Вы находитесь на странице: 1из 48

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

INJEKSI

(ReNewby:Meta)

I. PENDAHULUAN
A. DefinisidanPenggolongan
1. Injeksi(FIIII,hal13)Injeksiadalahsediaansterilberupalarutan,emulsi,ataususpensiatau
serbuk yang harus dilarutkan atau disuspensikan lebih dahulu sebelum digunakan, yang
disuntikkandengancaramerobekjaringankedalamkulitataumelaluikulitatauselaputlendir.
2. Injeksivolumekeciladalahinjeksiyangdikemasdalamwadah100mlataukurang(FIIV,hal
10)
Sediaansteriluntukkegunaanparenteraldigolongkanmenjadi5jenisyangberbedayaitu(FIIV,
hal910):
1. Obatataularutanatauemulsiyangdigunakanuntukinjeksi,ditandaidengannamaInjeksi..
2. Sediaanpadat,kering,ataucairanpekattidakmengandungdapar,pengencer,ataubahanlain
dan larutan yang diperoleh setelah penambahan pelarut yang sesuai memenuhi persyaratan
injeksi,dandapatdibedakandarinamabentuknyadisebut.steril.
3. Sediaansepertiterterapada2,tetapimengandungsatuataulebihdapar,pengencerataubahan
tambahanlaindandapatdibedakandarinamabentuknya,disebut.untukinjeksi.
4. Sediaanberupasuspensiserbukdalammediumcairyangsesuaidantidakdisuntikkansecaraiv
ataukedalamsaluranspinal,dandapatdibedakandarinamabentuknya,disebutSuspensi.
Steril.
5. Sediaanpadatkeringdenganbahanpembawayangsesuaimembentuklarutanyangmemenuhi
semua persyaratan untuk suspensi steril setelah penambahan bahan pembawa yang sesuai,
dibedakandengannamasteriluntuksuspensi.
B. KeuntungandanKerugianSediaanInjeksi
(DiktatKuliahTeknologiFarmasiSediaanSteril1011)
Keuntungan
Dapatdicapaiefekfisiolgissegera,untukkondisipenyakittertentu(Jantungberhenti)
Dapat diberikan untuk sediaan yang tidak efektif diberikan secara oral (tidak tahan asam
lambung)
Baik untuk penderitayang tidakmemungkinkanmengkonsumsi oral (Sakit jiwa atautidak
sadar)
Pemberianparenteralmemberikankemungkinanbagidokteruntukmengontrolobat,karena
pasienharuskembalimelakukanpengobatan
Sediaanparenteraldapatmenimbulkanefeklokalsepertipadakedokterangigi/anastesiologi
Pengobatanparenteralmerupakansalahsatucarauntukmengoreksiganggunseriuscairandan
keseimbangnelektrolit
Kerugian
Pemberiansediaanparenteralharusdilakukanolehpersonelyangterlatihdanmembutuhkan
waktupemberianyanglebihlama
Pemberianobatsecaraparenteralsangatberkaitandenganketentuanproseduraseptikdengan
rasanyeripadalokasipenyuntikanyangtidakselaludapatdihindari
Bilaobattelahdiberikansecaraparenteral,sukarsekaliuntukmenghilangkan/merubahefek
fisiologisnyakarenaobattelahberadadalamsirkulasisistemik
Harganyarelatiflebihmahal,karenapersyaratanmanufakturdanpengemasan
Masalahlaindapattimbulpadapemberianobatsecaraparenteralsepertiseptisema,infeksi
jamur,inkompatibiliaskarenapencampuransediaanparenteraldaninteraksiobat
Persyaratan sediaan parenteral tentang sterilitas, bebas dari partikel partikulat, bebas dari
pirogen,danstabilitassediaanparenteralharusdisadariolehsemuapersonelyangterlibat.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Indikasipemakaianruteparenteral:(Lachman,18)
Untuk memastikan obat sampai ke bagian tubuh atau jaringan yang membutuhkan dengan
konsentrasiyangmencukupi.Meyakinkanpenyampaiankonsentrasiobatyangmencukupike
bagiantubuh/jaringansakit.
Untukmencapaiparameterfarmakologitertentuyangterkontrol,sepertiwaktuonset, serum
peak,kecepataneliminasiobatdaridalamtubuh.
Untukpasienyangtidakbisamelakukanselfmedicate
Untukmendapatkanefekbiologikyangtidakdidapatkanmelaluipemakaianoral
Untukalternatifbilaruteyangdiharapkan(oral)tidaktersedia
Untukmendapatkanefeklokal,untukmeminimalkanefektoxicsistemik
Untukpasienyangtidaksadar,tidakkooperatif,tidakterkontrol
Untuk pengobatan ketidakseimbangan elektrolit dan cairan untuk supply nutrisi jangka
panjang/pendek
Untukmendapatkanefeklokalyangdiharapkan
Faktorfarmasetikalyangberpengaruhpadapemakaianparenteral:(Lachman,19)
Kelarutanobatdanvolumeinjeksi
Karakteristikpembawa
pHdanosmolalitaslarutaninjeksi
bentuksediaan(cth:larutan,suspensi,ataurekonstitusi)
formulationingredient(eksipien)
C. BentukBentukSediaanParenteral(Codexhal9495)
1. LarutanAirMerupakanbentukyangpalingsederhanadanbanyakdigunakan. Bentuklarutan
airdapatdigunakanuntuksemuarutepemberian.
2. Suspensi air Suspensi biasanya diberikan dalam rute intramuskular dan subkutan. Suspensi
tidak pernah diberikan secara intravena, intraarteri, inraspinal, inracardiac, atau injeksi
optalmik.Partikelpadapadasuspensiharuskecildndistribusiukuranpartikelharusdikontrol
untukmeyakinkanpartikeldapatmelewatijarumsuntik.Ukuranpartikelsuspensibiasanya
kecildandistribusiukuranpaetikelharusdikontroluntukmeyakinkanpartikeldapatmelewati
jarumsuntiksaatpemberian,ukuranpaetikeltidakbolehmeningkatdantidakterjadicaking
saatpenyimpanan.
3. Suspensi Minyak Injeksi suspensi bisa juga dibuat dalam pembawa minyak, meskipun
pembuatannyalebihjarangdibandingsuspensiair.Suspensiminyakdapatmenimbulkanefek
depot/lepaslambatpadarutepemberianIM.
4. Injeksi Minyak Senyawa yang bersifat lip ofilik banyak yang dibuat dalam bentuk injeksi
minyak.SediaaninisecaraumumdigunakandenganruteIM,danpadakeadaannormaltidak
digunakanuntukrutelain.
5. Emulsi Zat yang bersifat lipofilik juga dapat dibuatdalam bentuk emulsi o/w. Zat dapat
dilarutkandalamlarutanminyakatauzatnyasendirisudahbenbentukminyak.Dropletminyak
harusdikontroldenganhatihatidanpadasaatpenyimpananemulsitidakakanpecah.Ukuran
dropletideal3mikrometer.Biasanyadalambentuknutrisiparenteral.
6. LarutanKoloidal
7. SistempelarutcampurBanyakkondisiklinikdimanapentingsuatuzatdibuatdalambentuk
larutansejati,agarsiapbercampurdenganlarutanIVketikadiberikan.Untukzatyangsukar
larutdalamair,makaselaindigunakandalambentukgaramataudiformulasidalampHtinggi
ataurendah,beberapazatdapatpuladiformulasidalampelarutcampur.Kosolventdigunakan
untukmenurunkanpolaritaspembawasehinggazatlebihlarut.Pemilihankosolventterbatas
olehtoksitas.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

8. Larutanterkonsentrasi
9. SerbukuntukinjeksiBeberapazatyangtidakstabildalamair,sehinggadibuatdalambentuk
serbukuntukinjeksi.Sediaaninibisaberupaserbukdryfilledatauserbukliofilisasi(freeze
dried).
10. Implant
D. FormulaUmumSediaanInjeksi
R/
ZataktifPembawa
Zattambahan
Zattambahaninidapatberupa:
Pengaturtonisitas
PengaturpH(dapar)
Pengawet
Antioksidan
Anestetiklokal
Zatpengompleks
Suspendingagent
1. ZatAktif
Datazataktifyangdiperlukan(Preformulasi)
a. Kelarutan (BukuPenuntunPraktikumBennyLogawahal9)Terutamadatakelarutandalam
airdarizataktifsangatdiperlukan,karenabentuklarutanairpalingdipilihpadapembuaan
sediaansteril.Datakelarutaninidiperlukanuntukmenentukanbentuksediaan.Zataktifyang
larutairmembentuksediaanlarutandalamair,zataktifyanglarutminyakdibuatlarutandalam
pembawa minyak. Sedangkan zat yang tidak larut dalam kedua pembawa tersebut dibuat
sediaansuspensi.Jikazataktiftidaklarutdalamairadabeberapaalternatifyangdapatdiambil
sebelum memutuskan untuk membuat sediaan suspensi atau larutan minyak yaitu dengan
mencari bentuk garam dari zat aktif, melakukan reaksi penggaraman, atau dicari bentuk
kompleksnya.
b. pHstabilita(BukuPenuntunPraktikumBennyLogawahal10)pHstabilitaadalahpHdimana
penguraianzataktifpalingminimal,sehinggadiharapkankerjafarmakologinyaoptimal.pH
stabilitadicapaidenganmenambahkanasam encer (spt: HCl encer, asambikarbonat),basa
lemahataudaparisotonis(spt:fosfat,sitrat,dll).
c. Stabilitaszataktif (BukuPenuntunPraktikumBennyLogawahal11)Datainimembantu
menentukan jenis sediaan, jenis bahan pembawa, metoda sterilisasi atau cara pembuatan.
Beberapafactoryangmempengaruhipenguraianzataktifadalah:
1. Oksigen(Oksidasi)
Padakasusini, setelahairdididihkanmaka perludialiri gas nitrogendanditambahkan
antioksidan.
2. Air(Hidrolisis)
Jikazataktifteruraiolehairdapatdipilihalternatif:(a)Dilakukanpenambahanasam/basa
ataubufferuntukmencapaipHstabilitasZ.A;(b)Memilihjenispelarutdenganpolaritas
lebihrendahdaripadaair,seperticampuranpelarutairgliserinpropilenglikolataupelarut
campurlainnyayangcocok;(c)Dibuatdalambentukkeringdansterilyangdilarutkansaat
disuntikkan.
3. Suhu
Jikazataktiftidaktahanpanasdipilihmetodesterilisasitahanpanas,sepertifiltrasi
0 4. Cahaya
0
Pengaruhcahayamataharidihindaridenganpenggunaanwadahberwarnacokelat.
d. Taktersatukannyazataktif,Baikditinjaudarisegikimia,fisika,ataufarmakologi.
e. Dosis,Datainimenentukantonisitaslarutandancarapemberian.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

f.
0
1
0

Rutepemberian (LachmanParenteral,1992,hal:174)Rutepemberianyangakandigunakan
akanberpengaruhpadaformulasi,dalamhal:
Volumemaksimalsediaanyangdapatdiberikanpadarutetersebut(Lihatdatanyapadabagian
rutepemberian).
Pemilihanpelarutdisesuaikandenganrutepemberian
Isotonisitas dari sediaan juga dipengaruhi oleh rute pemberian. Pada larutan intravena
isotonisitas menjadi kurang penting selama pemberian dilakukan dengan perlahan untuk
memberikan waktu pengenceran dan adjust oleh darah. Injeksi intraspinal mutlak harus
isotonis.

2. BahanPembawaObatsuntik
Bahanpembawainjeksidapatberupaairmaupunnonair
PembawaAir
Sebagian besar produk parenteral menggunakan pembawa air. Hal tersebut dikarenakan oleh
kompatibilitas air dengan jaringan tubuh. Pembawa air dapat digunakan untuk berbagai rute
pemberian. Air mempunyai konstanta dielektriktinggi sehingga lebihmudah untukmelarutkan
elektrolit yang terionisasi dan ikatan hidrogen yang terjadi akan memfasilitasi pelarutan dari
alkohol,aldehid,keton,danamin(Lachmanhal175).SyaratairuntukinjeksimenurutUSP(Diktat
KuliahTeknologiSediaanSterilHal149):
Harusdibuatsegar*danbebaspirogen
Jumlahzatpadatterlaruttotaltidakbolehlebihdari10ppm.
pHantara57
Tidakmengandungionionklorida,sulfat,kalsiumdanamonium,dankarbondioksida.
Kandunganlogamberatterbatas
Kandunganmaterialorganik(spt:tanin,lignin)terbatas
Jumlahpartikelberadapadabatasyangdiperbolehkan.
Catatan:
1. Airuntukinjeksiharusdibuatsegar,artinya:airyangtelahselesaidiproses,hanyaboleh
disimpan pada temperature kamar selama 24 jam (bila tidak langsung digunakan).
Penyimpananyanglebihlamadapatdilakukanpadatemperaturekirakira5Cataupada
suhutinggiyaituantara6585untukmencegahpertubuhanjasadrenikdanpembentukan
pirogen.
2. Persyaratankadartotalzatpadatterlarut padaairsteriluntukinjeksiyangterdapatpada
farmakope (FI IV, hal 113) biasanya lebih tinggi kemungkinan terjadinya pelepasan
konstituenwadahgelasselamasterilisasi.
3. Air untuk injeksi yang sudah mengandung zat bakteriostatik tidak boleh dijual dalam
wadah yang lebih besar dari 30 ml untuk mencegah kemungkinan masuknya zat
bakteriostatikyangmungkintoksikdalamjumlahyangbesarkedalamtubuh.
a. AirProInjeksi
AquasterilProInjeksiadalahairuntukinjeksiyangdisterilisasidandikemasdengancarayang
sesuai,tidakmengandungbahanantimikrobaataubahantambahanlainnya(Monografiaquap.i
:FIIVhal.112113).
Cara : Aqua p.i + karbon aktif 0,1% dari volume, dipanaskan 6070C selama 30 menit,
kemudian saring panaspanas dengan kertas saring lapis ganda. Tidak boleh menggunakan
AquaDMkarenaadazatzatorganikyangtidakbermuatandapatlolos,ditanggulangidengan
filtrasikarbonadsorbendanfiltrasibakteri
b. AirProInjeksiBebasCO2
CO2 mampu menguraikan garam natrium dari senyawa organic seperti barbiturate
dansulfonamide kembali membentuk asam lemahnya yang mengendap.Cara pembuatan :
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Mendidihkanairp.iselama2030menitlaludialirigasnitrogensambildidinginkan.(Rep.Tek
Fa.Sterilhal4)
c. AirProInjeksibebasO2
Dibuatdenganmendidihkanairp.iselama2030menitdanpadasaatpendinginannyadialiri
gasnitrogenDipakaiuntukmelarutkanzataktifyangmudahteroksidasi,sepertiapomorfin,
klorfeniramin, klorpromazin, ergometrin, ergotamine, metilergotamin, proklorperazin,
promazin,promesatinHCl,sulfamidin,turbokurarin.(Rep.TekFa.Sterilhal4)
PembawaNonAir
Pembawanonairdigunakanjika(Rep.TekFa.Sterilhal5):
Zataktiftidaklarutdalamair
Zataktifteruraidalamair
Diinginkankerjadepodalamsediaan
Syaratumumpembawanonair(DiktatKuliahTeknologiSediaanSterilHal153):
Tidaktoksik,tidakmengiritasidanmenyebabkantidakmenyebabkansensitisasi
Dapattersatukandenganzataktif
Inertsecarafarmakologi
Stabildalamkondisidimanasediaantersebutbiasadigunakan
Viskositasnyaharussedemikianrupasehinggadapatdisuntikandenganmudah
Harustetapcairpadarentangsuhuyangcukuplebar
Mempunyaititikdidihyangtinggisehinggadapatdilakukansterilisasidenganpanas
Dapatbercampurdenganairataucairantubuh
a. Pelarutnonairyangdapatbercampurdenganair
Pelarutorganikyangbercampurdenganairdapatdijadikankosolvendalamsediaaninjeksi,
bertujuan untuk meningkatkan kelarutan suatu zat aktif yang kurang larut dalam air serta
meningkatkanstabilitaszattertentuyangmudahterhidrolisis.Pelarutyangdapatdigunakan
adalah : etanol, propilenglikol, polietilenglikol dan gliserin. Campuran pelarut dapat
menyebabkaniritasiataupeningkatantoksisitas,terutamajikadigunakandalamkonsentrasi
tinggi.Larutanyangmengandungetanoldengankonsentrasitinggidapatmenimbulkanrasa
sakitketikadisuntikkan.Yangharusdiperhatikanjuga,beberapaprodukyangdiberikansecara
intravenadengankecepataninjeksiyangterlalucepatdapatmenyebabkanpengendapanobatdi
dalampembuluhdarah.(Lachmanhal19)
KONSTANTADIELEKTRIKPELARUTPADA25oC(Lachmanparenteralhal178)
Pelarut
Konstantadielektrik
Air
78,5
Gliserina
40,1
N,NDimetilasetamida
37,8
Propilenglikola
32,01(30)
Metanol
31,5
Etanola
24,3
NPropanol
20,1
aseton
19,1
Benzilalkohola
13,1
Polietilenglikol400
12,5
Minyakbijikapasa
3,0
Benzen
2,3
Dioxane
2,2
a=larutanyangdipakaidalamsediaaninjeksi
b. Pelarutnonairyangtidakdapatbercampurdenganair
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Penggunaan pelarut minyak bertujuan untuk meningkatkan kelarutan zat aktif dan untuk
membuat sediaan lepas lambat. Injeksi pembawa minyak hanya dapat diberikan secara IM
(Diktat Kuliah Teknologi Sediaan Steril Hal 149). Salah satu persyaratan minyak untuk
parenteraladalahharustetapjernihbiladidinginkansampai10 oCuntukmenjaminkestabilan
dankejernihanselamadisimpandilemaripendingin.Jenispembawanonairyangtidakdapat
bercampurdenganairyangdapatdigunakansebagaipembawasediaaninjeksiadalah:
a. Minyaklemak(DiktatKuliahTeknologiSediaanSterilHal156):
Campuranesterasamlemakdangliserol
Padalabelsediaanharusdicantumkanjenispembawaminyakyangdigunakankarenapada
beberapaorangdapatmenimbulkanreaksialergi.
Tidak boleh mengandung minyak mineral atau parafin cair (karena tidak dapat
dimetabolismedalamtubuhdandapatmenimbulkanreaksiterhadapjaringanatautumor).
(Rep.TekFa.Sterilhal5)
Minyakyangdigunakanharusberbentukcairpadasuhukamardantidakbolehmenjadi
tengik. Untuk mencegah ketengikan akibat oksidasi maka dalam formula dapat
ditambahkanantioksidansepertiBHA,BHT,tokoferol,propilgalat,dll.
Minyakwijen(sesameoil)lebihbanyakdigunakanuntuksebagianbesarinjeksipembawa
minyak,karenamerupakanminyakyangpalingstabildibandingkanminyaktumbuhanlain
(kecualiterhadapcahaya)dandidalamnyasudahmengandungantioksidanalami.(Lachman
parenteral192)
Minyak tumbuhan sering menimbulkan rasa nyeri sehingga perlu penambahan benzil
alkohol0,5%sebagaianastetiklokal(Rep.TekFa.Sterilhal5)
Minyaknabatiyangbanyakdigunakan:Ol.Arachidis(minyakkacang),Ol.Gossypii,Ol.
Sesami(MinyakWijen),Ol.Terebinthinae,Ol.Maydis(minyakjagung),Ol.Olivarum
Netral(MinyakZaitun),Ol.Amigdalarum.(Rep.TekFa.Sterilhal5)
Pembawanonair(FIIVHal10)
Minyak lemak tidak berbau atau hampir tidak berbau, tidak tengik. Harus memenuhi
persyaratan uji parafin padat seperti yang tertera pada minyak mineral, tangas pendingin,
dipertahankansuhu10C,bilanganpenyabunanantara185200,bilanganiodium79128seperti
terterapadalemakdanminyaklemak<491>danmemenuhisyaratsebagaiberikut:
a. Bahantaktersabunkan:Memenuhisyarat BahanTakTersabunkan sepertiterteradalam
lemakdanminyaklemak<491>FIEd.IV
b. Asam lemak bebas : Tidak lebih dari 2,0 ml NaOH 0,002 N LV diperlukan untuk
menetralkanasamlemakbebasdalam10gramminyaklemak,seperti<471>FIEd.IV
c. Monogliseridadangliseridasintetikdariasamlemak:Dapatdigunakanjikaberupacairan
dantetapjernihkalaudidinginkanpadasuhu10Cdanbilanganiodiumtidaklebihdari140,
seperti<491>FIEd.
b.

Isopropilmiristat(DiktatKuliahTeknologiSediaanSterilHal157)
Esterasamlemakyangmempunyaiviskositasrendah
Sebagaipembawatunggalataukombinasidenganminyaklemak
Digunakanjenisyangbebasperoksidakarenamencegahteroksidasinyabahanberkhasiat
danminyakyangdigunakan.

c. Benzilbenzoat(DiktatKuliahTeknologiSediaanSterilHal157)
Merupakan cairan berminyak yang tidak berwarna dan bau yang khas. Biasanya
digunakanbersama dengan pembawa lain (sebagai kosolven) misal pada injeksi dimerkapol
danhidroksiprogesteron.
d. Etiloleat(DiktatKuliahTeknologiSediaanSterilHal157)
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Viskositaslebihrendahdanlebihmudahdiabsorpsiolehjaringandibandingkandengan
minyaklemak.
Sebagai pembawa tunggal atau kosolven dalam injeksi hormon seperti injeksi
deoksikortisonasetat,estradiolmonobenzoat,progerterondantestosteronpropionat.
INJEKSIDALAMMINYAK
(Lachman2ndEdHal:193)
USPXXII

MINYAKYANGBIASADIPAKAI

Ampicillin(suspensi)
Desoxycortisonasetat
Dietilstilbestrol
Dimerkapol(suspensi)
Epinefrin(suspensi)
Estradiolbenzoat
Estradiolsipionat
Estradiolvalerat
Estron
Ethiodizediodin
Flufenazinenanthate

Sayur
Sesame
Sesame
Kacang
Sesame
Sesame
Bijikapas
Sesame
Sesame
Poppyseed
Sesame

Hidroksiprogesteronkaproat

Sesame

Menadion
Nandrolonedecanota

Sesame
Sesame

PenisilinGprokain(suspensi)

Sayur

Propiliodon(suspensi)
Testosteronsipionat
Testosteronenanthat
Testosteronpropionat

Kacang
Bijikapas
Sesame
Sesame

3. PenjelasanMasingmasingBahanPembantu/ZatTambahan
Zattambahanpadasediaansterildigunakanuntuk:
Meningkatkankelarutanzataktif
Menjagastabilitaszataktif
Menjagasterilitasuntuksediaanmultipledose
Mempermudahdanmenjagakeamananpemberian
Syaratbahantambahan:
Inertsecarafarmakologi,fisika,maupunkimia
Tidaktoksikdalamjumlahyangdiberikan
Tidakmempengaruhipemeriksaanobat
a. PengaturTonisitas
Jikasuatularutankonsentrasinyasamabesardengankonsentrasidalamseldarahmerahsehingga
tidakterjadi pertukaran cairan di antara keduanya, maka larutan tersebut dikatakan isotonis
(ekivalendengan0,9%NaCl)(B.LogawadanS.Noerono,Rep.TekFarSediansteril)Seldarah
merahdalamlarutan:
hipotonis :mengembangkemudianpecah,karenaairberdifusikedalamsel(hemolisis).Keadaan
hipotoniskurangdapatditoleransi,karenapecahnyaselbersifatirreversibel.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

hipertonis:kehilanganairdanmengkerut(krenasi),keadaaninicukupdapatditoleransi.
Larutanperluisotonisagar:
Mengurangikerusakanjaringandaniritasi
Mengurangihemolisisseldarah
Mencegahketidakseimbanganelektrolit
Mengurangisakitpadadaerahinjeksi(Lachman,Teori&Praktek,ed.3,1994,hal.1302)
Larutanisotonistidakselalumungkinkarena:
konsentrasiobattinggi,tetapibatasvolumeinjeksikecil
variasidosispemberian
metodepemberian
pertimbanganstabilitasproduk
Contohpengaturtonisitas(padakeadaanhipotonis)
NaCl0,9%,Glukosa,NatriumSitrat,NatriumSulfat1,6%,Dekstrosa5,5%
Sifat
pH
Kelarutan

NaCl
6,77,3

Sukrosa
Glukosa
konstanta disosiasi ; 3,55,5
pKa=12,62
1 dalam 2,8 bagian 1dalam0,5bagianair 1dalam1bagianair
air 1 dalam 2,6 1dalam0,2air1000C
bagianair1000C

Cara
Sterilisasi
Inkompatibili
tas

Otoklaf,filtrasi

otoklaf dan filtrasi,


dalambentuklarutan
besi, perak, timbal, Asam
merkuri, oksidator askorbat,alumunium,
kuat,metilparaben
asamlemahataukuat

otoklaf, dalam bentuk


larutandalamair
sianokobalamin;
kanamisin

sulfat;
novobiosin natrium;
warfarin

natrium;
eritromisingluseptatpada
pH ,5,05; vitamin B
kompleks terdekomposisi
basa kuat; dalam bentuk
aldehid inkompatibel
dengan amin, amida,
asam amino, peptida dan
protein

Keamanan

nontoksik,noniritan

Osmolaritas

5,51 % b/v isoosmosis,


0,9 % b/v = iso 9,25 % b/v = iso namun tidak isotonik,
osmosis
osmosis
dapat menyebabkan
hemolisis.

tidak untuk penderita


DM atau intoleransi
metabolicsukrosa.

(HOPE,ed.4,2003,h.200,556,
622)
b. PengaturpH(dapar)
PengaturanpHsediaandapatdilakukandengan2carayaituadjustpHdanpemakaiandapar.
Dapar(lachmanparenteral,hal194):PerubahanpHpadapenyimpanandapatdisebabkan:
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Reaksidegradasiproduk
Interaksidengankomponenwadah(kacaataututupkaret)
Pelarutangasdanuap

TujuanDapar(Rep.Tek.Far.Sed.Sterilhal1920)

Meningkatkan stabilitas obat Ket : pada pH tertentu penguraian obat menjadi minimal,
misalnya pada zat aktif berikut : antibiotik (penisilin, tetrasiklin), basa sintetis (adrenalin),
polipeptida(insulin,oksitocin,vasopresin),alkaloida(senyawaergot),vitamin(B12,vitC).

Mengurangirasanyeri,iritasi,nekrosissaatpenggunaanya. Ket:penambahanlarutandapar
dalamlarutaninihanyadilakukanuntuklarutanobatsuntikdenganpH5,57,5.UntukpH<
3atau>10sebaiknyatidakdidaparkarenasulitdinetralisasikan.Peringataniniditujukan
terutamauntukinjeksii.mdans.c.
Untuksediaanparenteralvolumekecil(<100ml),dapardapatdibuatbilapHstabilitassediaan
beradadidalamrentang(Lachmanparenteral,hal195):
IV(SVP)
=pH310,5;karenadarahmerupakansistembufferyangbaik.
Rutelain
=Ph49

MenghambatpertumbuhanmikroorganismeKet:bukantujuandaparyangsebenarnya,tetapi
larutandalamsuasanasangatasamatausangatbasadapatdigunakanuntukmencapaimaksud
maksudtersebut,misalnyainjeksiinsulinyangpHnyadiaturantara33,5tidakmembutuhkan
penambahanantimikroba.

Meningkatkanaktifitasfisiologisobat.Ket:sebagaicontohdapatdiketengahkanmisalnya
campurankeringdansterildaparpHbasadenganzataktifatauobatyangsifatnyaasam(prokain
adrenalin).Campurankeringtersebutbarudilarutkandalamairproinjeksisecaraaseptissesaat
sebelumdigunakan.JaditampakbahwapeningkatanpHdilakukansampaibatastertentudimanazat
aktifmasihstabildenganaktifitasfisiologisyangmaksimal.
pHidealdarisediaanadalah7,4yangsesuaidenganpHdarah,tetapihaltersebuttidakselaludapat
dilakukan karena sediaan harus dibuat pada pH yang mendukung stabilitas dari sediaan
(disesuaikandenganpHstabilitaszataktifbukanpHlarutan).Daparyangidealmemilikikapasitas
daparyangcukupuntukmenjagapHsediaanselamapenyimpanan,namunmemungkinkancairan
tubuhberadaptasidenganmudah.RentangpHyangtidakdapatditoleransiolehtubuh:

pH>9menyebabkankematianjaringan

pH<3sangatmenyakitkandanmenyebabkanflebitis(Lachmanparenteral,hal195)
CarapenentuanpH:
Memakai indikator kertas atau indikator larutan universal baik secara langsung maupun
kolorimetri
Potensiometri,digunakanuntuklarutanberwarna
Denganperhitungan
Contohdapar:Daparfosfat,daparsitrat,asamasetat/garampH3,55,7;asamsitrat/garampH
2,56;asamglutamatepH8,210,2.(Lachman,parenteraldosageform,vol.1hal194)
c.Pengawet (Lachman,TeoridanPraktekFarmasiIndustri,hal.1298)
Pengawetyangideal(ToddR.GPharmaceuticalHandbook):
1
Mempunyaiaktivitasantimikrobayangtinggidanspektrumnyaluas,bekerjapadatemperatur
danpHyangluas.
2
MempunyaistabilitasyangtinggipadarangetemperaturdanpHyangdigunakan
3
Tidaktoksikpadakonsentrasiyangdigunakan
4
Tersatukandengankomponenlaindalamsediaan
5
Cepatlarutpadakonsentrasiyangdigunakan
6
Bebasdaribau,rasa,warna
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Tidak menyebabkan keracunan, karsinogenik, iritan, dan menyebabkan sensitisasi pada


konsentrasiyangdigunakan

Penambahanpengawetdapatdilakukanpada:
Sediaanmultidosis(kecualiyangdilarangolehmonografi,atauZAbersifatbakteriostatik)Pada
sediaanmultidosisadakemungkinankontaminasisediaanpadasaatpemakaiankembali,dan
pengawetbekerjasecarabakteriostatik.
Sediaanunitdosisjikatidakdilakukansterilisasiakhir(pembuatanaseptikataudenganfiltrasi
membrane), karena ada kemungkinan kontaminasi pada saat pengisian, dll) sering juga
ditambahkanpengawet.
(Lachmanparenteralhal:204)
Penambahanpengawettidakdibenarkanpada:
Sediaanvolumebesar(>100ml,misalnyainfus)
Volumeinjeksi>15mLdosistunggal,kecualijikadikatakanlain
Sediaanuntukrute2tertentuyangtidakbolehditambahkanantimikrobasepertiintrasisternal,
epidural,intrathekal,ataurutelainyangmelaluicairanserebrospinal/retrookulalar(British
pharm.,volII,2002,hal:1889)
ContohPengawet:(Lachman,L.Pharm.DosageForm:ParenteralMedication.Vol.I,1992,hal.
194)
Pengawet

Konsentrasi yang lazim


(%)
Benzalkoniumklorida
0.01
Benzethoniumklorida
0.01
Benzilalkohol
12
Klorobutanol
0.250.5
Klorokresol
0.10.3
Metakresol
0.10.3
Kresol
0.30.5
Fenol
0.250.5
Fenilmerkurinitratdanasetat
0.002
Metilphidroksibenzoat
0.10.2
Propilphidroksibenzoat
0.020.2
Butilphidroksibenzoat
0.015
Timerosal
0.01
:Theartscience,andtechnologyofPharmaceuticalCompounding,1998,hal254
d. Antioksidan
Antioksidandigunakanuntukmelindungizatyangpekaterhadapoksidasi. Beberapaantioksidan
berdasarkanmekanismekerjanya(Lachman,Teori&Praktek,ed.3,1994,hal.1301):
1. AgenPereduksi
Antioksidaninimempunyaipotensialoksidasirendahsehinggateroksidasilebihdahulu
daripadazataktif.
Contoh:

VitaminC
Natriumbisulfit
Natriumpirosulfit
Tiourea

16

0,020,1%
0,10,15%
0,10,15%
0,005%

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

2. AgenPemblokir
Antioksidaninimencegahoksidasidenganmemutuskanrantaioksidasi.
Contoh:Esterasamaskorbat0,010,015%BHA&BHT0,0050,02%VitaminE0,05
0,075%
3. ZatSinergis
Bekerjameningkatkanefekantioksidanlainnyaterutamaantioksidanagenpemblokir.
Contoh:VitaminC0.010.05%
Asamsitrat0.0050.01%
Asamtartrat0.010.02%
4. Pengompleks
Zatinimembentukkompleksdenganionionlogamyangmengkatalisisreaksioksidasi
sehinggareaksidapatdiperlambat.Contoh:GaramEDTA0.010.075%Selainitujuga
dapat meningkatkan efektivitas pengawet, seperti benzalkonium klorida dengan EDTA,
sertauntuksolubilisasi,misal:Kofein+Na.benzoateTeofilin+EtilendiaminKinin+
Antipirin
Catatan:
Natrium meta bisulfit larutan bersifat asam, Natrium bisulfit biasa digunakan untuk
injeksi epineprin, juga digunakan untuk larutan dengan pH sedang, Na sulfit biasa
digunakanuntuksediaanpHbasa(TPC,1994,Hal100)
Zatantioksidanyanglarutlemak(BHAdanBHT0,005%0,02%)digunakanuntuk
pelarutminyak(blockingagent)
e.SuspendingAgent(Lachman,Parenteral)
Digunakanuntuksediaaninjeksisuspensi:Contoh:Air:CMCNa.(0,050,75%)HOPE,2003
hal97,Tylosa(0,25%),PVP(diatas5%)HOPE,2003hal508,Sorbitol(1025%)IMMinyak:
Alumuniummonostearat(2%)Codexhal95,gelatin(2%),manitol(50%)
f.Anestetikalokal
Digunakanuntukmengurangirasanyeriakibatlarutansuntikyangkentaldanlarutansenyawaobat
yang terlalu asam. Seperti larutan obat suntik streptomycin + 0,5 % prokain HCl. Contoh :
Novokain,Benzilalkohol.
g.WettingAgent
Digunakan untuk pembasah dan mencegah pertumbuhan kristal. Bila diperlukan dan hanya
untukpelarutair.Contoh:Tween80,Propilenglikol,Lecithin,PolioksietilenPolioksipropilen,
Polisorbat80,Silikonantibusa,SilikonTrioleat.(Lachman,Parenteralhal214)
h.SolubilizingAgent(Lachman,Parenteralhal214)Contoh:PEG300,Propilenglikol
E.CaraPerhitungan(BennyLogawa,hal.8)
Tonisitas
1.MetodeTurunnyaTitikBeku
Denganmenggunakanpersamaan:

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

W=Jumlah(g)bahanpembantuisotonidalam100mllarutan
A=Turunnyatitikbekuairakibatzatterlarut,dihitungdenganmemperbanyaknilaiuntuklarutan
1%
B = Turunnya titik beku air yang dihasilkan oleh 1% b/v bahan pembantu isotoni Atau jika
konsentrasitidakdinyatakan,a=0

Keterangan:
Tb
=turunnyatitikbekularutanterhadappelarutmurninya
K
= turunnya titik beku pelarut dalam MOLAR (konstanta Kryoskopik air = 1,86 yang
menunjukkanturunnyatitikbeku1molzatterlarutdalam1000gcairan)
m
=Zatyangditimbang(g)
n
=jumlahion
M
=beratmolekulzatterlarut
L
=massapelarut(g)
2.EkivalensiNaCl
Didefinisikan sebagai suatu faktor yang dikonversikan terhadap sejumlah tertentu zat terlarut
terhadapjumlahNaClyangmemberikanefekosmotikyangsama.MisalnyaekivalensiNaClasam
borat0,55berarti1gasamboratdidalamlarutanmemberikanjumlahpartikelyangsamadengan
0,55gNaCl.

Olehkarenaituzataktifdengantipeionikyangsamadapatmenyebabkanturunnyatitikbekumolal
yangsamabesar,makaWellsmengatasinyadenganmenggolongkanzatzattersebutmenjadi
beberapa
kelompoksesuaidenganjumlahionyangdihasilkan.LihattabelIIIdiRepetitoriumTeknologi
SediaanSteril,hal.15.

3.MetodeLiso(DiktatKuliahSterilhal166,Lachmanparenteralhal209)
BilatidakadadataEdanTfdipustakamakabisadigunakanmetodeiniuntukmencarinya.

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

DaftarLiso
(LachmanParenteralhal211;PHYSICALPHARMACYthn1993,Ed.4thhal.181)
Tipezat
Nonelektrolit
Weakelektrolit
Divalentelektrolit

Liso
1.9
2.0
2.0

Contoh
Sucrose,glycerin,urea,camphor
Phenobarbital,cocaine,boricacid
Zinksulfat,magnesiumsulfate

Univalentelektrolit

3.4

NaCl,cocainehydrochloride,sodiumPhenobarbital

UniDivalenelektrolit

4.3

Nasulfat,atropinesulfate

DiUnivalenelektrolit

4.8

Kalsiumklorida,kalsiumbromide,zincklorida

Unitrivalenelektrolit

5.2

Nafosfat,sodiumcitrate

Triunivalenelektrolit

6.0

Alumuniumklorida,ferriciodide

Tetraborateelektrolit

7,6

Sodiumborate,potassiumborate

DaftarLisountukbeberapazatdapatdilihatpada PhysicalPharmacy ed.4,tahun1993,


hal.183184
CONTOHPERHITUNGAN

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

ZATTAMBAHANDALAMSEDIAANPARENTERAL
(Lachmanhal194)
ZAT
ANTIMIKROBA
Benzalkoniumflorida
Benzethoniumklorida
Benzylalcohol
Klorobutanol
Klorokresol
Metakresol
Fenol
Fenilmerkurinitratdanasetat
Metilphidroksibenzoat
Propilphidroksibenzoat
Butilphidroksibenzoat
Thimerosal
ANTIOKSIDANa
Asetonnatriumbisulfit
Asamaskorbat
Esterasamaskorbat
Butilhidroksianisol(BHA)
Butilhidroksitoluen(BHT)
Sistein
NDGA
Monotiogliserol
Natriumbisulfit
Natriummetabisulfit
Tokoferol
Glutation
AGENPENGKELAT
GaramEDTA
DAPAR
Asamasetatdangaramnya,pH3,55,7
Asamsitratdangaramnya,pH2,56
Asamglutamat,pH8,210,2
Asamphosphoricdangaramnya,pH68,2
PENGISOTONIS
Dektrosa
Natriumklorida
Natriumsulfatb
SURFAKTAN
Polisorbatmonooleat
Sorbitanmonooleat

KONSENTRASIPENGGUNAAN(%)
0,01
0,01
12
0,250,5
0,10,3
0,10,3
0,5
0,002
0,18
0,02
0,015
0,01
0,2
0,01
0,15
0,02
0,02
0,5
0,01
0,5
0,15
0,2
0,5
0,1
0,010,075
12
15
12
0,82
45,5
0,50,9
11,6
0,10,5
0,050,5

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

a
b

=konsentrasimaksimumdalamsediaaninjeksi
=jangandisimpanpadagelasyangmengandungbarium

II. METODE DAN PROSEDUR PEMBUATAN


A.MetodePembuatan
Adaduametodepembuatansediaansterilyaitucarasterilisasiakhirdancaraaseptik.
1. SterilisasiAkhir
Metodeinimerupakanmetodeyangpalingumumdanpalingbanyakdigunakandalam
pembuatan sediaan steril. Persyaratannya adalah zat aktif harus stabil dengan adanya
molekul air dan tingginya suhu sterilisasi. Sediaan disterilkan pada tahap terakhir
pembuatansediaan.
Contohyangpalingbanyakdigunakanpadametodeiniadalahsterilsasidenganautoklaf
(suhu121C,selama15menit).
2. Aseptik
Metodeinibiasanyadigunakanuntukzataktifyangsensitifterhadapsuhutinggiyang
dapat mengakibatkan penguraian dan penurunan kerja farmakologinya. Antibiotika dan
beberapahormontertentumerupakanzataktifyangsebaiknyadikerjakansecaraaseptik.
Metode aseptik bukanlah suatu cara sterilisasi melainkan suatu cara kerja untuk
memperolehsediaansterildenganmencegahkontaminasijasadrenikdanpartikulatdalam
sediaanjadi.
Keterangan:
PenimbanganzataktifZataktifbiasanyaditimbangdilebihkansesuaipersyaratanyangadadi
monografi untuk mencegah kemungkinan berkurangnya kadar dalam sediaan akibat proses
pembuatanataupundalampenyimpanan.(Contoh:persyaratankadarzatX=98102%,maka
penimbanganzataktifdilebihkan2%)
BebaspirogenHalinibarudilakukanjikavolumelarutansuntiksebanyak10mlataulebih.
Pembebasan pirogen dilakukan dengan penambahan 0,1 % karbon aktif dihitung terhadap
volumetotal(b/v),kemudiandipanaskanpadasuhu6070Cselama15menitsambilsesekali
diaduk.Waktudihitungsetelahsuhumencapai6070C
BebasoksigenataukarbondioksidaHalinibarudilakukanjikadiperlukanterutamajikazat
aktifdiketahuipekaterhadapkedua gastersebut.Pembebasanoksigenataukarbondioksida
dilakukan dengan cara memanaskan air suling selama 30 menit dihitung sejak mendidih
kemudiandialirigasnitrogensambildidinginkan.
SterilisasilemaridanruangLemaridisterilkandenganuapformaldehidhasilpemanasanserbuk
paraformaldehiddalamcawanpenguappanasyangdiletakkandalamlemari.Ruangdisterilkan
dengansinarUVselama24jamsebelumdigunakan.
B. ProsedurPembuatan
1. Larutan(Sterilisasiakhir)
Jikazatsensitifterhadapcahaya,makapengerjaandilakukanpadaruangterlindungcahaya,di
bawahlampunatrium
a. Zataktifdigerusdanditimbangberlebihsesuaikebutuhanmenggunakankacaarloji,kemudian
dimasukkankedalamgelaspiala.Kacaarlojidibilas2kalidenganaquaproinjeksi
b. Zataktifdilarutkandalamsejumlahtertentuaquaproinjeksi
c. Setelahzataktifdansemuazattambahanterlarut,larutantersebutkemudiandituangkedalam
gelasukursehinggavolumetertentudibawahvolumeakhir
d. Kertassaringrangkap2yangakandigunakanuntukmenyaringdibasahisejumlahtertentu
aquaproinjeksiterlebihdahulu,kemudiancorongdipindahkankeerlenmeyerlainyangtelah
steril
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

e.

f.
g.
h.
i.
j.

k.
l.

Larutanyangadadigelasukurdisaringkedalamlabuerlenmeyeryangtelahdisiapkan.IPC
dilakukandenganmengukurpHsediaan.Kekuranganaquaproinjeksidituangkansedikitdemi
sedikituntukmembilasgelaspialalaludituangkegelasukur.Airbilasantersebutkemudian
disaringlagikedalamerlenmeyeryangtelahberisifiltratlarutanhinggavolumetotalseluruh
larutangenap...mL
Larutanyangtelahdisaringdituangkedalamkolomreservoirmelaluimembranfilterbakteri
yangdiletakkandiatasglassfilterG5(ukuranporipori0,45m)
Larutandituangkedalamburetsterilkemudianujungyaditutupdenganalumuniumfoil
Sebelumdiisikankedalamwadah,jarumburetdibersihkandengankapasyangtelahdibasahi
alkohol70%.Setiapwadahdiisidenganlarutan..C..mLsesuaipersyaratanvolumeFIIV
Ampul/vialyangtelahberisizataktif,biladiperlukandialiridengangasnitrogen
(Bilawadahampul)Ampulditutupdenganapidandisterilkanmenggunakanautoklafsecara
terbalikdalamgelaspialayangtelahdialasikapas(121Cselama15menit)ataumetodelain
yangsesuai
(Bila wadah vial) Vial ditutup dengan tutup karet lalu diseal dengan alumunium cap,
kemudiandisterilkanmenggunakanautoklafdalamgelaspialayangtelahdialasikapas(121C
selama15menit)ataumetodelainyangsesuai
Setelahsterilisasiakhir,dilakukanevaluasisediaan
Sediaandikemasdalamdusyangsudahdiberietiketdandisertakanbrosurinformasiobat

Pencampuraneksipiendilakukandiawal,dengancaramelarutkandahulueksipienmasing2baru
ditambahkankedalamlarutanstok
2. Larutan(MetodeAseptik)
SemuapengerjaanpembuatansediaandilakukandibawahLAF,ruangankelas2(jikazatsensitif
terhadap cahaya, maka pengerjaan dilakukan pada ruang terlindung cahaya, di bawah lampu
natrium)
a. Semuabahanbaku(zataktif+eksipien)yangtelahditimbangdisterilisasidenganmetode
yangsesuai
b. Prosedurbfsamadenganyangtercantumpadametodesterilisasiakhir
c. Larutanyangtelahdisaring,dituangkedalamkolomreservoirmelaluimembranfilterbakteri
yangdiletakkandiatasfilterglassG3(ukuranporipori0,22m)
d. Larutandituangkedalamburetsterilkemudianujungnyaditutupdenganalumuniumfoil
e. Sebelumdiisikankedalamwadah,jarumburetdibersihkandengankapasyangtelahdibasahi
alkohol70%.SetiapwadahdiisidenganlarutanCmLsesuaipersyaratanvolumeFIIV
f. Ampul/vialyangtelahberisizataktif,biladiperlukandialiridengangasnitrogen
g. Dilakukanevaluasisediaan
i.
Sediaandikemasdalamdusyangsudahdiberietiketdandisertakanbrosurinformasiobat
3. InjeksiSuspensiKeringtanpagranulasi(SterilisasiAkhir)
Jikazatsensitifterhadapcahaya,makapengerjaandilakukanpadaruangterlindungcahaya,di
bawahlampunatrium
a. Zataktifdaneksipiendigerus,kemudianditimbangsejumlahyangdibutuhkan
b. Masingmasingzatdigerusdandicampurkansampaihomogendalammortir
c. Campuran sediaan ditimbang dan dimasukkan ke dalam vial dengan bantuan corong dan
zalfkaart
d. Vial ditutup dengan tutup karet lalu diseal dengan alumunium cap, kemudian disterilkan
dalam
autoklaf(121Cselama15menit)ataumetodelainyangsesuai
e. Setelahsterilisasiakhir,dilakukanevaluasisediaan
f. Sediaandikemasdalamdusyangsudahdiberietiketdandisertakanbrosurinformasiobat

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

4. InjeksiSuspensiKeringtanpagranulasi(MetodeAseptik)
SemuapengerjaanpembuatansediaandilakukandibawahLAF,ruangankelas2(jikazatsensitif
terhadap cahaya, maka pengerjaan dilakukan pada ruang terlindung cahaya, di bawah lampu
natrium)
a. Zataktifdaneksipiendigeruskemudianditimbangsejumlahyangdibutukanlaludisterilisasi
denganmetodeyangsesuai
b. Campurkanzataktifdaneksipiendalammortarsterillalugerussampaihomogen
c. CampurandiayakmelaluiayakanB40
d. Campuranditimbangkemudiandimasukkankedalamvialdenganbantuancorongdanzalfkart
e. Vialditutupdengankaretdanalumuniumcap
f. Dilakukanevaluasisediaan
g. Sediaandikemasdalamdusyangsudahdiberietiketdandisertakanbrosurinformasiobat
5. InjeksiSuspensidenganPembawaAir(MetodeAseptik)
a. Suspending agent dikembangkan dengan cara yang sesuai lalu dicampur dengan eksipien
lainnya.
Sterilisasibersamadalamautoklaf(121Cselama15menit)
b. Timbangzataktif,sterilisasi,gerusdalammortaryangsterilkemudiandicampurkandengan
pembawa yang telah disterilkan tadi (dalam keadaan dingin) sedikit demi sedikit sambil
digerus
c. Suspensitersebutdituangkedalamgelasukuryangdilengkapibatangpengadukdanvolume
akhirdicapaidenganpenambahanaquaproinjeksi
d. Setelahdiadukhomogen,suspensidituangkedalamvialsterilyangtelahdikalibrasi
6. InjeksiSuspensidenganPembawaMinyak(MetodeAseptik)
a. Suspendingagentdicampurbersamaminyakkemudiandisterilkandidalamoven(170C,30
menit)
b. Timbangzataktif,sterilisasi,gerusdalammortaryangsterilkemudiandicampurkandengan
pembawa yang telah disterilkan tadi (dalam keadaan dingin) sedikit demi sedikit sambil
digerus
c. Suspensitersebutdituangkedalamgelasukuryangdilengkapibatangpengadukdanvolume
akhirdicapaidenganpenambahanminyaksteril(tanpasuspendingagent)
d. Setelahdiadukhomogen,suspensidituangkedalamvialsterilyangtelahdikalibrasi
7. InjeksiLarutanMinyak(MetodeAseptik)
a. Timbangzataktif,campurkankedalamminyak,kemudiansterilisasidalamoven(170C,30
menit)
b. Campurantersebutdituangkedalamgelasukuryangdilengkapibatangpengaduk,genapkan
volumedenganpenambahanminyaksteril
c. Setelahdiadukhomogen,suspensidituangkedalamvialsterilyangtelahdikalibrasi
8. InjeksiEmulsiM/A(MetodeAseptik)
a. Zatzatlarutminyakdicampurdalamminyakdanemulgatorminyak,sterilisasidalamoven
(170C,30menit)
b. Zatzatlarutairdicampurdalamaquaproinjeksidanemulgatorair,sterilisasidalamautoklaf
(121C,15menit)
c. Campurdangeruskeduacampurantersebutpadasuhuyangsama(6070C)dalammortar
steril
d. Campurantersebutdituangkedalamgelasukuryangdilengkapibatangpengaduk,genapkan
volumedenganpenambahanaquaproinjeksi
e. Setelahdiadukhomogen,suspensidituangkedalamvialsterilyangtelahdikalibrasi

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Catatanuntukpenimbanganzat(BennyLogawa)
Volumetiapampul/vialdilebihkansesuaidengankelebihanvolumeyangdianjurkandalamFIIV,
p.1044
Volumeyangterteradalam
penandaan(mL)
0,5
1,0
2,0
5,0
10,0
20,0
30,0
50,0ataulebih

Kelebihanvolumeyangdianjurkan(mL)
Untukcairanencer
Untukcairankental
0,10
0,12
0,10
0,15
0,15
0,25
0,30
0,50
0,50
0,70
0,60
0,90
0,80
1,20
2%
3%

Volumesediaanyangharusdiisikankedalamsetiapampul/vial:
Jika: Volumetiapampul/vial=amL
Kelebihanvolumeyangdianjurkan=bmL
Maka: Volumetiapampul/vial=a+b=cmL
Volumesediaanyangakandibuat:
Ampul:V=(n+2)c+6
Vial :V=n.c+6
Keterangan:
V
=volumesediaanyangharusdibuat
n
=jumlahsediaanyangakandibuat
C
=ampul/vial
c
= volume sediaan yang harus diisikan ke dalam setiap
ampul/vial
6
=volumeuntukmembilasburet:2x3mL
C. CaracaraSterilisasi
(FIIVhal.11121116,FIIIIhal1819,TPCed12hlm538554,diktatkuliahTekn.FA
SediaanSteril5558,PrinciplesofSterileProductPreparation7374/PSPP)
1. Sterilisasi uap Proses sterilisasi termal menggunakan uap jenuh di bawah tekanan
berlangsung di suatu bejana di sebut otoklaf. Suatu siklus otoklaf yang ditetapkan
dalamfarmakope,untukmediaataupereaksiadalahselama15menit,121oC,kecuali
dinyatakanlain.
Prinsipdasarkerjaalat:udaradidalambejanadigantidenganuapjenuh,danhalini
dicapai dengan menggunakan alat pembuka atau penutup khusus. Faktor yg
mpengaruhi desain&pemilihan suatu siklus utk produk atau komponen tertentu a.l:
ketdkstabilanpanasbahan,pengetahuanttgpenetrasipanaskedlmbahan,faktorlain
ygtercantumdlmprogramvalidasi(FIIV).
Sediaanyangakandisterilkandiisikankedalamwadahyangcocok,kemudianditutup
kedap.Jikavolumedalam tiap wadahtidak lebih dari100ml,sterilisasi dilakukan
denganuapairjenuhpadasuhu115oC116oCselama30menit.Jikavolumedalamtiap
wadahlebihdari100ml,waktusterilisasidiperpanjanghinggaseluruhisitiapwadah
beradapada115oC116oCselama30menit(FIIII).
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Digunakanutkzatygstabilpdpanas,tahanlembabdandptditembusuapairpanas.
Reaksikimia ygmematikan tjdlbhmudahdgnadanyaair&konsekuensinyaakan
butuhwktpemaparanpanaslbhsedikitutkmembunuhmikroorganismedlmkeadaan
terhidrasidibandingkankeadaankering.Inaktivasipanasdlmselterhidrasidisebabkan
oleh denaturasi dan koagulasi ireversibel enzim dan struktur protein, kemungkinan
melalui proses hidrolisis. Hubungan suhu dan waktu tunggu utk sterilisasi panas
lembab:(TPC)
SuhuC
115118
121124
126129
134138

Wkttungguminimum(menit)
30
15
10
3

Fo(menit)
7,515
1530
3263
60150

Ikatanhidrogenmudahputusdgnadanyamolekulairkrnterjadinyaikatanhidrogen
antaramasingmasinggugusamino&karboksidenganmolekulair.Fungsiairpdpanas
lembabadhdlmprosesdenaturasi.
Keuntungan: adanya uap jenuh mpnyai aktivitas pembunuhan yg tinggi & dpt
membunuhsemuajnsmikroorganisme,tmsksporaygresisten,dlmwkt15mnt121C,
murah,sederhana,hnymembutuhkanpemantauanwaktu,suhu&tekanan,cepat.
2. Sterilisasipanaskering
Prosessterilisasitermaluntukbahanyangterteradifarmakopedenganmenggunakan
panas kering biasanya dilakukan dengan suatu proses bets dalam suatu oven yang
didesain khusus untuk tujuan tersebut. Distribusi panas dapat berupa sirkulasi atau
disalurkanlangsungdarisuatunyalaterbuka(FIIV).
Sediaanyangakandisterilkandimasukkankedalamwadahkemudianditutupkedap
ataupenutupaninibersifatsementarauntukmencegahcemaran.Jikavolumedalamtiap
wadahtidaklebihdari30ml,panaskanpadasuhu150 oCselama1jam.Jikavolume
dalamtiapwadahlebihdari30ml,waktu1jamdihitungsetelahseluruhisitiapwadah
mencapai suhu 150oC. Wadah yang tertutup sementara, kemudian ditutup kedap
menurutteknikaseptik(FIIII).
Teknik Aseptik. Cara pengurusan bahan steril menggunakan teknik yang dapat
memperkecil kemungkinan terjadinya cemaran kuman hingga seminimum mungkin.
Teknikaseptikdimaksudkanuntukdigunakandalampembuataninjeksiygtidakdapat
dilakukanprosessterilisasiakhir,krnketidakmantapanzatnya.Teknikinitidakmudah
diselenggarakan dan tidak ada kepastian bahwa hasil akhir sesungguhnya steril.
Sterilitashasilakhirhanyadapatdisimpulkan,jikahasilitutelahmemenuhisyaratUji
sterilitasygterterapdUjikeamananHayati.Teknikaseptikmjdhalygpentingsekali
diperhatikan pd waktu melakukan sterilisasi menggunakan cara sterilisasi
penyaringan&pemanasankeringsewaktumemindahkanataumemasukkanbhnsterilke
dlmwadahakhirsteril.Dlmhaltertentu,untukmeyakinkanterjadinyacemaranatar
atautidaksewaktumemindahkanataumemasukkancariansterilkedlmwadahsteril
menggunakancaraini,perludiujidgncarasbb:Kedlmsalahsaruwadahmasukkan
mediumbiakanbakterisebagaiganticairansteril.Tutupwadah&eramkanpdsuhu32 oC
selama7hari.Jktjdpertumbuhankuman,menunjukkanadanyacemaranygtjdpd
waktumemasukkanataumemindahkan carankedlmwadahakhir.Dlmpembuatan
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

cairansterilmenggunakanprosesini,obatsterildilarutkanataudidispersikandlmzat
pembawa steril, diwadahkan dlm wadah steril, akhirnya ditutup kedap untuk
melindungithdpcemarankuman.Semuaalatygdigunakanharussteril.Ruanganyg
digunakanutkmelekukanpekerjaaniniharusdisterilkanterpisah&tekananudaranya
diatur positif dgn memasukkan udara yg telah dialirkan melalui penyaring bakteri.
Lagipula,pekerjaaninihrsdilakukandgntabirpelindungataudlmaliranudarasteril.
Pakaianpekerjahrskhusus&steril,dilengkapidgnpenutupmuka&topi(FIIII).
Digunakanutkzatygstabilpdpanasttpsensitiflembabatautidakdptditembusuapair
panas.Digunakanutksterilisasiserbukobatkering,suspensiobatdgnpelarutnonair,
minyak,lemak,waxes,liquids,soft&hardparafin,lubrikansptsilikon,injeksiminyak,
implants,basissalepmata,pakaianbedah,wadahgelas&logam,alatoperasi.Pdsuhu
diatas250Cselamaminimal30menitbisasterilisasidandepirogenisasiglasswaredan
logamygresistenpanas.Variasisuhuoventidakbolehlbhdr5Cpdsuhusterilisasi
selamawkttunggu.Barangbarangdibiarkandingindlmoven hggsekitar40Csebelum
kmd dipindahkan. Inakivasi oleh panas pd sel terdehidrasi, terutama sbg hasil proses
oksidasi.Hubungansuhudgnwkttunggupdsterilisasipanaskering:
SuhuC
160
170
180

Waktutungguminimum(menit)
120
60
30

BritishPharmacopoeia1993merekomendasikanprotokolinidanmenerimahubungansuhudan
waktutunggulainmisalnyapdbbrpminyakygmembutuhkansuhulebihrendah(TPC).
Keuntungan:pdsuhutertentudptutksterilisasi&depirogenisasi,metodeaman&terpercaya.
Tingkatpembunuhan&penetrasitergantungpdenrgiygdigunakan,jikaenergipanascukup
dptberpenetrasibaik&membunuhsemuamikroorganisme.(Diktatsteril)
3. Sterilisasigas
Pilihan untuk menggunakan sterilisasi gas sebagai alternatif dari sterilisasi termal sering
dilakukan jika bahan yang akan disterilkan tidak tahan terhadap suhu tinggi pada proses
sterilisasiuapataupanaskering.Bahanaktifyangumumnyadigunakanpadasterilisasigas
adalahetilenoksida.Keburukandaribahaniniadalahsangatmudahterbakar,bersifatmutagen
dan kemungkinan adanya residu toksik dalam bahan yang disterilkan terutama yang
mengandung ion klorida. Proses sterilisasi umumnya berlangsung dalam bejana yang
bertekananyangdidesainsamasepertiotoklaftetapidengantambahanbagiankhususyang
hanyaterdapatpadaalatsterilisasiyangmenggunakangas.Kualifikasiprosessterilisasigas
etilenoksidalebihluascakupannyadrpdcarasterilisasilainnyakrnselainsuhu,kelembaban,
tekananpositifatauhampaudarajgdiperlukanpengendalianketatthdpkadaretilenoksida.
Keterbatasan utama dari proses sterilisasi etilen oksida adalah terbatasnya kemampuan gas
tersebutuntukberdifusisampaikedaerahyangpalingdalamdaribahanyangdisterilkan.Jd
desain kemasan&cara pengisisan bejana sterilisasi hrs ditetapkan sedemikian rupa hingga
resistensiminimalthdpdifusigas(FIIV).
Untukmateriygkompatibeldgngasygdigunakan,tidaktahanpdsuhusterilisasiuap,panas
kering, atau dosis radiasi tinggi. Kondisi kritis yg hrs dikontrol: konsentrasi gas, suhu,
kelembabanrelatif,danwaktupemaparan.Dgnmelihatfaktorkritispdprosessterilisasigasmk
metodeinitidakdisarankanselamamasihadametodelainygsesuai.
Gas etilen oksida biasa digunakan utk sterilisai peralatan medis, jg bisa utk wadah
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

plastik&serbuktermolabil.Etilenoksidamerupakanpengalkilasikuatdanaktivitasantimikroba
melaluialkilasigugussulfhidril,hidroksil,karboksil,aminopdprotein&asamnukleat.Tidak
adasiklusstandarutksterilisasidgnetilenoksida,siklusygdigunakanbiasanyapdrentang
kadargas2501500mg/L,kelembabanrelatif3090%,suhu3065 o,&wktpemaparan130jam.
Gas yang lain yang dapat dipakai yaitu formaldehid (seperti box sterilisasi), hidrogen
peroksida,ozon,klorindioksida.
Gasformaldehidtdkberwarna,tdkeksplosif,tdkmdhtbakar.kekuatanpenetrasinyarendah,
afinitas thd air tinggi, mudah tpolimerisasi pd permukaan pd suhu dibawah 80 o, toksik bg
manusiattpdibandingkanetilenoksida,diadptdideteksidgnbaunyapdkonsentrasiygmsh
dibawahkdrtoksiknya.
Hidrodgenperoksida,prosessterilisasipadasuhurendah(480 o)&dgnkadargasrendah(0,55
mg/L) yg diklaim tidak korosif, dgn siklus sterilisasi kurang dr 90 menit telah diterima.
Hidrogen Peroksida tdk dapat digunakan utk sterilisasi liquid&inkompatibel dgn material
selulosaberporitinggidannilon.
Ozon merupakan bahan pengoksidasi kuat, aktif melawan endotoksin. Proses sterilisasi pd
kelembaban relatif 7590%, suhu rendah (25o), kadar gas 25mg/L. Kelembaban tinggi pd
prosesnya, sifat pengoksidasinya menyebabkankorosi logam, degradasi karet&bbrpplastik,
sehinggamenyebabkansedikitnyapenggunaanutksterilisasi.
Klorinoksidatelahbykdigunakanutkpegolahanair.Prosessterilisasipdkelembabanrelatif
tinggi (>80%), suhu rendah (2530C), kadar gas <2,5mg/L. Sifat klorin oksida; korosif,
kompatibeldgnbbrpplastik,selulosa,karetsilikon&stainlesssteel(TPC).
4. Sterilisasidenganradiasiion
Untukygtahanradiasitinggi,tidaktahanpanas&kekhawatiranttgkeamananetilenoksida.
Keunggulan sterilisasi radiasi meliputi reaktivitas kimia rendah, residu rendah yang dapat
diukur dan kenyataan yang membuktikan bahwa variabel yang dikendalikan lebih sedikit.
Radisihnymenimbulkansedikitkenaikansuhu,ttpdptmpengaruhikualitas&jenisplastikatau
kaca tertentu. Ada 2 jenis radiasi ion yang digunakan yaitu disintegrasi radioaktif dari
radioisotop(radiasi )danradiasi berkas elektron. Utk sterilisasi radiasi hrs dipilihdosis
sterilisasi yg efektif&dpt ditoleransi tanpa menimbulkan kerusakan. Bdasarkn pengalaman
dipilih dosis 2,5 Mrad radiasi yg diserap, ttp dlm bebrapa hal, diinginkan&dpt deterima
penggunaandosislbhrendah/tinggiuntukperalatan,bhnobat&bentuksedanakhir(FIIV).
Radiasiadhelektromagnetikenergitinggidgn110nm&energi1010eV.Absorpsikedlm
selakanmenyebabkanionisasikomponensel,pembentukanradikalbebas,&eksitasimolekul
ygmemicudisorganisasienzim&DNAsertakematiansel.Resistensiolehradiasiberhubungan
dgnbesarnyakerusakanygdibutuhkanuntukmenyebabkankematian&kapasitasorganisme
utkmemperbaikikerusakan.Kemampuanpenetrasitinggi,kenaikansuhuygdptdiabaikanpd
objek yg diradiasi dgn dosis normal,& tdk menginduksi radioaktivitas. Umumnya sumber
radiasi adhCo60.Dosisutksterilisasiberbedabeda. DiUK&mostEropaSterilisasiradiasi
dgndosisminimum25kGy.Agenprotektifsptkomponenygmengandungsulfhidril,askorbat
&gliserolmeningkatkanresistensi.Diskolorasimengkintjdselamsrasiasipdbbrpgelas&
plastiksptPVC,politetrafluoroetilen&polipropilen.Degradasimaterialolehradiasidiperbesar
dgnadanyaair&halinimembatasipenggunaanradiasiutksterilisasilarutanobatdgnpelarut
air. Penggunaan utama utk sterilisasi peralatan medis. Dpt utk sterilisasi enzim, vitamin,
mineral,antibiotik,antibodimonoklonal,&peptida.
Elektron energi tinggi adh partikel yg dipercepat oleh energi tinggi dgn menggunakan
potensialvoltasetinggi.Penetrasilbhkecildibandingkanradiasi.
Radiasi UV adlh pd 210328nm. Aktivitas Bakterisidal maksimumnya ditunjukkan pd
253,7nm. Radiasi UV adlh energi rendah, tidak mengionisasi, hny meningkatkan eksitasi
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

molekul. Efek hny pd mikroorganisme yg terpapar langsung oleh radiasi. Sebagian besar
mikroorganismemelaluiprosesenzimatikdptmemperbaikikerusakanygdiinduksiolehUV.
olehkrnituhnysesuaiutksterilisasiudaradanairdalamlapisantipis&permukaankerasyg
impermeabel.
RadiasiUVTidakdirekomendasikanutksterilisasiproduk.(TPC)
Keuntungan:penetrasi tinggi (radiasi ), aktivitas pembunuhan tinggi sehingga tingkat
kepercayaantinggi.(diktatsteril)
4. Sterilisasidenganpenyaringan
Sterilisasi larutan yang labil terhadap panas sering dilakukan dengan penyaringan
menggunakanbahanyangdapatmenahanmikroba,sehinggamikrobayangdikandungdapat
dipisahkan secara fisika. Perangkat penyaring umumnya terdiri dari suatu matriks berpori,
bertutup kedap atau dirangkaikan pada wadah yang tidak permeabel. Efektivitas suatu
penyaring media atau penyaring substrat tergantung pada ukuran pori bahan dan dapat
tergantungpadadayaabsorbsibakteripadaataudalammatrikspenyaringataubergantungpada
mekanisme pengayakan. Penyaringan untuk tujuan sterilisasi umumnya dilaksanakan
menggunakanrakitanyangmemilikimembrandenganporositasnominal0,2mataukurang.
Mediamembranpenyaringygtsediasaatini:celulosaasetat,celulosanitrat,fluorokarbonat,
polimerakrilik,polikarbonat,polister,PVC,vinil,nilon,politef,&jgmembranlogam,&ini
dptdiperkuatatauditunjangolehbahanberseratinternal.Rakitanpenyaringmembranharus
diujiutkintegritasawalsblm&sesdhdigunakan(FIIV).
Larutandisaringmelaluipenyaringbakteristeril,diisikankedlmwadahakhirygsteril,kmd
ditutupkedapmerurutTeknikaseptik(FIIII).
Metodecepat,dankususnyasesuaiutklarutanygmengandungbahantermolabilygtdkbisa
dengansterilisasipanaswalaupunmenggunakanprotokoldgnwaktusingkat&suhutinggi.
Minyak,cairankental,pelarutorganikdapatdisterilisasidgncaraini.Tidakdptmembedakan
mikroorganisme/partikelhidup&mati,&akanmemisahknsemuatipepartikeldgnukuranlbh
besardrukuranporimembran(TPC).
Filter&perangkatnyaharuskompatibelsecarafisik&kimiadgnlarutan&bisatahandgnsuhu
&tekananselamaproses.Berbagaipertimbanganpemilihanfilter:
a. Ukuran pori maksimum pori 0,22 m, tetapi utk kepastiannya perlu ditentukan SAL
(sterilityassurancelevel).BatasanNormalSALutkfilter0,22mygdptditerima1:1000
ataudgnkatalaintidaklebihdr0,1%mikroorganismeygtertinggal.
b. Kompatibilitas Hatihati:Pelarut terutama alkohol, glikol, dimetilformamid dpt
menyebabkanpolimermengembang&larut.
c. Volume cairan Utk memperoleh kecepatan aliran yg sesuai perlu filter dgn luas area
permukaanygsesuai.
d. Beban partikulat Saat sterilisasi dgn filtrasi, proses sterilisasi filtrasi tsb hrs
komplete/sempurnatanpamenggantifilternya. Ketikapartikulatdlmlarutantinggimaka
diperlukan satu/lbh prefilter. Bila beban partikulat relatif rendah, bisa digunakan filter
membran5mutkprefilternya.(PSPP)
6. Pemanasandenganbakterisida
SediaandibuatdenganmelarutkanataumensuspensibahanobatdalamlarutanklorkresolP
0,2%b/vdalamairuntukinjeksiataudalamlarutanbakterisidayangcocokdalamairuntuk
injeksi.Isikankedalamwadahlaluditutupkedap.Jikavolumedalamtiapwadahtidaklebih
dari 30ml, panaskanpada suhu 98100 oC selama 30menit. Jika volume lebihdari 30ml
waktunyadiperpanjanghinggaseluruhisitiapwadahberadapadasuhu98100 oCselama30
menit.Jikadosistunggalinjeksiyangdigunakansecaraivlebihdari15ml,pembuatantidak
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

dilakukan dengan cara ini. Injeksi yang digunakan secara intratekal, intrasisternal, atau
periduraltidakbolehdibuatdengancaraini(FIIII).
***Untuksedaanygtidakdapatdisterilkandgnsalahsatucaradiatas,pembuatandilakukandgn
carateknikaseptikygumumnyasbb:
a. Masingmasingbahandanwadahdisterilkanmenurutsalahsatucaradiatas.
b. Pencampurandilakukansesempurnamungkinhinggamemenuhisyarat Ujibebasjasadrenik.
(FIIIIhal19).
***Dlmprakteknyauntukmengurangibioburdensemuaalatdanbahanyangmemungkinkandi
sterilisasiterlebihdahuludanprosesaseptiktetapdigunakan,baikutkmetodepembuatansecara
aseptikmaupunsterilisasiakhir.

METODESTERILISASI
Metode

Karakteristikzataktif,eksipien,
wadah
Sterilisasi basah Tahan panas (121C selama 15
(autoklaf)
menit) dan tahan lembab, cairan
bercampurdenganair,wadahdapat
ditembusolehair

Kerugian

Tidakdepirogenasi
Tdkbsbhnsensitifpanasataupanaslembab,
keterbatasanpanaslembabutkberpenetrasi
melaluiwadah,perlupenghilanganudarakrn
udaradptmenghalangidifusiuapair.(diktat
steril,56)
Sterilisasi panas Tahanpanas(170Cselama1jam) Dapat depirogenasi Kerugian: waktu&suhu
kering(oven)
tidak tahan lembab, cairan tidak lbh lama&lbh tinggi dibandingkan panas
bercampurdenganair
lembab,terbataspdbhntahanpanas.(diktat
steril)
Filtrasi
Tidaktahanpanasberbentukcairan Tidak depirogenasi, kemungkinan terjadi
menggunakan
Tidakdapatdigunakanuntukwadah absorbsi zat pada membran dan leaching
membran
membran
Irradiasi(gamma, Memiliki ikatan molekul stabil Tidak depirogenasi, mahal, dapat merusak
elektron)
terhadap radiasi. Harus dipastikan ikatanmolekulbbrpzat,ongkoskapitalawal
tahan radiasi (tahan radiasi UV, tinggi&keamanannya.
blmtentutahanradiasi)
Sterilisasigas
Wadah polimer harus permeabel Kemungkinanresidu
terhadapudara,uapair,gas
SIFATZAT
METODASTERILISASI
AKTIF
Zat padat tahan Sterilisasipanaskering
panas dan tidak
mudahmenguap

Larutantahanpanas,
danlembab

Sterilisasi autoklaf (121 C


selama20menit)

16

KETERANGAN
Zincoxide,kalamin,talk,bismuthsubnitrat,
bismuth subkarbonat, calomel (tahan
pemanasan 160180 C selama 12 jam)
Sulfanilamid, sulfadiazin, sulfathiazole,
sulfamerazin(thnpemanasan3jam140150
C)

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Zat padat sensitif Sterilisasi gas seperti


panas
formaldehid,atau1020%etilen
dioksida dicampur dengan
karbondioksida
Cairansensitifpanas Filtrasi menggunakan membran,
secaraaseptis
Cairan minyak Sterilisasi oven (120130 C Minyak mineral, petrolatum cair, gliserin.
(tidak bercampur selama12jam)
Gliserin tidak dapat dipanaskan melebihi
denganair)
150C. Minyak&petrolatum cair tahan
pemanasansampai200C

III. EVALUASI DAN PENYIMPANAN


A.Evaluasi
Dilakukansetelahsediaandisterilkandansebelumwadahdipasangetiketdandikemas.
EVALUASIFISIKA
1
PenetapanpH.(FIed.IV,hal10391040)
2
BahanPartikulatdalamInjeksi<751>(FI>edIV,hal.981984).
3
PenetapanVolumeInjeksiDlamWadah<1131>(FIed.IVHal1044).
4
Ujikeseragamansediaan(untukserbukrekonstitusi,FIIV<911>,p.9991001)
5
UjiKebocoran(GoeswinAgus,LarutanParenteral,hal192)
6
UjiKejernihandanWarna(GoeswinAgus,LarutanParenteral,HAL201)
7
UjiKejernihanlarutan(FIIV<881>hal998)
EVALUASIBIOLOGI
1
UjiEfektivitasPengawetAntimikroba(untukyangmengandungpengawet)<61>(FIedIV,
HAL854855)
2
UjiSterilitas<71>(FIed.IV,HAL855863)
3
UjiEndotoksinBakteri<201>(FIed.IV,HAL905907)
4
UjiPirogen(Untukvolume>10ml)<231>(FIed.IV,HAL.908909)
5
UjiKandunganZatAntimikroba(untukyangmengandungpengawet)<441>(FIed.IV,HAL.
939942)
6
UjiPotensiAntibiotika(Untukzataktifantibiotik)(FIIV<131>hal891899)
EVALUASIKIMIA
1 UjiIdentifikasi(Sesuaidenganmonografisediaanmasingmasing)
2. PenetapanKadar(Sesuaidenganmonografisediaanmasingmasing).
B. Wadah
Wadahuntukinjeksitermasukpenutuptidakbolehberinteraksimelaluiberbagaicarabaiksecara
fisikmaupunkimiawidengansediaan,yangdapatmengubahkekuatan,mutuataukemurniandi
luarpersyaratanresmidalamkondisibiasapadawaktupenanganan,pengangkutan,penyimpanan,
penjualan, dan penggunaan. Wadah terbuat dari bahan yang dapat mempermudah pengamatan
terhadapisi.Tipekacayangdianjurkanuntuktiapsediaanumumnyaterteradalammasingmasing
monografi.(FIEd.IV,hal10).
Wadahdansumbatnyatidakbolehmempengaruhibahanyangdisimpandidalamnyabaiksecara
kimia maupun secara fisika, yang dapat mengakibatkan perubahan khasiat, mutu dan
kemurniannya.(FIed.III,halXXXIV)
Bagaimanapunbentukdankomposisiwadah,wadahpengemasmerupakansumberdarimasalah
stabilitassediaan,bahanpartikulat,dansumberpirogen.(DiktatSteril,hal82)
Keuntunganwadahgelas(Diktatsteril,hal8299):
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

1
2
3
4
5

Mempunyaidayatahankimiayangbaiksehinggatidakbereaksidengankandunganwadahdan
tidakmengabsorbsiataumengeluarkansenyawaorganik.
Bersifattidakpermeablesehinggaapabiladitutupdenganbaikmakapemasukanatauhilangnya
gasgasdapatdiabaikan.
Wadahgelasmudahdicucikarenapermukannyalicin
Bersifattransparansehinggadapatdiamatikandungnnyadalamwadah.
Mempunyaisifatkaku,kuatdanbentuknyastabil.Tahanterhadaptusukandapatdivakumkan,
dapatdipanaskanpadasuhu121Cpadasterilisasiuapdan260Cpadasterilisasikeringtanpa
mengalamiperubahanbentuk.Kerugian:mudahpecahdanbobotnyarelatifberat.

Wadahyangbiasadigunakanuntuksedianinjeksiadalahberupavialatauampul.Untukzataktif
yang mudah teroksidasi biasanya digunakan ampul berwarna gelap (biasanya coklat) untuk
melindungisediaandaricahaya.
GelastipeIuntukmembuatwadahtiupdalambentuktabung,misalnyavial,ampul,badanalat
suntik(syringe)danbagianinfusset.Beberapasediaanparenteralvolumekecildikemasdalamalat
suntikgelassekalipakai(disposableonetripglasssyringe).
C. Penandaan(FIEd.IV,hal11)
Padaetiketterteranamasediaan,untuksediaancairterterapersentaseataujumlahzataktifdalam
volume tertentu, cara pemberian, kondisi penyimpanan dan tanggal kadaluarsa, nama pabrik
pembuatdanataupengimporsertanomorlotataubetsyangmenunjukkanidentitas.Nomorlotdan
nomor bets dapat memberikan informasi tentang riwayat pembuatan lengkap meliputi seluruh
prosespengolahan,sterilisasi,pengisian,pengemasan,danpenandaan.
Biladalammonografiterteraberbagaikadarzataktifdalamsediaanparenteralvolumebesar,maka
kadarmasingmasingkomponendisebutdengannamaumummisalnyainjeksiDekstrosa5%atau
InjeksiDekstrosa(5%).
Bila formula lengkap tidak tertera dalam masingmasing monografi, Penandaan mencakup
informasiberikut:
1 Untuksediaancair,persentaseisiataujumlahtiapkomponendalamvolumetertentu,kecuali
bahanyangditambahkanuntukpenyesuaianpHatauuntukmembuatlarutanisotonik,dapat
dinyatakannamadanefekbahantersebut
2 Sediaankeringatausediaanyangmemerlukanpengenceransebelumdigunakan,jumlahtiap
komponen, komposisi pengencer yangdianjurkan, jumlah yangdiperlukanuntukmendapat
konsentrasitertentuzataktifdanvolumeakhirlarutanyangdiperoleh,uraiansingkatpemerian
larutanterkonstitusi,carapenyimpanandantanggalkadualarsa.
Pemberianetiketpadawadahsedemikianrupasehinggasebagianwadahtidaktertutupolehetiket,
untukmempermudahpemeriksaanisisecaravisual.
D. PengemasandanPenyimpanan
Volumeinjeksiwadahdosistunggaldapatmemberikanjumlahtertentuuntukpemakaianparenteral
sekalipakaidantidakadayangmemungkinkanpengambilanisidanpemberian1liter.(FIEd.IV,
Hal11)
Untuk penyimpanan obat harus disimpansehingga tercegahcemarandanpenguraian, terhindar
pengaruhudara,kelembaban,panasdancahaya.
Kondisi penyimpanan tergantung pada sediaannya, misalnya kondisi harus disimpan terlindung
cahaya,disimpanpadasuhukamar,disimpanditempatsejuk,disimpanditemapatdingin(FIEd.
III,HalXXXIV)

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

IV. SEDIAAN DI PUSTAKA


Trissel,10thed.
Alteplase(14)
KetolorakTrometamin(705)
PenisilinGNatrium(949)
AmikasinSulfat(22)
LabetalolHCl(707)
PentamidinIsetinat(954)
AmiodranHCl(78)
LevopranolTartrat(717)
PentazosinLaktat(955)
AmtrypinHCl(81)
MethotreksatNatrium(783)
PentobarbitalNatrium(959)
BezotiprineMesylate(141)
MetildopateHCl(793)
PhenilefrinHCl(974)
BetamethasoneNatriumMetilergonovinMaleat(795)
PhenitoinNatrium(976)
Sulfat(142)
Metronidazole(817)
PiperasilinNatrium(986)
Calcitriol(162)
Multivitamin(866)
PrednisolonNatriumFosfat(1018)
ChlordiazepoksideHCl(278)
NafcilinNatrium(872)
PiridoksinHCl(1056)
ChlorpromazineHCl(285)
NalbufinHCl(879)
QuinidineGlukonat(1057)
ClindamisinFosfat(322)
NalmefenHCl(883)
RanitidinHCl(1059)
DexamethasoneSodiumNaloksonHCl(884)
ScopolaminHBr(1079)
Fosfat(363)
NeostigminMetilsulfat(885)
SodiumAcetate(1083)
Diazepam(378)
NetilmisinSulfat(886)
SodiumFosfat(1105)
ErgonovinMaleat(460)
NikardipinHCl(893)
StreptomisinSulfat(1109)
Etoposide(477)
Nitrogliserin(894)
ThiethylperazineMalate(1136)
Filgrastim(507)
NorepinefrinbitartratTrimethobenzamideHCl(1173)
AsamFolat(538)
(NoradrenalinAsamTartrat)TubokurarinKlorida(1180)
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

GentamisinSulfat(559)(904)
VecuroniumBromida(1193)
Hialuronidase(626)
VitaminA
HidralazinHCl(629)
OktreotidaAsetat(909)
WarfarinNatrium(1220)
HidrokortisonNatriumFosfat(632)
PenisilinGKalium(939)

V. MASALAHKHUSUS
A. SuspensiSteril

Suspensisediaansteril(diambildaridefinisisuspensiobatmata,FIed.IV,hal14)adalahsediaan
steril yang mengandung partikelpartikel yang terdispersi dalam cairan pembawa. Obat dalam
suspensiharusdalambentuktermikronisasiagartidakmenimbulkaniritasi.
Sediaan suspensi parenteral adalah zat berkhasiat yang tak larut, terdispersi dalam bentuk
multiphasedengansystemheterogen,ditujukanuntukinjeksiintramuskulardansubkutan(Diktat
Sterilhal:167).
Suspensiparenteralmerupakansalahsatujenissediaanyangpalingsulituntukdibuat.Sediaan
suspensi parenteral tidak boleh mengendap (caking) selama penyimpanan, mudah untuk
diresuspensipadapemakaiandanukuranpartikelnyaharusdapatmelewatijarumdenganukuran
1821gauge.Untukmencapaihaltersebutadabeberapahalyangharusdiperhatikanyaitu:
Mengontrolkristalisasidanreduksiukuranpartikel(mikronisasi)
Prosessterilisasizataktif
Prosespembasahandengansurfaktan,dispersedanpencampuranaseptic,pengisianakhir
kewadah.
Keseragamanukuranpartikeluntukuntukmenjaminketepatandosis
Zat tambahan yang digunakan harus membuat dispersi stabil selama penyimpanan dan
mudahmengalir(tiksotropik)
Sedianparenteraldibuatdalambentukinjeksibila:
Zataktifsukarlarutdalamairataupunminyakdanjikadigunakanpelarutcampurmaka
dibutuhkanpelarutcampuratauzatpenambahkelarutandalamjumlahyangbanyak(Diktat
Sterilhal162)
Jika diinginkan sediaan parenteral dengan kecepatan pelepasan lambat Formula umum
(TPC,hal98)
FORMULA
PUSTAKA
Pembawaair
R/
Zataktif
Pembawa(air)
Zattambahan(untuksuspensiparenteral)
Pengawet,antioksidan,zatpengkelat,zatpembasah,zatpensuspensi,buffer,zat
pengisotonis(Lachman/dispersesystenvolII,hal399)
Contoh:InjeksikortisonasetatCarapembuatan:DapatdilihatpadaprosedurpembuatandiBAB2
Pembawaminyak
Suspensi parenteral dapat juga dibuat dalam pembawa minyak, untuk memberikan efek depot
(pemberianIM)
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

R/

Zataktif
Pembawa(minyak)
Zattambahan(suspendingagent,antioksidan,pengawet)
Suspendingagentyangbiasadipakaidalampembawaminyak:Alumuniummonostearat.
Contoh:InjeksiprokainPenisilin
R/
ProkainPenisilin300.00UI/ml
Alumuniummonostearat2,0%
Minyakzaitunad100ml
CaraPembuatan:DapatdilihatpadaprosedurpembuatandiBABII
ZatTambahandalamSediaanInjeksiSuspensiSteril(Lachmanparenteral,volI,hal214)
1. PENSUSPENSI
Alumuniummonostearat
Gelatin
Manitol
Povidon
Natriumkarboksimetilselulosa
Sorbitol
2. SURFAKTAN
Lesitin
Polioksietilenpolioksipropileneter
Polioksietilensorbitanmonolaurat
Polisorbat80
Silikonantifoam
Sorbitantrioleat
3. PELARUT
Polietilenglikol300
Propilenglikol
4. pHADJUSMENT
Asamsitrat,
Natriumsitrat
EvaluasidanPenyimpanan
Evaluasisediaansuspensisterilmengacupadasediaansuspensinonsteril,hanyaperludilakukanuji
sterilisasi.Wadahuntuksuspensisterilbiasanyadigunakanvial.
B. Emulsi Steril
PENDAHULUAN
Sediaanemulsiparenteraladalahdispersiheterogendalamsatucairanyangtidaklarutdenancairan
lainnya. Untuk membuat sediaan stabil dapat ditambahkan zat pengemulsi. [Diktat Kuliah
TeknologiFarmasiSediaanSteril,1994,p.169]
Ketidaklarutan zat aktif tertentu menyebabkan kesulitan pembuatan formula untuk intravena.
Alternatifnyaadalahdibuatdalamsystemkosolvenatauemulsi.[Lachman,PharmaceuticalDosage
Forms:DisperseSystems,vol.1,1988,p.222]
Padaemulsiuntukinjeksi,zataktiflarutminyakdilarutkandalampembawayangsesuai,kemudian
diemulsikan. Namun, emulsi parenteral jarang dibuat karena keharusan dan kesulitan untuk
mencapaidropletstabildenganukurankurangdari1 muntukmencegahembolidipembuluh
darah.[Lachman,PharmaceuticalDosageForms:DisperseSystems,vol.1,1988,p.221]
TujuanPenggunaanSediaanParenteralEmulsi
1
SediaanEmulsiair dalamminyak(A/M)untukmencegahalergi (Emulsionofallergenic
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

2
3

extracts),diberikansecarasubkutan
Sediaan emulsi lepas lambat minyak dalam air (M/A), diberikan secara intramuskular
(Sustainedreleasedepotpreparation)
Sedian emulsi nutrisi minyak dalam air (M/A), diberikan secara intravena [Diktat Kuliah
TeknologiFarmasiSediaanSteril,1994,p.169]

Keterbatasanpembuatanemulsiparenteraladalah:
1
Pilihanstabilisatordanemulgatoryangterbatas
2
Kemungkinanterjadinyareaksipirogendanhemolisislebihbesar[Lachman,Pharmaceutical
Dosage Forms: Disperse Systems, vol. 1, 1988, p. 221; Diktat Kuliah Teknologi Farmasi
SediaanSteril,1994,p.169]
Emulsiparenteraldibatasiolehduahalpenting,yaitu:
1
Ukuran partikel Untuk intravena, ukuranpartikel 5 m, tanpa resikoemboli di kapiler.
Ukuranpartikelrataratauntukemulsilemak<1 m,diperolehdenganhomogenisasipada
temperaturdantekanantinggi.
2
SterilisasiMetodesterilisasiyangdigunakanadalahautoklafpada110Cselama40menit,
perlakuaninitidakmemengaruhistabilitas,melainkanmemperkecilukuranpartikel.Metode
sterilisasi alternatif adalah: filtrasi, selama ukuran partikel (droplet) cukup kecil untuk
melewatifiltersterilisasiawal,pembuatanaseptik
Instabilitasemulsilemakdapatdisebabkanbeberapahal:
1
Perubahanukuranpartikeldropletminyak,menyebabkancreamingdankoalesensi
2
PerubahanpHJikapHemulsidijagalebihalkali,stabilitasdapatterjagadanprodukdapat
disimpandibawahsuhu30C.
3
Hidrolisisemulgator
4
Oksidasiminyak
5
Penambahanzatktifatauelektrolit,sehinggaformulaharusdibuatkhusus
Keuntunganemulsilemak:
a. TargetedDeliverySystem
Emulsi lemak dapat digunakan sebagai pembawa obat karena kemiripannya dengan
kilomikron
b. Dapat diencerkan in vivo dalam darah atau saluran cerna tanpa menyebabkan presipitasi
partikel

obat Lingkungan pembawa nonair dapat meningkatkan stabilitas [Lachman,


PharmaceuticalDosageForms:DisperseSystems,vol.1,1988,p.246247]
FORMULASI
Faktoryangharusdiperhatikandalampengembanganformulasediaanemulsisteril:
1
Ukuran globul yang terdispersi dengan rentang ukuran yang cukup kecil melalui proses
destruksiyangspesifikpadasaatpembuatansediaanemulsi.
2
Pembawaminyakyangdapatberasosiasidengancairantubuh.
3
Inkompatibilitasantarkomponendalamsediaanataupadasaatdicampurkandengansediaan
injeksilainnya.
4
Wadah primer sesuai dengan cara pemberian : disposable. [Modul Praktikum Teknologi
SediaanLikuid&Semisolid,p.39]
Persyaratantambahanuntukinjeksiemulsi:

Fisikokimia
0
Stabilitasfisik
1
Ukuranpartikelkurangdari2m
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

2
3

4
5
6

397]

Dapatdisterilisasi
Stabilitaskimia
Biologi
Efeksampingkecil
Nonantigenik
Semuakomponendapatdimetabolismeataudiekskresikan
Praktik
Stabilpadatemperaturyangekstrem
Harga[Lachman,PharmaceuticalDosageForms:DisperseSystems,vol.2,1988,p.379

Minyakyangumumdipakai:
Naturaloil:cottonseedoil,soybeanoil,saffloweroil,sesameoil,codliveroil,linseedoil,coconut
oil,cornoil,peanutoil,cocobutteroil,butteroil.
Sintetik/semisintetik:triolein,etiloleat,dibutil,sebakat,isoamilsalisilat.[Lachman,Pharmaceutical
Dosage Forms: Disperse Systems, vol. 2, 1988, p. 379397]Untuk rute intramuskular dapat
digunakan munyak paraffin atau minyak tumbuhan, untuk ruteintravena biasanya digunakan
minyaktumbuhanmurni,sepertisoybeanoil,saffloweroil,dan
cottonseedoil.Minyakminyaktersebutpalingumumdigunakankarenareaksitoksikjarangterjadi
dantahanterhadapoksidasi.[Lachman,PharmaceuticalDosageForms:DisperseSystems,vol.1,
1988,p.246]
Minyakteremulsitidakmempunyaiefekosmotik,perlutambahanuntukmembuatkondisiisotonik.
Jikadigunakanlesitinsebagaiemulgator,NaCldangulapereduksi(glukosa)tidakdapatdipakai,
karenaberinteraksimenyebabkanwarnacokelatdanpemisahanfasa,solusinyaadalahpenggunaan
gliserin,sorbitolatauxylitol.[Lachman,PharmaceuticalDosageForms:DisperseSystems,vol.2,
1988,p.379397]
Formulaemulsiparenteral:
a.Zataktif
b.Pembawa(airdanminyak)
c.Emulgator
d.Pengawet
e.Antioksidan
METODEPEMBUATAN

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

EVALUASI
Evaluasifisika,Analisiskimia,PenentuanpH,Penentuanukuranpartikel,Ujisterilitas,Uji
pirogen[Lachman,PharmaceuticalDosageForms:DisperseSystems,vol.2,1988,p.379397]
Evaluasisediaansamadenganemulsinonsteril,hanyaperludilakukanujisterilitas
LihatevaluasiemulsidiTSEMULSI!!!
C.InjeksiKering
Bentuksuatuobatyangdibuatsebagaiobatsuntiktergantungpadasifatobatitusendiridengan
memperhitungkansifatfisikadankimiadanjugapertimbanganterapeutiktertentu.Umumnya,bila
obat tidak stabil dalam larutan, ia akan dibuat sebagai bubuk kering yang dimaksudkan untuk
dibentukdengan penambahan pelarut yangtepat pada waktu akandiberikan, ataudapat dibuat
dalambentuksuspensipartikelobatdalampembawadimanaobattidaklarut.(ANSELED4,1989,
HAL.405).
LarutanTerkonstitusi(FIIVHAL12)Padasediaansterilyangakandibuatlarutanterkonstitusi
diberinamasesuaibentuknya.......sterilatau.....untukinjeksi.Karenasediaandikonstitusikanoleh
tenagamediksegerapadasaatdigunakan,ujidanketentuantentanglarutanyangdikonstitusiuntuk
pemberian tidak dimasukkan dalam masingmasing monografi padatan kering atau cairan pekat
steril. Untuk menjamin mutu sediaan injeksi sebagaimana diberikan, uji yang tidak merusak
sediaaninjeksiseprtiberikutinidilakukanuntukmemperlihatkankesesuaianlarutanterkonstituai
padasaatsebelumdigunakan.
1. KesempurnaandankejernihanmelarutKonstitusikanlarutansepertiterterapadaetiketdari
pabrikuntuksediaansterilkering.
Padatanmelarutsempurna,tidakterlihatmeninggalkansisayangtidakmelarut
Kejernihanlarutanterkonstitusitidakkurangjernihsecarasignifikandarivolumesama
pengenceratauairmurnidalamwadahserupadandiperiksadengancarayangsama.
2. BahanpartikulatKonstitusikanlarutandengancarasepertiyangterterapadaetiketsediaan
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

steril kering: larutan tidak mengandung partikel bahan asing yang dapat dilihat secara
visual.
LAMPIRANEVALUASISEDIAAN
EVALUASIFISIK
1. PENETAPANpH(FIIV<1071>hal10391040)
Tujuan:MenetapkanpHsuatusediaanlarutanagarsesuaidenganmonografi
Carapengerjaan:LarutandaparuntukpembakuanBuatmenurutpetunjuksesuaiTabel.Simpan
dalam wadah tahan bahan kimia, tertutup rapat, sebaiknya dari kaca tipe I. Larutan segar
sebaiknyadibuatdenganintervaltidaklebihdari3bulan. Tabel berikutmenujukkanpHdari
larutandaparsebagaifungsidarisuhu.Petunjukinidigunakanuntukpembuatanlarutandapar
dengan kadar molal sebagaimana disebutkan. Untukmemudahkan, petunjuk diberikan dengan
pengenceranhinggavolume1000ml,bukandenganmenyebutkanpenggunaan1000gpelarut
yangmerupakandasarsistemmolalitasdarikadarlarutan.Jumlahyangdisebutkantidakdapat
secarasederhanadiperhitungkankantanpainformasitambahan.
Kaliumtetraoksalat0,05mLarutkan12,61gKH3(C2O4)2.2H2Odalamairhingga1000ml.
Kaliumbiftalat0,05m Larutkan10,12gKHC8H4O4,yangtelahdikeringkanpadasuhu110 o
selama1jam,dalamairhingga1000ml.RF
Ekuimolalfosfat0,05m Larutkan3,53gNa2HPO4 dan3,39gKH2PO4,masingmasingtelah
dikeringkanpadasuhu120oselama2jam,dalamairhingga1000ml.
Natriumtetraborat0,01mLrutkan3,80gNa2B4O7.10H2Odalamairhingga1000ml.Lindungi
daripenyerapankarbondioksida.
Kalsiumhidroksidajenuhpadasuhu25 o Kocok kalsiumhidroksidaP berlebihdenganairdan
enaptuangkan pada suhu 25o sebelum digunakan. Lindungi dari penyerapan karbondioksida.
KarenaadanyavariasidalamsifatmaupuncarakerjapHmeter,tidakpraktisuntukmemberikan
petunjukyangdapatditerapkansecaraumumuntukpenetapanpHsecarapotensiometrik.Prinsip
umumyangharusdiikutidalammelakukanpetunjukyangterdapatpadamasingmasingalatoleh
pabrikakandiuraikanpadaparagrafberikut.Sebelumdigunakan,periksaelektrode,danjembatan
garamjikaada.Jikaperlu,isilagilarutanjembatangaramdanperhatikanpetunjuklainyang
diberikanolehpabrikalatataupabrikelektrode.UntukpembakuanpHmeter,pilih2 larutan
daparuntukpembakuanyangmempunyaiperbedaanpHtidaklebihdari4unitdansedemikian
rupasehinggapHlarutanujidiharapkanterletakdiantaranya.IsiseldengansalahsatuLarutan
daparutnukpembakuan padasuhuyanglarutanujinyaakandiukur.Pasangkendalisuhupada
suhularutan,danaturkontrolkalibrasiuntukmembuatpHidentikdenganyangtercantumdalam
Tabel.BilaselektrodedanselbeberapakalidenganLarutandaparuntukpembakuanyangkedua,
kemudianisiseldenganlarutantersebutpadasuhuyangsamadenganlarutanuji.pHdarilarutan
daparkedua0,07unitpHdarihargayangterteradalamTabel.Jikapenyimpanganterlihatlebih
besar, periksa elektrode dan jika terdapat kesalahan, supaya diganti. Atur kemiringan atau
suhu hingga pH sesuai dengan yang tertera pada Tabel. Ulangi pembakuan hingga kedua
larutandaparuntukpembakuanmemberikanhargapHtidaklebihdari0,02unitpHdariharga
yangterterapadaTabel,tanpapengaturanlebihlanjutdaripengendali.Jikasistemtelahberfungsi
dengan baik, bilas elektrode dan sel beberapa kali dengan larutan uji, isi sel dengan sedikit
larutan uji dan baca harga pH. Gunakan air bebas karbon dioksida P untuk pelarutan atau
pengenceranlarutanuji.JikahanyadiperlukanhargapHperkiraandapatdigunakanindikatordan
kertasindikator.

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Suhu
(C)
10
15
20
25
30
35
40
45
50
55
60

Kalium
tetraoksalat
(0,05m)
1,67
1,67
1,68
1,68
1,68
1,69
1,69
1,70
1,71
1,72
1,72

Kalium
biftalat
(0,05m)
4,00
4,00
4,00
4,01
4,02
4,02
4,04
4,05
4,06
4,08
4,09

Ekimolal
fosfat
(0,05m)
6,92
6,90
6,88
6,86
6,85
6,84
6,84
6,83
6,83
6,83
6,84

Natrium
tetraborat
(0,01m)
9,33
9,28
9,23
9,18
9,14
9,10
9,07
9,04
9,01
8,99
8,96

Kalsium hidroksida
jenuh pada suhu 25
C
13,00
12,81
12,63
12,45
12,29
12,13
11,98
11,84
11,71
11,57
11,45

2.PENETAPANVOLUMEINJEKSIdalamWADAH(FIIV<1131>hal1044)
Tujuan:Menetapkanvolumeinjeksiyangdimasukkandalamwadahagarvolumeinjeksi
yang
digunakantepat/sesuaidenganyangterterapadapenandaan.(Volumeinjeksinyaituharus
dilebihkan.
KelebihanvolumeyangdianjurkandipersyaratkandalamFIIV)
CaraPengerjaan:Pilihsatuataulebihwadah,bilavolume10mlataulebih,3wadah
ataulebihbilavolumelebihdari3mldankurangdari10ml,atau5wadahataulebihbila
volume3mlataukurang.Ambilisitiapwadahdenganalatsuntikhipodermikkering
berukurantidaklebihdari3kalivolumeyangakandiukurdandilengkapidenganjarum
suntiknomor21,panjangtidakkurangdari2,5cm.Keluarkangelembungudaradari
dalamjarumdanalatsuntikdanpindahkanisidalamalatsuntik,tanpamengosongkan
bagianjarum,kedalamgelasukurkeringvolumetertentuyangtelahdibakukansehingga
volumeyangdiukurmemenuhisekurangkurangnya40%volumedarikapasitastertera
(garisgarispenunjukvolumegelasukurmenunjukvolumeyangditampung,bukanyang
dituang).Caralain,isialatsuntikdapatdipindahkankedalamgelaspialakeringyang
telah ditara, volume dalam ml diperoleh dari hasil perhitungan berat dalam gdibagi
bobotjeniscairan.Isidariduaatautigawadah1mlatau2mldapatdigabungkanuntuk
pengukurandenganmenggunakanjarumsuntikkeringterpisahuntukmengambilisitiap
wadah. Isi dari wadah 10 ml atau lebih dapat ditentukan dengan membuka wadah,
memindahkanisisecaralangsungkedalamgelasukurataugelaspialayangtelahditara.
Volumetidakkurangdarivolumeyangterterapadawadahbiladiujisatupersatu,atau
bilawadahvolume1mldan2ml,tidakkurangdarijumlahvolumewadahyangtertera
padaetiketbilaisidigabung.
Volume tertera dalam Kelebihanvolumeyangdianjurkan
penandaan(ml)
Untukcairanencer(ml)

Untukcairankental(ml)

0,5
1,0
2,0
5,0
10,0

0,12
0,15
0,25
0,50
0,70

0,10
0,10
0,15
0,30
0,50
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

20,0
30,0
50,0ataulebih

0,60
0,80
2%

0,90
1,20
3%

Biladalamwadahdosisgandaberisibeberapadosisvolumetertera,lakukanpenentuan
sepertidiatasdengansejumlahalatsuntikterpisahsejumlahdosistertera.Volumetiap
alatsuntikyangdiambiltidakkurangdaridosisyangtertera.
Untukinjeksimengandungminyak,bilaperluhangatkanwadahdansegerakocokbaik
baik sebelum memindahkan isi. Dinginkan hingga suhu 25 o C sebelum pengukuran
volume.
3.BAHANPARTIKULATDALAMINJEKSI(FIIV<751>hal981984)
Tujuan: Larutan injeksi, termasuk larutan yang dikonstitusi dari zat padat steril untuk
penggunaan parenteral, harus bebas daripartikel yangdapat diamati padapemeriksaan
secara visual. Cara Pengerjaan: Dua prosedur untuk penetapan bahan partikulat
dicantumkanberikutini,berbedasesuaidenganvolumeyangterterapadaetiketwadah.
Semua injeksi volume besar untuk infus dosis tunggal, dan injeksi volume kecil yang
ditetapkandalampersyaratanmonografi,harusmemenuhibatasbahanpartikulatseperti
yangterterapadaujiyangdigunakan
INJEKSI VOLUME BESAR UNTUK INFUS DOSIS TUNGGAL [Catatan Selama
melakukan prosedur ini gunakan sarung tangan yang sesuai bebas serbuk pelincir,
peralatankacadanperlengkapanyangtelahdibersihkansecaracermatdenganpencucian
berturut turut menggunakan larutan deterjen hangat, air panas, air, dan isopropanol.
Semprotkanairberkalikalidengankuatpadapermukaanalatyangdiletakkanvertikal,
lakukan perlahanlahan dari atas ke bawah. Lakukan pembilasan dengan isopropanol
dalamlemarialirlamineryangdilengkapidenganpenyaringpartikulatudaraberefisiensi
tinggi, biarkan alatalat mengering dalam lemari asam. Sebaiknya letakkan lemari di
ruang terpisah yan dilengkapi dengan alat penyaring dan pendingin udara, dan
pertahankantekananudaralebihtinggidaridaerahsekitarnya.Sebelummelakukanuji,
bersihkan lemari alir laminer dengan pelarut yang sesuai kecuali permukaa media
penyaring.Pertahankankecepatanaliranudarapada0,450,1meterperdetik.]
Penyaring membran dan rangkaiannya Dengan menggunakan pinset, angkat penyaring
membranberkisiwarnakontrasdariwadahnya.Cucikeduasisimembrandenganaliranair
yang telah dimurnikan dengan penyaringanmelalui membran yang sesuai untuk
menghilangkanbahanpartikulatberdimensilinierefektiflebihbesardari5 m,dengan
meletakkanpenyaringpadaposisivertikal,mulaipadabagianatasdarisisitidakberkisi,
lewatkanaliranairberkalikalipadapermukaandenganperlahanlahandariataskebawah
hinggapartikelterbawakebawahlepasdaripenyaring,danulangiprosespencucianpada
sisi yang berkisi. Letakkan membran (sisi yan berkisi menghadap ke atas) diatas dasr
penyanggapenyaringdasartanpamenyentuhpenyaringmembran.Balikkanunitrangkaian,
cucibagiandalamcorongselamalebihkurang10detikdengasemprotanairyantelah
disaring.Biarkanairmengalirdanletakkanunitpadalabupenyaring.
Larutanuji Campurlarutandenganmembalikkanwadah20kali.Bersihkanpermukaan
luarwadahdengansemprotanairdanangkattutuphatihatiagartidakterjadipengotoran
isiwadah.Masukkan25mllarutanyangtelahtercampurbaikkedalamcorong,biarkan
selama1menit,pasangpenghisapudaradansaring.Lepaskanpenghisapudaraperlahan
lahan dancuci dinding dalam corongdengan semprotan 25mlair yangtelah disaring
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

sedemikianrupauntukmencucidindingcorongagarbebasdaritiappartikelyangmungkin
menempelpadadinding,tetapihindarkanagarsemprotatidakmengarahkeataspermukaan
penyaring.Setelahturbulensidalampenyaringreda,bilasandisaringdenganhampaudara.
Angkat dengan hatihati bagian atas rangkaian penyaring, sambil menjaga tetap dalam
keadaanhampaudara.Lepaskanpenghisapdanangkatpenyaringmembrandenganpinset.
Letakkanpenyaringpadalempengpetriplastik,bilaperlugunakangemukpelumaskran
yansangattipissebagaipralapis,untukmenahanpenyaringtetapdatardantidakbergerak.
Biarkanprnyarinmengeringdengantutuppetrisedikitmerenggang.Tutupobyekdengan
hatihati,amatidibawahmikroskopyandilengkapidenganmikrometerdanhitungpartikel
padapenyaringsepertidibawahini.
Penetapan Amatiseluruhpenyaringmembrandibawahmikroskopyangsesuaidengan
perbesaran100xdenganpenyinaranpadasudut10ohingga20oterhadapgarishorisontal.
Hitungjumlahpartikeldengandimensilinierefektif10mataulebihdansamaataulebih
besardari25m.LakukanpenetapanblangkodenganmenggunakanPenyaringmembran
danrangkaiannyasepertiyangterterapadaLarutanujimulaidengancucidindingdalam
corongdengansemprotan.....KurangijumlahtotalpartikelyandiperolehpadaLarutanuji
denganjumlahtotalblangko.[CatatanUntuklarutanyangmengandungdekstrosa,jangan
menghitungpartikeldenganmorfologitidakjelas,yangmenunjukkansedikitatausama
sekalitanpareliefpermukaandanberbentuksepertigelatinatausepertifilm.Olehkarena
dalamlarutanbahantersebutterdiridariunitunityangukurannyasamataukurangdari
1 m dan hanya dapat dihitung setelah terjadi agregasi dan atau deformasi pada
membran,interpretasipenghitungan dapatdilaukandenganmengamati contohlarutan
denganbantuanalatpenghitungpartikelelektronikyangsesuai.]
Interpretasi Lakukan penetapan duplo dari Larutan uji dan blangko. Jika penetapan
blangkomenghasilkanlebihdari5partikeldengandimensilinierefektif25mataulebih,
menunjukkan bahwa lingkungan pelaksanaan pekerjaan tidak memuaskan danuji tidak
absah.
Injeksivolumebesaruntukinfusdosistunggalmemenuhisyaratujijikamengandungtidak
lebihdari50partikelpermlyangsetaraataulebihbesardari10mdantidaklebihdari5
partikelpermlyangsetaraataulebihbesardari25mdalamdimensilinierefektif.
INJEKSIVOLUMEKECIL
[Catatan Siapkan contoh, alat kaca, pentutup dan perlengkapan lain yang diperlukan
dalam lingkungan yang terlindung dengan menggunakan penyaring HEPA (udara
partikulatefisiensitinggi).Selamapersiapan,gunakanpakaianbebaspartikeldansarung
tanganbebasserbuk.Sebaiknyalemaripengujiandiletakkandiruangterpisahyangdialiri
udara yang telah dilewatkan penyaring HEPA ( udara partikulat efissiensi tinggi),
penyejukruangansertatrekondisidandijagaagartekananudarapositifterhadapdaerah
sekitar.]
Gunakanbejanayangtahantekanansampai100psidenganpipatahantekananyangtidak
melepas partikel dan pipa semprot yang dipegang tangan serta dilengkapi dengan
penyaringuntukmenyaringairpembersihdanpembuatancontoh.Gunakanpenyaringrata
atauhalusberporiukuran5,0mataukurang.Untuktujuanpembakuandanpenyiapan
contoh, gunakan wadah kaca yang diperkeras dan tidak melepaskan partikel, dengan
lubanglubangsekecilmungkinuntukmengurangipengotoranyangtimbulkarenatidak
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

hatihati.Jikamenggunakanpenutup,pilihyangtidakmelepaspartikelsepertipolitef.
PencucianalatkacadanpenutupCucialatalatkaca,penutupdanperlengkapanlainyang
diperlukandenganmeredamdanmenyikatnyadalamlarutandeterjiknonionikyanghangat,
kemudian bilas dengan air ledeng hangat yang mengalir, lanjutkan pembilasan dengan
mengalirkanairyangtelahdisaring.Pelarutorganikdapatdigunakanuntukmemudahkan
pencucian.Akhirnyabilasdenganairbertekananyangtelahdisaringmenggunakanpipa
semprotyangdilengkapidenganpenyaringakhirataudenganmenggunakanalatlainyang
sesuai.
Ujikontrolpartikulat Lakukanujiiniuntukmenetapkanbahwalingkungansesuaiuntuk
melakukananalisisdanbahwaalatkacatelahbenarbenarbersihsertauntukmeyakinkan
bahwaairyangdigunakanuntukanalisisbebaspartikel.Gunakanairyangtelahdisaring
dan alat kaca yang telah dibersihkan untuk mengambil 5 contoh air secara berurutan,
masingmasing 5 ml. Balikkan tiap contoh 20 kali. Awaudarakandengan ultrasonikasi
selama30detikataudenganmembiarkanselama2menit.Aduksetiapcontohairsecara
mekanikpadakecepatanyangcukupuntukmenimbulkanpusaranlemahselamaanalisis.
Jika5partikelberukuran25matau25partikelberukuran10matauukuranlebihbesar
teramatidalamseluruh25mlcontohair,makainimenunjukkanbahwalingkungantidak
sesuaiuntukanalisis,atauairyangsudahdisaringdanalatkacatidakdipersiapkandengan
baik.Ulangilangkahpersiapansampailingkungankerja,airdanalatkacasesuaiuntuk
melakukanujiini.
KalibrasiKalibrasialatdengan3baku,masingmasingterdiridaribolapolistirendengan
satuukuransamalebihkurang10m,20mdan30mdalampembawaberupaair.Bila
menggunakanbakupembandingpartikulat,perlumengurangipenggumpalanpartikeldan
memastikan kemurnian partikel. Bila diinginkan, tersedia metode yang sesuai untuk
memeriksa bolabola komersial. Tetapkan akurasi penghitungan dan ukuran dari alat
penghitung cemaran partikel dalam cairan dengan menggunakan bahan partikulat
berbentuk bola dengan ukuran hampir sama yang terdispersi untuk mengkalibrasi alat
penghitungpartikelotomatik.
Larutanuji Siapkancontohdenganurutansebagaiberikut:Lepaskanpenutupluar,pita
segeldansemuaetiketkertaslepas,cucibagianluarwadahseperticarayangterterapada
Pencucian alat kaca dan penutup dan keringkan dalam aliran udara bebas partikel.
Keluarkan isi wadah seperti dilakukan pada penggunaan biasa atau sesuai aturan pada
etiket kecuali pada wadah dengan pentutup yang dapat dibuka, contoh dapat diambil
denganmembukatutupdanmenuangkanisiwadahkedalamwadahlainyangbersih.
Penetapan
A.SediaanCair
(1) Campurisiwadahdenganmembolakbalikkan25kalidalamwaktu10detik.[Catatan
Karena volume beberapa sediaan begitu kecil, diperlukan pengocokan yang lebih
kuatuntukmensuspensikanpartikeldengasempurna.]
(2) Bukadankumpulkanisidaritidakkurang10wadahhinggamemperolehvolumetidak
kurangdari20mldalamwadahbersih.
(3) Awaudarakandenganultrasonikasiselama30detikataudiamkanselama2menit
(4) Aduk perlahanlahanmemutar dengan tangan atau secara mekanik, hatihai jangan
sampai masuk gelembung udara atau cemaran lain. Aduk terus menerus selama
melakukananalisis.
(5) Ambil 3 bagian berturutturut, tiap bagian tidak kurang dari 5 ml. Buang contoh
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

pengambilanpertama
B.SediaanKeringatauTerliofilisasi
(1) Bukawadah,hatihatijanganmencemaripenutup.
(2) Konstitusikandengansejumlahvolumeairyangtelahdisaringataupelarutyangtepat
dantelahdisaring,jikapelarutairtidaksesuai.
(3) TutupkembalidankocoksepertipadaA
(4) LakukananalisissepertipadaA.
C.Untuksediaanyangdikemasdalamwadahyangdibuatkhususuntuksediaanobatdan
pelarut dalam wadah terpisah, campur tiap unit kemasan seperti tertera pada etiket.
LakukananalisissepertiyangterterapadaA.
D. Untuk sediaan dengan etiket Kemasan besar untuk farmasi Bukan untuk infus
langsung,lakukansepertiterterapadaAatauB.Lakukanujipadasejumlahunityang
setara dengan dosis maksimum yang tertera pada etiket. Untuk perhitungan di bawah,
perhatikankesetaraanbagianiniterhadapseluruhisiwadah.
Perhitungan Rataratakan hasil hitungan dari 2 contoh yang dianalisis. Hitung jumlah
partikeldalamtiapwadah,Pc,denganrumus:

Cadalahhitunganpartikelrataratayangdiperolehdaricontohyangdianalisis;V T adalahvolume
dalammlseluruhcontohyangdianalisis;V P adalahvolumedalammltiapbagiancontohdanN
adalahjumlahwadahcontohyangdigunakanpadaanalisis.

InterpretasiInjeksivolumekecilmemenuhisyaratujijikajumlahrataratapartikelyangdikandung
tidaklebihdari10.000tiapwadahyangsetaraataulebihbesardari10mdiametersferikefektif
dantidaklebihdari1000tiapwadahsamaataulebihbesardari25mdiametersferikspesifik.
UJIKEBOCORAN(GoeswinAgoes,LarutanParenteralhal191192)
Tujuan: memeriksa keutuhan kemasan untuk menjaga sterilitas dan volume serta kestabilan
sediaan.
CaraPengerjaan:Padapembuatansecarakecilkecilanhalinidapatdilakukandenganmatatetapi
dalamjumlahbesarhalinitidakmungkinbisadikerjakan.

a.Wadahwadahtakarantunggalyangmasihpanas,setelahselesaidisterilkan
dimasukkan
kedalamlarutanbirumetilena0,1%.Jikaadawadahwadahyangbocormakalarutan
biru
metilenaakanmasukkedalamnyakarenaperbedaantekanandiluardandidalamwadah
tersebut.Tentusajacarainitidakdapatdipakaiuntuklarutanlarutanyangsudah
berwarna.
b.Wadahwadahtakarantunggaldisterilkanterbalikyaitudenganujungnyadibawah.Ini
juga
digunakanpadapembuatandalamskalakecil.Jikaadakebocoranmakalarutaninidari
dalam
wadahakankeluar,danwadahmenjadikosong.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

b. Wadahwadahyangtidakdapatdisterilkan,kebocorannyaharusdiperiksadengan

memasukkanwadahwadahtersebutdalameksikator,yangkemudiandivakumkan.
Jikaadakebocoranlarutanakandiserapkeluar.Harusdijagaagarjangansampai
larutanyangtelahkeluar,diisapkembalijikavakumdihilangkan.
UJIKEJERNIHANDANWARNA (GoeswinAgoes,LarutanParenteralhal201202)
Setiap larutan obat suntik harus jernih dan bebas dari kotoran sehingga diperlukan uji
kejernihansecara visual.Prosedur : wadahwadah kemasan akhir diperiksa satu persatu
dengan menyinari wadah dari sampingdengan latar belakang sehelai papan yang
separuhnyadicatbewarnahitam danseparuhlagidicatberwarnaputih.Latarbelakang
hitam dipakai untuk menyelidiki kotoran yang bewarna muda,sedangkan berlatar putih
untukkotorankotoranberwarnagelap.Penafsiran:memenuhisyaratjikatidakditemukan
kotorandalamlarutan
a. KEJERNIHANLARUTAN(FIIV<881>hal998)
Tujuan:Sediaaninfusatauinjeksiyangberupalarutanharusjernihdanbebasdarikotoran,
makaperludlakukanujikejernihansecaravisual.
CaraPengerjaan:Penetapanmenggunakantabungreaksialasdatardiameter15mmhingga
25mm,tidakberwarna,transparan,danterbuatdarikacanetral.Masukkankedalamdua
tabung reaksi masingmasing larutan zat uji dan Suspensi padanan yang sesuai
secukupnya, yang dibuat segar dengan cara seperti tertera dibawah sehingga volume
larutan dalam tabung reaksi terisi setinggi tepat 40 mm. Bandingkan kedua isi tabung
setelah5menitpembuatan Suspensipadanan,denganlatarbelakanghitam.Pengamatan
dilakukandibawahcahayayangterdifusi,tegakluruskearahbawahtabung.Difusicahaya
harussedemikiansehinggaSuspensipadananIdapatlangsungdibedakandariairdandari
SuspensipadananII.
BakuopalesenLarutkan1,0ghidrazinasulfatP dalamairsecukupnyahingga100,0ml,
biarkanselama4jamhingga6jam.Pada25,0mllarutaniniditambahkanlarutan2,5g
heksaminaP dalam25,0mlair,campurdanbiarkanselama24jam.Suspensiinistabil
selama2bulanjikadisimpandalamwadahkacayangbebasdaricatapermukaan.Suspensi
tidak boleh menempel pada kaca dan harus dicampur dengan baik sebelum digunakan
Untukmembuat Bakuopalesen,encerkan15,0mlsuspensidenganairhingga1000ml.
Suspensiharusdigunakandalamwaktu24jamsetelahdigunakan.
SuspensipadananBuatlahSuspensipadananIsampaidenganSuspensipadananIVdengan
carasepertiyangterterapada Tabel.Masingmasingsuspensiharustercampurbaikdan
dikocoksebelumdigunakan.
Suspensipadanan
Bakuopalesen(ml)
Air(ml)

II

III

IV

5,0
95,0

10,0
90,0

30,0
70,0

50,0
50,0

Pernyataan kejernihan dan derajat opalesen Suatu cairan dinyatakan jernih jika
kejernihannya sama dgn air atau pelarut yang digunakan bila diamati dibawah kondisi
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

seperti tersebut diatas atau jika opalesensinya tdk lbh nyata dari Suspensi padanan I.
Persyaratan untuk derajat opalesensi dinyatakan dalam Suspensi padanan I, Suspensi
padananII,danSuspensipadananIII.
7. UJI KESERAGAMAN SEDIAAN <991> FI IV hal. 999 Ada 2 metode, yaitu
keseragamanbobot,dankeseragamankandungan.Metodediterapkantergantungpadajenis
sediaan.
KeseragamanBobot
SEDIAANPADATSTERILUNTUKPARENTERAL:Timbangseksama10vial,satu
persatu,beriidentitastiapvial.Keluarkanisidengancarayangsesuai.Timbangseksama
tiapvialkosong,danhitungbobotnettodaritiapisivialdengancaramengurangkanbobot
vialdarimasingmasingbobotsediaan(bobotvialyangadaisinya).DarihasilPenetapan
Kadar,sepertiterterapadamasingmasingmonografi,hitungjumlahzataktifdalamtiap
vial,dengananggapanbahwazataktifterdistribusisecarahomogen.
KeseragamanaKandungan
SEDIAANPADASTERILDALAMDOSISTUNGGAL:Tetapkankadar10vialsatuper
satu,sepertipadaPenetapanKadardalammasingmasingmonografikecualidinyatakan
laindalamUjiKeseragamanKandungan.Jikajumlahzataktifdalamsatuandosistunggal
kurangdariyangdibutuhkandalamPenetapanKadar,aturderajatpengencerandarilarutan
danatauvolumealikuotsehinggakadarzataktifdalamlarutanakhirlebihkurangsama
sepertiyangterterapadaprosedurPenetapanKadar;ataujikapenetapankadardilakukan
secaratitrasi,gunakantitranyangmemadaisepertiyangterterapadaTitrimetri<771>,pada
ProsedurdalamUjidanPenetapanKadardalamKetentuandanPersyaratanUmum.Jika
dilakukan modifikasi sepertiinidalam prosedurpenetapan kadardalam masingmasing
monografi,buatperubahanyangsesuaidalamrumusperhitungandanfaktortitrasi.Bila
prosedur khusus disebutkan untuk uji keseragaman kandungan dalam masingmasing
monografi,lakukankoreksi.
Kriteria
(A)Jikahargarataratadarihargabatas(limit)yangterterapadadefinisipotensidalam
tiapmonografiadalah100,0%ataukurang
BAHANPADATSTERILDOSISTUNGGALDANUNTUKPARENTERAL:kecuali
dinyatakanlaindalammasingmasingmonografi,persyaratankaseragamandosisdipenuhi,
jikajumlahzataktifdalammasingmasingdari10satuansediaansepertiyangditetapkan
dari cara Keseragaman Bobot atau dalam Keseragaman Kandungan terletak antara 85
115%dariyangterterapadaetiketdansimpanganbakurelatif6%.Jika1satuanterletak
diluarrentang85,0115,0%dantidakadasatuanterletakantararentang75,0125,0%,atau
jikasimpanganbakurelatif>6,0%ataujikakeduakondisitidakterpenuhi,lakukanuji20
satuantambahan.Persyaratandipenuhijikatidak>1satuandari30terletakdiluarrentang
85,0115,0%dariyangterterapadaetiketdantidakadasatuanyangterletakdiluarrentang
75,0125,0%,dansimpanganbakurelatifdari30satuantidak>7,8%.
(B) Jika ratarata dari harga batas potensi pada Ketentuan potensi masingmasing
monografi>100,0%
1 Jikahargarataratasatuansediaanyangdiuji100,0%ataukurang,persyaratanseperti
yangterterapada(A)
2 Jika ratarata satuan ratarata batas, persyaratan seperti (A), hanya kata2 yang
tertera dietiket diganti jadiseperti terterapadaetiketdikalikandenganratarata
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

hargabatasyangterterapadaketentuanpotensidalammonografidibagidengan100
Jikarataratasatuanterletakdiantara100%danrataratahargabatasyangterterapada
ketentuanpotensisepertipada(A),kecualibahwakatakatayangterteradietiket
digantijadisepertiterterapadaetiketdikalikandenganhargarataratasatuansediaan
yangdiuji(dinyatakansbg%yangterterapadaetiket)dibagidengan100

EVALUASIBIOLOGI
1.UJIEFEKTIVITASPENGAWETANTIMIKROBA <61>(FIIV,hal.854855)
Tujuan: Menunjukan efektivitas pengawet antimikroba yang ditambahkan pada sediaan
dosis ganda yang dibuat dengan dasar atau bahan pembawa air seperti produkproduk
parenteral, telinga, hidung, dan mata yang dicantumkan pada etiket produk yang
bersangkutan.
Cara Pengerjaan: Jika wadah sediaan dapat ditembus secara aseptik
menggunakanjarumsuntikmelaluisumbatkaret,lakukanpengujianpada5
wadahaslisediaan.Jikawadahsediaantidakdapatditembussecaraaseptik,
pindahkan 20 ml sampel ke dalam masingmasing 5 tabung bakteriologik
tertutup, berukuran sesuai dan steril. Inokulasi masingmasing wadah atau
tabungdengansalahsatumikrobabaku,menggunakanperbandingan0,10ml
inokulasetaradengan20mlsediaan,dancampur.Mikrobaujidenganjumlah
yang sesuai harus ditambahkan sedemikian rupa hingga jumlah mikroba di
dalamsediaanujisegerasetelahinokulasiadalahantara100.000dan1000.000
perml.Tetapkanjumlahmikrobaviabeldidalamtiapsuspensiinokula,dan
hitungangkaawalmikrobatiapmlsediaanyangdiujidenganmetodelempeng.
Inkubasiwadahatautabungyangtelahdiinokulasipadasuhu2025.Amati
wadahatautabungpadaharike7,14,21,dan28setelahinokulasi.Catatiap
perubahanynagterlihatdantetapkanjumlahmikrobaviabelpadaselangwaktu
tersebut dengan metode lempeng. Dengan menggunakan bilangan teoritis
mikroba pada awal pengujian, hitung perubahan kadar dalam persen tiap
mikrobaselamapengujian.PenafsiranhasilSuatupengawetdinyatakanefektif
dalamcontohyangdiujijika:
a.Jumlahbakteriviabelpadaharike14berkuranghinggatidak>0,1%darijumlah
awal.
b.Jumlahkapangataukhamirviabelselama14hariadalahtetapataukurangdari
jumlahawal.
c.Jumlahtiapmikrobaujiselamaharitersisadari28haripengujianadalahtetapatau
<bilanganyangdisebutpadaadanb.
2.UJIKANDUNGANZATANTIMIKROBA(FIIV<441>HAL939942)
Tujuan:untukmenunjukkanbahwazatyangterteramemangadatetapitidaklebihdari
20%darijumlahyangterterapadaetiket.CaraPengerjaan:
BenzilAlkohol
LarutanBakuinternalLarutkanlebihkurang380mgfenolPdalam10mlmetanolP
dalamlabutentukur200ml,tambahkanairsampaitanda.
LarutanbakuTimbangsaksamalebihkurang180mgbenzilalkoholP,larutkandalam
20,0 ml metanol P dalam labu tentukur 100ml. Tambahkan Larutan baku internal
sampaitanda.
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

ProsedurSuntikkansecaraterpisahsejumlahvolumesama(lebihkurang5l)Larutan
bakudanlarutanuji,gunakanparameteroperasionalkromatografgassepertiyangtertera
padaTabel.UkurluaspuncakbenzilalkoholdanfenolLarutanbaku,tandaimasing
masingdenganP1 danP2,danluaspuncakp1 danp2 dariLarutanuji.Hitngjumlahdalammg
C7H8O,permlzatujiyangdigunakandenganrumus

CadalahkadarbenzilalkoholdalammgpermlLarutanbaku,
Vadalahvolumezatujidalammltiap100mlLarutanuji.
Klorobutanol
LarutanbakuinternalLarutkanlebihkurang140mgbenzaldehidaPdalam10mlmetanolP
dalamlabutentukur100ml,goyangsampailarut,danencerkandenganairsampaitanda.
LarutanbakuTimbangsaksamalebihkurang125mgklorobutanolP,masukkankedalamlabu
tentukur25ml.Tambahkan2mlmetanolP,goyangsampailarut.Encerkandenganairsampai
tanda.Pipet5mllarutaninidan5,0mlLarutanbakuinternal,masukkankedalamlabutentukur
25ml,campurhinggakadarklorobutanollebihkurang2,5mgperml.
Larutan uji Ukur saksama sejumlah volume zat uji, jika perlu encerkan dengan metanol P
hinggahinggamengandungklorobutanoltidaklebihdari5,0mgperml.Campur3,0mllarutan
inidengan3,0mlLarutanbakuinternal.
Sistem kromatografi Lakukan seperti yang tertera pada Kromatografi <931>[CatatanLihat
Tabel Parameter Operasional Kromatografi Gas]. Pertahankan suhu injektor dan detektor
masingmasingpadasuhu180odan220o.LakukankromatografiterhadapLarutanbaku,rekam
responspuncaksepertiyangterterapadaProsedur:resolusi,R,antarapuncakbenzaldehidadan
klorobutanoltidakkurangdari2,0dansimpanganbakurelatifpadapenyuntikanulangtidaklebih
dari2,0%.

ProsedurSuntikkansecaraterpisahsejumlahvolumesama(lebihkurang1l)Larutan
bakudanLarutanujikedalamkromatograf,ukurresponspuncakutama.Wakturetensi
relatifbenzaldehidadanklorobutanolmasingmasinglebihkurang0,8dan1,0.Hitung
jumlahdalammgC4H7Cl3O,permlzatujiyangdigunakandenganrumus:

CadalahkadarklorobutanoldihitungterhadapzatanhidratdalammgpermlLarutanbaku;L
adalahjumlahklorobutanolyangterterapadaetiketdalammgpermlzatuji;Dadalahkadar
klorobutanol dalam mg per ml Larutan uji dihitung terhadap volume zat uji yang telah
diencerkan;Ru danRs berturutturutadalahperbandinganpuncakklorobutanoldanbenzaldehida
dalamLarutanujidanLarutanbaku.
Fenol
Larutanbakuinternal Pipet1ml benzilalkoholP,masukkankedalamlabutentukur500
ml,tambahkanmetanolPsampaitanda.
LarutanbakuTimbangsaksamalebihkurang75mgfenolP,larutkandalam7,5mlmetanol
Pdalamlabutentukur100ml.Tambahkan20,0mlLarutanbakuinternaldantambahkanair
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

sampaitanda.

Prosedur Suntikkan secara terpisah sejumlah volume sama (lebih kurang 3 l)


LarutanbakudanLarutanujigunakanparameteroperasionalkromatografgasseperti
yangterterapadatabel.UkurluaspuncakfenoldanbenzilalkoholdariLarutanbaku,
tandaimasingmasingdenganP1danP2,danpuncakP1danP2dariLarutanuji.Hitung
jumlahdalammgC6H6O,dalampermlzatujiyangdigunakandenganrumus

CadalahkadarfenoldalammgpermlLarutanbaku;Vadalahvolumezatujidalammlper100
ml
Larutanuji.
MetilparabendanPropilparaben
LarutanbakuinternalTimbanglebihkurang200mgbenzofenonP,masukkankedalamlabu
tentukur250ml,tambahkaneterPsampaitanda.
Larutan baku Timbang saksama masingmasing 100 mg metilparaben P dan 10 mg
propilparabenP,masukkankedalamlabutentukur200ml,tambahkan Larutanbakuinternal
sampaitanda.Pipet10mllarutanini,masukkankedalamlabuErlenmeyer25mldanlanjutkan
sepertiyangterterapadaLarutanuji,mulaidariTambahkan3mlpiridinaP......
Larutanuji Pipet10mlzatujidan10ml Larutanbakuinternal,masukkankedalamcorong
pisahkecil.Kocokkuatkuat,biarkanlapisanmemisah,danpindahkanlapisaneterkedalamlabu
kecilmelaluicorongyangberisinatriumsulfatanhidratP.Ekstraksilapisanair2kali,tiapkali
dengan10mleterP,saringekstrakmelaluinatriumsulfatanhidratP.Uapkankumpulanekstrak
denganaliranudarakeringhinggavolumelebihkurang10ml,danmasukkanresidukedalam
labuErlenmeyer25ml.Tambahkan3mlpiridinaP,uapkaneterhinggasempurnadandidihkan
diataslempengpanashinggavolumelebihkurang1ml.
3. UJI STERILITAS <71>(FI IV hal.855863)Tujuan: menetapkan apakahbahanFarmakope
yangharussterilmemenuhipersyaratanberkenaandenganujisterilitasyangterterapadamasing
masingmonografi
CaraPengerjaan:
UjiFertilitas
Tetapkansterilitastiaplotmediadenganmenginkubasisejumlahwadahyangmewakili,padasuhu
danselamawaktuyangterterapadauji.
Lakukanujifertilitastiaplotmediaaritiapotoklafdenganmenginokulasiduplowadahtiapmedia
secara terpisah denagn 10 hingga 100 mikroba viabel dari tiap galur yang tertera dalam tabel
berikut,daninkubasipadakondisiyangsesuai.
Media

MikrobaUji
Suhu(o)

TioglikolatCair

Tioglikolatalternatif
SoybeanCaseinDigest

(1)Bacilissubtilis(ATCC6633)*
(2)Candidaalbicans(ATCC10232)
(3)Bacteroidesvulgatus(ATCC5482)**
(1)Bacteroidesvulgatus(ATCC5482)**
(1)Bacilissubtilis(ATCC6633)*
(2)Candidaalbicans(ATCC10232)

16

Inkubasi
kondisi

3035

Aerobik

3035
2025

Anaerobik
Aerobik

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Mediaujimemenuhisyaratjikaterjadipertumbuhanyangnyatadalamsemuawadahmedia
yangdiinokulasidalamkurunwaktu7hari.Penetapandapatdilakukansimultandengan
mediaujiuntukpengujianujisterilitas.Ujisterilitasdinyatakantidakabsahjikamediauji
menunjukkanresponpertumbuhanyangtidakmemadai.
BakteriostatikdanFungistatik
Sebelummelakukanujisterilitascarainokulasilangsungterhadapsuatubahan,tetapkan
tingkataktivitasbakteriostatikdanfungistatikdenagnprosedurberikut.Buatpengenceran
bakteridanjamurtidakkurangdarigalurmikrobasepertiyangterterapadaUjiFertilitas.
Inokulasimediaujisterilitasdengan10100mikrobaviabel,gunakanvolumesepertidalam
Tabel Jumlah untuk Bahan Cair pada Pemilihan spesimen uji dan masa inkubasi.
Tambahkan sejumla teetentu bahan ke dalam setengah dari jumlah wadah yang
mengandunginokulumdanmedia.Inkubasiwadahpadasuhudankondisisepertiyang
terteradalamtabelselamatidakkurangdari7hari.

Jikapertumbuhanmediaujidalamcampuranmediabahansecaravisualsebandingdengan
pertumbuhandalamtabungkontrol,gunakanjumlahbahandanmediasepertiyangtertera
padaTabeljumlahuntukbahancairdalamPemilihanspesimenujidanmasainkubasi.
Jikabahanyangdiujidengancarasepertidiatasadsalahbakteriostatikdan/ataufungistatik,
gunakansejumlahzatpenetral steril yangsesuai,jikatersedia. Kesesuaianzatpenetral
ditetapkan seperti yang tertera pada uji di bawah ini. Jika zat penetral tidak tersedia,
tetapkanjumlahdanmediayangsesuaidigunakansepertiyangterteradibawah.
Ulangipengujiandiatas,gunakansejumlahtertentubahandanvolumemediayanglebih
besar untuk menetapkan perbandingan media dan bahan yang tidak merugikan
pertumbuhanmikrobauji.
Jikasejumlahtertentubahandalam250mlmediamasihmempunyaidayabakteriostatik
atau fungistatik, kurangi jumlah bahan hingga diperoleh jumlah maksimum yang tidak
menghambatpertumbuhnamikrobaujidalam250mlmedia.Untukcairandansuspensi
yangjumlahnya <1ml,perbesarjumlah mediahinggacukupuntukmengencerkan dan
mencegahhambatanpertumbuhan.Untukbahanpadatyangtidaksegeralarutataudapat
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

terdispersi, jikia jumlahnya < 50 mg, perbesar jumlah media hingga cukup untuk
mengencerkan untuk mencegah hambatan pertumbuhan. Dalam tiap kasus, gunakan
perbandinganjumlahbahandanmediayangtelahdiketahuiuntukujisterilitas.
Jika digunakan penyaringan membran, buat perbandingan yang sama menggunakan
sejumlahtertentubahanujidancairanpengencerdanpembilasyangsesuai,bilasmembran
3 kali, tiap kali dengan 100 ml cairan pengecer dan pembilas. Inokulasikan sejumlah
tertentumikrobaviabelpadacairanpengencerdanpembilasterakhiryangdigunakanuntuk
menyaringbahanujidanpadacairanpengencerdanpembilassaja.Pertumbuhanmikroba
ujidarimembranyangdigunakanuntukmenyaringbahandiikuticairanpengencerdan
pembilasyangtelahdiinokulasisecarvisualsebandingdenganpertumbuhandarimembran
yang hanya digunakan untuk menyaring cairan pengencer dan pembilas yang telah
diinokulasi. UjiSterilitas Prosedurpengujianterdiridari(1)inokulasilangsungkedalam
mediaujidan(2)teknikpenyaringanmembran.UjisterilitasuntukbahanFarmakope,jika
mungkin mengunakan penyaringan membran, merupakan metode pilihan. Prosedur ini
terutamabergunauntukcairandanserbukyangdapatlarutyangbersifarbakteriostatikatau
fungistatik, untuk memisahkan mikroba kontaminan dari penghambat pertumbuhan.
Prosedurharusdivalidasiuntukpenggunaaktersebut.Denganalasanyangsamacaraini
bergunauntukbahansepertiminyak,salepataukrimyangdapatmelarutkedalamlarutan
pengencerbukanbakteriostatikataubukanfungistatik.Penggunaannyajugasesuaiuntuk
uji sterilitas cairan atau serbuk dapat larut bukanbaateriostatik atau bukan fungistatik.
Teknikpenyaringanmembrandapatjugadigunakanuntukujisterilitas permukaanatau
lumenkritisalatalatkesehatan.
PenafsiranHasilUjiSterilitas
TAHAPPERTAMAPadaintervalwaktutertentudanpadaakhirperiodeinkubasi,amati
isi semua wadah akan adanya pertumbuhan mikroba seperti kekeruhan dan/atau
pertumbuhanpadapermukaan.Jikatidakterjadipertumbuhan,makabahanujimemenuhi
syarat.
Jika ditemukan pertumbuhan mikroba tetapi peninjauan dalam pemantauan fasilitas
pengujian sterilitas, bahan yang digunakan, prosedur pengujian dan kontrol negatif
menunjukantidakmemadaiatauteknikaseptikyangsalahdigunakandalampengujian,
tahappertamadinyatakantidakabsahdandapatdiulang.
Jikapertumbuhan mikrobateramati tetapi tidakterbukti ujitahappertama tidak absah,
lakukantahapkedua.
TAHAPKEDUAJumlahspesimenujiyangdiseleksiminimumduakalijumlah Tahap
pertama.Volumeminimumtiapspesimenyangdiujidanmediadanperiodeinkubasisama
sepetiyangterterapadaTahappertama.Jikatidakditemukanpertumbuhanmikroba,bahan
yang diuji memenuhi syarat. Jika ditemukan pertumbuhan, hasil yang diperoleh
membuktikan bahwa bahan uji tidak memenuhi syarat. Jika dapat dibuktikan bahwauji
padaTahapkeduatidakabsahkarenakesalahanatauteknikaseptikyangtidakmemadai,
makaTahapkeduadapatdiulang.
(Catatan: Jika pengujian sterilitas digunakan sebagai bagian penilaian terhadap
produksi lot atau bets atau serentak sebagai satukriteria pengawasanmutu untuk
melepaskan lot atau bets, seperti yang tertera pada Sterilitas dan Jaminan
SterilitasBahanKompendia<1371>.)

16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

4.UJIPIROGEN<231>(FIIV,hal.908)Tujuan:untukmembatasiresikoreaksidemam
padatingkatyangdapatditerimaolehpasienpadapemberiansediaaninjeksi
CaraPengerjaan:
Lakukan pengujian dalam ruang terpisah yang khusus untuk uji pirogen dan dengan
kondisi lingkungan ynag sama dengan ruang pemeliharaan, bebas dari keributan yang
menyebabkankegelisahan.Kelincitidakdiberimakanselamawaktupengujian.Apabila
pengujianmenggunakantermistor,masukkankelincikedalamkotakpenyekapsedemikian
rupa sehingga kelinci tertahan dengan letak leher yang longgar sehingga dapat duduk
denganbebas.Tidaklebihdari30menitsebelumpenyuntikanlarutanuji,tentukansuhu
awal masingmasing kelinci yang merupakan dasar untuk menentukan kenaikan suhu.
Bedasuhutiapkelincitidakbolehlebihdari1 odansuhuawalsetiapkelincitidakboleh>
39,8o.
Kecuali dinyatakan lain pada masingmasing monografi, suntikan 10 ml per kg bobot
badan,melaluivenatepitelinga3ekorkelincidanpenyuntikandelakukandalamwaktu10
menit.Larutanujiberupasediaanyangbilaperludikonstitusisepertiyangterterapada
etiket maupun bahan uji yang diperlakukan seperti yang tertera pada masingmasing
monografidandisuntikandengandosissepertiyangtertera.Untukujipirogenalatatau
perangkatinjeksi,gunakansebagailarutanhasilcucianataubilasandaripermukaanalat
yangberhubunganlangsungdengansediaanparenteral,tempatpenyuntikanataujaringan
tubuhpasien.Semualarutanharusbebasdarikantaminasi.Hangatkanlarutanpadasuhu
372sebelumpenyuntikan.Rekamsuhuberturutturutantarajamke1danke3setelah
penyuntikandenganselangwaktu30menit.
PenafsiranhasilSetiappenurunansuhudianggapnol.Sediaanmemenuhisyaratapabilatak
seekorkelincipunmenunjukankenaikansuhu0,5ataulebihlanjutkanpengujiandengan
mengunakan5ekorkelinci.Jikatidaklebihdari3ekordari8ekorkelincimasingmasing
menunjukankenaikansuhu0,5ataulebihdanjumlahkenaikansuhumaksimum8ekor
kelincidantidak>3,3sediaandinyatakanmemenuhisyaratbebaspirogen.
5.PenetapanPotensiAntibiotika(untukzataktifantibiotik)(FIIV<131>,hlm.891899)
Tujuan: untukmengetahuiaktivitas(potensi)antibiotik Metode :lempengsilinderatau
atau "lempeng" dan "tabung" atau turbidimetri. Prinsip: Metode lempeng silinder
berdasarkan difusi antibiotik dari silinder yang dipasang tegak lurus pada lapisan agar
padat dalam cawan Petri atau lempeng, sehingga mikroba yang ditambahkan dihambat
pertumbuhannya pada daerah berupa lingkaran atau "zona" di sekeliling silinder yang
berisi larutan antibiotik. Metode turbidimetri berdasarkan atas hambatan pertumbuhan
biakan mikroba dalam larutan serba sama antibiotik, dalam media cair yang dapat
menumbuhkanmikrobadengancepatbilatidakterdapatantibiotik.
6.UjiEndotoksinBakteri(FIIV<201>,hlm.905907)
Tujuan:untukmemperkirakankadarendotoksinbakteriyangmungkinadadidalamatau
padabahanuji.
Prinsip:pengujiandilakukanmenggunakan"LimulusAmebocyteLysate"(LAL),deteksi
dilakukan dengan metode turbidimetri atau kolorimetri, penetapan titik akhir reaksi
dilakukan dengan membandingkan langsung enceran dari zat uji dengan enceran
endotoksin baku, dan jumlah endotoksin dinyatakan dalam unit Endotoksin (UE).
16

TEORI SEDIAAN APOTEKER ITB ~ OKTOBER 2007/2008 STERIL

Sebelumnyadilakukanpersiapan:

ujikonfirmasikepekaanpereaksiLAL

ujipenghambatanataupemacuan

pengenceranmaksimumyangabsah(PMA)
(untukbentuksediaanyangdirekonsitusiatausediaanyangdiencerkan)Penafsiran
hasil:darimasingmasingzataktifX

16