a m i e n t o enzimtico, polifenol oxidasa, Solanum quitoense, gen ppo, porcentaje de identidad.

SUMMARY
A nucleotide sequence of a genomic DNA fragment that corresponds to the 3 region of lulo (Solanum quitoense Lam.) ppo gene candidate was isolated and determined. The guanine-cytosine content for this fragment is 45.13%, which is within the rank that has been previously determined for potato and tomato genomes. The study of this DNA segment led to the identification of an open reading frame of 252 amino acids. The characterized sequence shows similarity values upperwards of 75% and 66% at a nucleotide and amino acid level respectively with ppo genes and PPO proteins of potato, tomato, tobacco and eggplant. Key words: Enzymatic browning, polyphenol oxidase, Solanum quitoense, ppo gene, identity percentage.

Investigacin y Ciencia del Gimnasio Campestre

18

INTRODUCCIN
El pardeamiento enzimtico es el fenmeno bioqumico responsable del deterioro del color (pigmentacin) que se observa en la corteza y la pulpa de la gran mayora de frutas y verduras econmicamente importantes. Este tipo de dao limita de manera significativa la posibilidad de comercializacin del producto, ya sea para el consumo en fresco o para el procesamiento industrial (McEvily, et al., 1992). La pigmentacin antes mencionada es provocada por la actividad de una familia de enzimas denominadas polifenol oxidasas (PPO) que estn confinadas dentro de los plastidios de las clulas vegetales y se liberan al citoplasma una vez se ha producido dao en la estructura celular de los tejidos como consecuencia del impacto mecnico ocasionado durante la recoleccin de la cosecha y la manipulacin poscosecha de los frutos (Vaughn y Duke, 1981; Vaughn, et al., 1988). El mtodo ms ampliamente utilizado para controlar el pardeamiento enzimtico en la mayora de alimentos frescos o procesados es la adicin de agentes qumicos antioxidantes tales como los sulfitos, los compuestos tilicos (Martnez y Whitaker, 1995), la tropolona y el cido salicilhidroxmico (Fuerst, et al., 2006). Sin embargo, estudios recientes efectuados por la Administracin de Drogas y Alimentos de los Estados Unidos (FDA) han demostrado que dichas sustancias representan un riesgo considerable para la salud humana. Por tal razn, la bsqueda de alternativas de naturaleza biotecnolgica a ste problema ha cobrado gran importancia a nivel mundial. Para implementar una de estas opciones, conocida como silenciamiento de genes mediante RNA antisentido, se requiere aislar un gen o parte de un gen que codifique una PPO. Puesto que en todas las especies vegetales cultivadas por su valor nutricional e industrial se han encontrado genes que
El Astrolabio

codifican PPOs (Newman, et al., 1993; Thygesen, et al., 1995; Goldman, et al., 1998), se presuma que el deterioro del color que se observa en lulo (Solanum quitoense Lam.) era pardeamiento enzimtico. Sin embargo, no se tenan evidencias de la existencia de genes ppo en dicha especie. Recientemente Pulido y Nez (2009) identificaron la regin 5 de uno de ellos. En este trabajo se reportan el aislamiento y la secuenciacin de un fragmento de DNA correspondiente a la regin 3 del mismo.

MATERIALES Y MTODOS
Material vegetal: El tejido empleado en el estudio se obtuvo de plantas de lulo (Solanum quitoense Lam., accesin ILS 388) y papa (Solanum tuberosum L., variedad Millenia). Semillas de lulo provenientes de los bancos de germoplasma de CORPOICA se sembraron en macetas con turba como sustrato; tanto la germinacin de las semillas como el desarrollo de las plntulas se dieron bajo condiciones de invernadero. El material vegetal de papa se colect de plantas pertenecientes a la Coleccin Central Colombiana que se encontraban en el campo. Cultivo de Escherichia coli cepa DH5: La bacteria se cultiv en medio Luria-Bertani (LB) lquido a 37 oC y agitacin (250 r.p.m) durante 8 horas. Extraccin y purificacin de DNA genmico de lulo, papa y E. coli: El DNA genmico de lulo y papa se aisl a partir de hojas jvenes, empleando el protocolo reportado por Doyle y Doyle (1990). El DNA genmico de E. coli se extrajo utilizando el procedimiento reportado por Chen y Kuo (1993). Evaluacin de la integridad y cuantificacin de los DNAs genmicos: Alcuotas de los DNAs y del marcador de masa molecular High

19

DNA Mass Ladder (Invitrogen, USA) fueron sometidas a electroforesis en gel de agarosa 1%. El gel se fotografi y la imagen se analiz con el programa GeneTools (Syngene, USA). Diseo de los iniciadores para PCR: Las secuencias nucleotdicas de los genes ppo previamente reportadas en tomate, papa, tabaco, batata, durazno, manzana, pera y haba se alinearon utilizando el programa Clustal X versin 2.0.9 (Larkin, et al., 2007) con el fin de identificar la regin hacia el extremo 3 que mostrara el mayor grado de conservacin posible. Una vez determinada dicha regin, se utilizaron el gen ppo-F de tomate (como gen de referencia) y el programa Oligo versin 6.71 (Rychlik y Rhoads, 1989; Rychlik, et al., 1990) (Molecular Biology Insights, Inc., USA) para disear los iniciadores que permitieran amplificar un fragmento de aproximadamente 920 pares de bases a partir de DNA genmico de lulo. La especificidad del posicionamiento de los iniciadores sobre la regin seleccionada se verific analizndolos con el programa BLAST (Altschul, et al., 1990). Amplificacin por PCR de la regin 3 del gen ppo de lulo: Para determinar las condiciones ptimas que permitieran la amplificacin de un fragmento ubicado hacia el extremo 3 del gen ppo de lulo se ensayaron diversas concentraciones de iniciadores, sulfato de magnesio (MgSO4) y DNA; de otro lado se evaluaron programas de amplificacin con diferentes temperaturas de alineamiento y perodos de extensin. Una vez estandarizadas las condiciones de amplificacin, el producto de PCR se someti a electroforesis en gel de agarosa 1% para verificar su tamao y la especificidad de la amplificacin. Purificacin y cuantificacin del fragmento amplificado: El fragmento amplificado por PCR fue purificado empleando el sistema Wizard SV Gel and PCR Clean-Up System

(Promega, USA). La concentracin del mismo se determin utilizando el mtodo descrito anteriormente. Secuenciacin del fragmento aislado: La secuencia de nucletidos del fragmento aislado se obtuvo empleando el mtodo de terminacin de cadena con dideoxinucletidos (Sanger, et al., 1977) y los mismos iniciadores diseados para producirlo (InfPPO-F y PPORv). El fragmento se secuenci dos veces por cada extremo con el fin de confirmar las secuencias logradas. Secuencia consenso del fragmento aislado: Las secuencias correspondientes tanto a la cadena positiva como a la negativa del fragmento aislado fueron alineadas empleando el programa CodonCode Aligner versin 2.0.4 (CodonCode Corporation, USA) para generar una secuencia consenso definitiva. Identificacin de marcos de lectura abiertos en el fragmento secuenciado: Para identificar los posibles marcos de lectura abiertos en el fragmento aislado se utiliz el programa ORF Finder (NCBI, USA). Anlisis de similitud con genes ppo y protenas PPO previamente reportadas: La secuencia de nucletidos consenso y la secuencia de aminocidos derivada de la primera fueron comparadas con las bases de datos empleando el programa BLAST (Altschul, et al., 1990) con el fin de determinar el grado de similitud de stas respecto a los genes ppo y protenas PPO previamente reportados en otras especies.

RESULTADOS Y DISCUSIN Iniciadores para PCR


Los trabajos sobre la estructura de los genes ppo en papa (Hunt, et al., 1993), tomate
Investigacin y Ciencia del Gimnasio Campestre

20

(Newman, et al., 1993) y otras especies sealan que el tamao de estos oscila entre 1700 y 2000 pb. y que las secuencias que flanquean los extremos 5y 3 muestran un alto grado de divergencia incluso entre genes pertenecientes a la misma especie. Considerando la variabilidad existente en los extremos de la regin que se pretenda amplificar y buscando iniciadores cuyas caractersticas permitieran un posicionamiento altamente especfico en los sitios previamente determinados, se disearon oligonucletidos con degeneracin en varias posiciones. Para amplificar por PCR el fragmento de DNA localizado hacia el extremo 3 del gen ppo de lulo se disearon los iniciadores InfPPO-F (5-CAAWTGRTNACTAAKGCTCC- 3) y PPO-Rv (5- TTAACAATCCKCAAGCTTGAT -3) (directo y reverso respectivamente). Las caractersticas de los iniciadores se presentan en la tabla 1.

El anlisis BLAST hecho para los iniciadores diseados permiti determinar las posiciones en las cuales estos se ubicaran en los genes ppo de otras especies y el tamao del producto de PCR que permitiran obtener (Tabla 2). Los resultados del anterior anlisis demuestran que la posicin de las secuencias sobre las cuales se ubican los dos iniciadores vara incluso en los genes ppo de la misma especie; ello implica que la longitud de los fragmentos que se pueden amplificar con estos iniciadores tambin presenta diferencias. Aunque el tamao de los genes ppo cambia, el anlisis muestra que tambin presentan variaciones en otras regiones. De otro lado, el hecho de que los iniciadores diseados para este estudio encuentren en el DNA de tomate, papa y tabaco secuencias pertenecientes a

Iniciador InfPPO-F PPO-Rv

Longitud (pb.) 20 21

Posicin degenerada nucletidos 4, 7, 9 y 15 nucletido 11

% G-C 36.4 38.0

Tm (oC) 63.5 67.0

Tabla 1. Caractersticas de los iniciadores diseados para amplificar el fragmento ubicado hacia el extremo 3 del gen ppo de lulo. Caractersticas de los iniciadores diseados para amplificar el fragmento ubicado hacia el extremo 3 del gen ppo de lulo.

Especie Tomate Tomate Tomate Tomate Tomate Tomate Papa Papa Papa Papa Tabaco

Gen ppo-A ppo-B ppo-C ppo-D ppo-E ppo-F ppo-POT 32 ppo-POT 33 ppo-A ppo-B ppo

Lugar posicionamiento iniciadores 881 - 1762 884 - 1771 869 - 1750 869 - 1756 878 - 1744 878 - 1738 887 - 1774 893 - 1780 866 - 1732 881 - 1747 886 - 1761

Tamao producto PCR (pb.) 901 908 901 908 887 881 908 908 887 887 896

Tabla 2. Sitios de posicionamiento de los iniciadores diseados para este estudio sobre genes ppo de diferentes especies y tamao de los productos de PCR que permitiran generar.

El Astrolabio

21

genes ppo sobre las cuales puedan posicionarse de manera muy especfica demuestra que el mtodo utilizado para el diseo de stos es muy efectivo. Aunque la evidencia experimental sugiere que estos iniciadores permitieron la amplificacin exclusiva de un fragmento correspondiente a un gen ppo de lulo y surge la posibilidad de que pudieran ser utilizados con el mismo fin en otras especies de dicotiledneas, de ninguna manera se propone el uso universal de ellos. Amplificacin de la regin 3de un gen ppo de lulo Los anlisis de PCR virtual realizados con el programa Oligo 6.71 sealaron que el tamao del producto de amplificacin deba estar entre 880 y 910 pb. Los iniciadores InfPPO-F y PPO-Rv permitieron amplificar un fragmento de aproximadamente 920 pb. (Figura 1) a partir de los genomas de lulo y papa. Despus
Reactivo Agua Buffer PCR MgSO4 dNTPs Primer InfPPO-F Primer PPO-Rv Taq DNA Polimerasa Platinum Hi-Fi DNA Volumen final Concentracin Inicial 10X 50 mM 2.5 mM 10 M 10 M 5 U/L 20 ng/L

Figura 1. Productos de PCR de 920 pb. correspondientes al gen ppo. M.P.M: Marcador de peso molecular; carril 1: genoma de lulo; carril 2: genoma de papa; carril 3: genoma de E. coli (control negativo); carril 4: blanco.

de evaluar diferentes concentraciones de magnesio (1.0, 1.5, 2.0, 2.5, 3.0 y 3.5 mM) con el fin de optimizar la amplificacin del fragmento, se determin que el valor ptimo era 2.0 mM. Los ensayos de estandarizacin de la temperatura de alineamiento cubrieron el rango entre 54 y 60 oC. Los mejores resultados se obtuvieron utilizando 58oC.
Concentracin Final 1X 2 mM 0.2 mM 0.4 M 0.4 M Volumen/Reaccin 13.45 L 2.5 L 1.0 L 2.0 L 1.0 L 1.0 L 0.25 L 3.8 L 25.0 L

Tabla 3. Condiciones de reaccin utilizadas en la amplificacin por PCR del fragmento de 920 pb. perteneciente al gen ppo a partir de DNA genmico de lulo.

Etapa Desnaturalizacin Inicial Amplificacin Desnaturalizacin Hibridacin Extensin Extensin final

Temperatura / Tiempo 94 oC X 3 min. 94 oC X 1 min. 58 oC X 45 segundos 72 oC X 75 segundos 72 oC X 7 min.

Nmero de Ciclos 1 45

Tabla 4. Programa de ciclaje utilizado para la amplificacin por PCR del fragmento de 920 pb. del gen ppo a partir de DNA genmico de lulo.

Investigacin y Ciencia del Gimnasio Campestre

22

Las condiciones de reaccin ptimas bajo las cuales se logr amplificar el fragmento se presentan en la tabla 3. El programa de ciclaje utilizado se presenta en la tabla 4. Secuencia del fragmento de gen ppo de lulo El mtodo de terminacin de cadena con dideoxinucletidos (Macrogen, USA) permiti determinar una secuencia de 800 nucletidos (Figura 2). La diferencia observada entre el tamao del fragmento amplificado por PCR (920 pb.) y el resultado arrojado por el procedimiento de secuenciacin (800 pb.) obedece a que la tcnica no logra resolver eficientemente los nucletidos de los extremos de las cadenas de DNA que se producen durante la reaccin de secuencia. La longitud de las regiones que no se logra identificar con claridad es de aproximadamente 120 nucletidos.
1

para genes que codifican PPO (Tabla 5) en tomate y papa oscila entre 41.67% y 43.64%; en tabaco es 44.80%, levemente superior al mostrado por las dos especies antes mencionadas, y para el caso de especies como manzana, pera, durazno y batata (las tres primeras pertenecientes a la familia Rosaceae y la ltima a la familia Convolvulaceae) los valores se encuentran entre 52.24 y 56.48% respectivamente. El valor ms bajo encontrado en la comparacin corresponde a haba (37.94%), especie perteneciente a la familia Fabaceae. La comparacin de la secuencia de 800 pb. encontrada en lulo con los genes ppo de otras especies revel valores de identidad elevados no slo con los genes ppo de especies pertenecientes a la familia Solanaceae sino con las de familias filogenticamente distantes (Tabla 6). El porcentaje de identidad

TTTTCGGTAA TCCTTACCCT CTTGGAACCG ATCCAAGTCC AGGAATGGGC ACTATCGAAA ATATTCCTCA CAATGCGGTC

81 CACGTCTGGG TGGGTGACCC ACGACAACCA AACGGAGAGG ACATGGGTAA TTTCTACTCA TCCGGTCTAG AACCGGCTTT 161 CTTTTGCCAC CACTCCAATG TGGACCGAAT GTGGAATGAA TGGAAAGCAA TCGGTGGGAA AAGAAGAGAT CTAGCCGACA 241 AAGATTGGTT GAACACAGAA TTCCTTTTCT ACGACGAAAA TCGCAAGCTG TTTCGCGTGA GAGTCCGAGA CTGTTTGGAC 321 AGTAAGAAAA TGGGATTCGA TTACGCACCA ATGCCCACTC CATGGCGTAA TTTTAAACCA TCAATCAGAA AGACAACAGC 401 AGGGAAACTG AATACCAGTT CCATTCCACC GGTTTCCAAG GTCTTTCCAA TCCCTAAACT AGACAGACCG ATTTCGTTTT 481 CCATCAATAG ACCAGCTTCG TCAAGGACTC AAGCTGAGAA AAATGAACAA GAGGAGATGC TAACATTCCA CAAGATACAA 561 CACAATGATA GACTGTACGT GAGATTTGAT GTTTTCCTGA ATGTGGACAA GACTGTGAAT GCGTTGGAGC TTGACCAGCC 641 AGAGTTCGCA GGGAGCTATA CTAGCTTACC GCATGTTCAT GGAGATGATA AGCCTCATGC TACGAGTGCT ACATTATCGC 721 TGGCGATAAC AGAATTGTTG GAGGATAATA ACCTGGAAGA TGAAGAGACTA TTGTGGTAAC TCTGGTTCCA AAAGTAGGT
Figura 2. Secuencia de nucletidos correspondiente a la regin 3 del gen ppo identificado en lulo (800 pb).

El fragmento de 800 pares de bases est constituido por 246 adeninas (30.75%), 175 citosinas (21.88%), 186 guaninas (23.25%) y 193 timinas (24.12%). El contenido de guaninas-citosinas (%GC) para este fragmento es 45.13%, valor que se encuentra dentro del rango que ha sido determinado previamente para los genomas de otras solanceas como papa y tomate, que oscila entre 40 y 45% (Rensink, et al., 2005). El %GC especfico
El Astrolabio

que arroj el anlisis BLAST, definido como el grado de invariabilidad que presentan dos secuencias (de nucletidos o protenas) al ser comparadas, puede ser asumido como una medida de la similitud existente entre las mismas (Altschul, et al., 1990). La secuencia encontrada en lulo presenta valores de similitud que oscilan entre 75 y 79% con los genes ppo de papa, tomate, tabaco, berenjena (especies de la familia Solanaceae) y

23

Especie Lulo Tomate Tomate Tomate Tomate Tomate Tomate Papa Papa Papa Papa Tabaco Batata Batata Durazno Pera Haba Manzana Manzana

Gen

Tamao gen (pb.) 800 1893 1791 1881 1776 1764 1758 1794 1800 1752 1767 1781 1767 1767 1794 1359 1821 1782 1782

Adenina 246 530 519 529 513 498 491 517 537 501 507 491 420 419 485 350 602 463 462

Citosina 175 379 370 365 366 379 365 366 376 367 367 409 523 525 512 351 353 462 472

Guanina 186 420 399 437 409 374 382 401 377 378 377 389 475 478 437 367 338 475 459

Timina 193 564 503 550 488 513 520 510 510 506 516 492 349 345 360 291 528 382 389

% G+C 45.13 42.20 42.94 42.63 43.64 42.69 42.49 42.75 41.83 42.52 42.10 44.80 56.48 56.76 52.90 52.83 37.94 52.58 52.24

ppo A ppo B ppo C ppo D ppo E ppo F ppo pot 32 ppo pot 33 ppo A ppo B ppo ppo ppo -1 ppo ppo ppo -1 ppo -1 ppo -2

Tabla 5. Contenido de nucletidos y porcentaje de guaninas y citosinas (%GC) en genes ppo de especies econmicamente importantes pertenecientes a las familias Solanaceae, Rosaceae y Fabaceae.

caqui (de la familia Ebenaceae). Los valores ms elevados (79 y 78%) corresponden a los genes ppo-A y ppo-B de papa y ppo-E de tomate respectivamente. Con valores de similitud entre 66 y 72% respecto al fragmento de lulo se encuentran los genes ppo de especies como nogal (Juglandaceae), albaricoque, pera asitica, ciruela del Japn, membrillo, fresno, manzana (Rosaceae), uva (Vitaceae), lamo balsmico y lamo californiano (Salicaceae) y batata (Convolvulaceae). En la tabla 6 se observa que los valores E arrojados por el anlisis BLAST se presentan en orden numrico ascendente mientras que los porcentajes de identidad se muestran en aparente desorden. Ello responde al hecho de que el valor E representa el nmero de alineamientos que se puede esperar que ocurran por azar entre la secuencia en estudio y

cualquiera otra de las existentes en la base de datos. Por lo tanto, entre ms cercano a cero sea el valor E, ms significativo es el alineamiento entre la secuencia que se analiza y la secuencia relacionada (Altschul, et al., 1990). Los valores E ms bajos que arroj la comparacin de la secuencia nucleotdica identificada en lulo con la base de datos de genes correspondieron a los alineamientos con los genes ppo reportados en papa, tomate, tabaco y berenjena, especies cercanamente relacionadas con el lulo; sin embargo, uno de estos valores E (2e -155) pertenece al caqui, especie que hace parte de una familia filogenticamente distante de las solanceas. El programa ORF Finder permiti determinar que dentro de la secuencia nucleotdica identificada hay un marco de lectura abierto
Investigacin y Ciencia del Gimnasio Campestre

24

Descripcin del gen ppo-A Papa (Solanum tuberosum) ppo-B Papa (Solanum tuberosum) ppo-E Tomate (Solanum lycopersicum) ppo Tabaco (Nicotiana tabacum) ppo-F Tomate (Solanum lycopersicum) ppo Caqui (Diospyros kaki) ppo Berenjena (Solanum melongena) ppo alelo POT33 Papa (Solanum tuberosum) ppo-B Tomate (Solanum lycopersicum) ppo alelo POT32 Papa (Solanum tuberosum) ppo-C Tomate (Solanum lycopersicum) ppo-A Tomate (Solanum lycopersicum) ppo-D Tomate (Solanum lycopersicum) ppo alelo POT72 Papa (Solanum tuberosum) ppo-1 Nogal (Juglans regia) ppo Potentilla fruticosa ppo Rhamnus californica ppo Uva (Vitis vinifera) ppo Albaricoque (Prunus armeniaca) ppo Cercocarpus betuloides ppo Pera Yar (Pyrus bretschneideri) ppo Cydonia oblonga ppo Chamaebatia foliolosa ppo Pera asitica (Pyrus pyrifolia) ppo lamo de California (Populus trichocarpa) ppo lamo balsmico (Populus balsamifera) ppo Ciruela del Japn (Prunus salicina) ppo Batata (Ipomoea batatas) ppo Fresno de California (Sorbus californica) ppo Pera comn (Pyrus communis) ppo Penacho de Apache (Fallugia paradoxa) ppo Membrillo (Chaenomeles speciosa) ppo-2 Manzana (Malus domestica)

Valor E 0.0 0.0 0.0 1e -169 1e -163 2e -155 2e -153 3e -152 5e -137 4e -132 7e -129 7e -129 2e -128 8e -122 5e -23 2e -20 3e -19 1e -18 4e -18 1e -17 5e -16 5e -16 5e -16 5e -16 7e -15 7e -15 7e -15 7e -15 2e -14 2e -14 2e -14 2e -14 3e -13

% Identidad 79% 79% 78% 76% 76% 78% 77% 77% 76% 75% 75% 75% 75% 76% 72% 71% 71% 70% 70% 71% 71% 71% 71% 71% 72% 68% 69% 66% 71% 71% 69% 71% 70%

Tabla 6. Niveles de similitud entre la secuencia de 800 pb. identificada en lulo y los genes ppo reportados en otras especies.

de 756 nucletidos en la cadena positiva, que se inicia en la posicin 45 y se extiende hasta la posicin 800. La protena deducida de este segmento tiene 252 aminocidos (Figura 3). El anlisis BLAST para la secuencia de aminocidos deducida del fragmento estudiado revel valores de similitud que oscilan entre
El Astrolabio

66 y 78% con las protenas PPO de papa, tomate, tabaco y berenjena (Tabla 7). Tal como ocurri con el anlisis del fragmento de DNA, la seccin de protena derivada de la secuencia identificada en lulo muestra niveles de similitud menores con las PPO de especies pertenecientes a las familias Convolvulaceae, Rosaceae, Salicaceae, Vi-

25

1 MGTIENIPHNAVHVWVGDPRQPNGEDMGNFYSSGLEPAFFCHHSNVDRMWNEWKAIGGKRRDLADKDWLN 71 TEFLFYDENR KLFRVRVRDC LDSKKMGFDY APMPTPWRNF KPSIRKTTAG KLNTSSIPPV SKVFPIPKLD 141 RPISFSINRP ASSRTQAEKN EQEEMLTFHK IQHNDRLYVR FDVFLNVDKT VNALELDQPE FAGSYTSLPH 211 VHGDDKPHAT SATLSLAITE LLEDNNLEDE ETIVVTLVPK VG
Figura 3. Secuencia de aminocidos deducida del fragmento identificado en lulo.

Descripcin de la protena PPO-B Papa (Solanum tuberosum) PPO-E Tomate (Solanum lycopersicum) PPO-A Papa (Solanum tuberosum) PPO-F Tomate (Solanum lycopersicum) PPO Tabaco (Nicotiana tabacum) PPO-POT33 Papa (Solanum tuberosum) PPO-C Tomate (Solanum lycopersicum) PPO-A Tomate (Solanum lycopersicum) PPO-B Tomate (Solanum lycopersicum) PPO Berenjena (Solanum melongena) PPO-POT32 Papa (Solanum tuberosum) PPO-D Tomate (Solanum lycopersicum) PPO Caqui (Diospyros kaki) PPO-POT72 Papa (Solanum tuberosum) PPO lamo (Populus trichocarpa) PPO Camelia amarilla (Camellia nitidissima) PPO-1 Trbol rojo (Trifolium pratense) PPO-1 Batata (Ipomoea batatas) PPO Uva (Vitis vinifera) PPO Cydonia oblonga PPO Pera (Pyrus pyrifolia) PPO Ciruela (Prunus salicina) PPO Diente de Len (Taraxacum officinale) PPO Nogal (Juglans regia) PPO Manzana (Malus domestica) PPO-2 Batata (Ipomoea batatas) PPO Pia (Ananas comosus)

Valor E 2e -114 4e -114 4e -111 1e -110 8e -110 2e -104 8e -101 2e -100 3e -100 5e -100 3e -97 1e -96 1e -92 3e -83 3e -60 1e -58 6e -58 1e -57 2e -57 2e -56 3e -56 3e -56 5e -56 2e -55 2e -55 3e -55 3e -55

% Identidad 77 78 76 75 75 70 69 69 67 67 66 66 78 70 44 45 43 48 46 45 46 45 44 44 46 48 43

Tabla 7. Niveles de similitud entre la protena hipottica deducida del fragmento de DNA identificado en lulo y polifenol oxidasas reportadas en otras especies.

taceae, Juglandaceae, Fabaceae, Bromeliaceae y Asteraceae entre otras. Ello se explica en funcin de la distancia filogentica que hay entre la familia Solanaceae y las familias antes referidas. Aunque la comparacin de los genes pone de manifiesto una mayor similitud entre el segmento de lulo y los genes

ppo A y B de papa, ppo-E de tomate, ppo de tabaco y ppo-F de tomate respectivamente, a nivel de protenas se observa una pequea diferencia: el grado de similitud que existe entre la protena PPO de tabaco y la protena de lulo es levemente menor al que hay entre sta ltima y las PPO A y B de papa y
Investigacin y Ciencia del Gimnasio Campestre

26

las PPO E y F de tomate. Esto responde al hecho de que el tabaco pertenece al gnero Nicotiana mientras que las especies antes mencionadas estn agrupadas en el gnero Solanum. La notable semejanza entre la seccin de protena deducida de la secuencia nucleotdica encontrada en lulo y la PPO del caqui (especie de la familia Ebenaceae que a su vez pertenece al orden Ericales) puede ser el reflejo de la relativa proximidad de los rdenes Ericales y Solanales.

tan determinar su capacidad para catalizar las reacciones de oxidacin de orto-difenoles a orto-diquinonas (Cary, et al., 1992; Eicken, et al., 1998).

BIBLIOGRAFA
Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990). Basic local alignment search tool. J. Mol. Biol., 215, 403-410. Cary, J.W., Lax, A.R. & Flurkey, W.H. (1992). Cloning and characterization of cDNAs coding for Vicia faba polyphenol oxidase. Plant Mol. Biol., 20, 245-253. Chen, W. & Kuo, T. (1993). A simple and rapid method for the preparation of gram-negative bacterial DNA. Nucl. Acids Res., 21, 2260. Doyle, M. & Doyle, A. (1990). Isolation of DNA from small amounts of plant tissues. BRL Focus, 12, 13-15. Eicken, C., Zippel, F., Buldt-Karentzopoulos, K. & Krebs, B. (1998). Biochemical and spectroscopic characterization of catechol oxidase from sweet potatoes (Ipomoea batatas) containing a type-3 dicopper center. FEBS Lett., 436, 293-299. Fuerst, E.P., Anderson, J.V., & Morris, C.F. (2006). Delineating the role of polyphenol oxidase in the darkening of alkaline wheat noodles. J. Agric. Food Chem., 54, 2378-2384. Goldman, M.H., Seurinck, J., Marins, M., Goldman, G.H. & Mariani, C. (1998). A tobacco flower-specific gene encodes a polyphenol oxidase. Plant Mol. Biol., 36, 479-485. Hunt, M.D., Eannetta, N.T., Yu, H., Newman, S.M. & Steffens, J.C. (1993). cDNA cloning and expression of potato polyphenol oxidase. Plant Mol. Biol., 21, 59-68. Larkin, M.A., Blackshields, G., Brown, N.P., Chenna, R., McGettigan, P.A., McWilliam, H., Valentin, F., Wallace, I.M., Wilm, A., Lpez, R., Thompson, J.D., Gibson, T.J., & Higgins, D.G. (2007). Clustal W and Clustal X version 2.0. Bioinformatics, 23, 2947-2948. Martnez, M.V. & Whitaker, J.R. (1995). The biochemistry and control of enzymatic browning. Trends Food Sci. Technol., 6, 195-200. McEvily, A.J., Iyengar, R., & Otwell, W.S. (1992). Inhibition of enzymatic browning in foods and beverages. Crit. Rev. Food Sci. Nutr., 32, 253-273.

CONCLUSIONES
Los anlisis BLAST efectuados a los iniciadores utilizados en este estudio demuestran que la manera como fueron diseados les confiere la capacidad de amplificar exclusivamente el fragmento correspondiente a la regin 3 de genes ppo, hecho que abre la posibilidad de que estos sean empleados para trabajos similares en otras especies de dicotiledneas. El anlisis global de los resultados logrados por Pulido y Nez (2009) en la caracterizacin de la regin 5 de un candidato a gen ppo en lulo junto con los presentados en este estudio se constituye en evidencia de que los fragmentos de DNA reportados corresponde a un gen ppo. De otro lado, los porcentajes de similitud entre la secuencia de lulo analizada y las secuencias homlogas en otras especies (en trminos de nucletidos y de aminocidos) reflejan de manera clara la distancia filogentica existente entre los individuos comparados. Si bien el examen de un fragmento de DNA en trminos de su secuencia de nucletidos, el nivel de homologa respecto a otros genes y la existencia de secuencias que codifiquen para algn tipo de protena pueden constituirse en evidencias de la existencia de protenas PPO en lulo, la prueba definitiva consiste en expresar el gen aislado, purificar la protena obtenida y hacer pruebas de actividad sobre sustratos especficos que permiEl Astrolabio

27

Newman, S.M., Eannetta, N.T., Yu, H., Prince, J.P., de Vicente, M.C., Tanksley, S.D. & Steffens, J.C. (1993). Organisation of the tomato polyphenol oxidase gene family. Plant Mol. Biol., 21, 1035-1051. Pulido, M. & Nez, V.M. (2009). Aislamiento y caracterizacin molecular de un fragmento de DNA genmico correspondiente a un gen que codifica para una polifenol oxidasa (PPO) en lulo (Solanum quitoense Lam.). El Astrolabio, 8, 20-29. Rensink, W.A., Lee, Y., Liu, J., Iobst, S., Ouyang, S., & Buell, C.R. (2005). Comparative analyses of six solanaceous transcriptomes reveal a high degree of sequence conservation and species-specific transcripts. BMC Genomics, 6, 124. Recuperado el 2 de marzo de 2009, de http://www.biomedcentral. com/1471-2164/6/124 Rychlik, W. & Rhoads, R.E. (1989). A computer program for choosing optimal oligonucleotides for filter hybridization, sequencing and in vitro amplification of DNA. Nucl. Acids Res., 17, 8543 - 8551.

Rychlik, W., Spencer, W.J., & Rhoads, R.E. (1990). Optimization of the annealing temperature for DNA amplification in vitro. Nucl. Acids Res., 18, 6409 6412. Sanger, F., Nicklen, S. & Coulson, A.R. (1977). DNA sequencing with chain-terminating inhibitors. Proc. Natl. Acad. Sci. USA., 74, 5463-5467. Thygesen, P.W., Dry, I.A. & Robinson, S.P. (1995). Polyphenol Oxidase in potato. A multigene family that exhibits differential expression patterns. Plant Physiol., 109, 525-531. Vaughn, K.C. & Duke, S.O. (1981). Tentoxin-induced loss of plastidic polyphenol oxidase. Physiol. Plant., 53, 421-428. Vaughn, K.C., Lax, A.R. & Duke, S.O. (1988). Polyphenol oxidase: The chloroplast oxidase with no established function. Physiol. Plant., 72, 659-665.

Investigacin y Ciencia del Gimnasio Campestre