You are on page 1of 276

NokiaNetworks

LTE Radio Access, Rel. FDDLTE 15A, Operating


Documentation, Issue 02,
Documentation Change
Delivery 2
LTE RL40, Feature
Descriptions and Instructions
DN09185979
Issue 01J
Approval Date 2015-12-16

LTERL40,FeatureDescriptionsandInstructions

The information in this document applies solely to the hardware/software product (Product) specified
herein,andonlyasspecifiedherein.
ThisdocumentisintendedforusebyNokiaSolutionsandNetworks'customers(You)only,anditmaynot
beusedexceptforthepurposesdefinedintheagreementbetweenYouandNokiaSolutionsandNetworks
(Agreement) under which this document is distributed. No part of this document may be used, copied,
reproduced, modified or transmitted in any form or means without the prior written permission of Nokia
Solutions and Networks. If you have not entered into an Agreement applicable to the Product, or if that
Agreementhasexpiredorhasbeenterminated,YoumaynotusethisdocumentinanymannerandYou
areobligedtoreturnittoNokiaSolutionsandNetworksanddestroyordeleteanycopiesthereof.
The document has been prepared to be used by professional and properly trained personnel, and You
assumefullresponsibilitywhenusingit.NokiaSolutionsandNetworkswelcomeYourcommentsaspartof
theprocessofcontinuousdevelopmentandimprovementofthedocumentation.
This document and its contents are provided as a convenience to You. Any information or statements
concerningthesuitability,capacity,fitnessforpurposeorperformanceoftheProductaregivensolelyon
anasisandasavailablebasisinthisdocument,andNokiaSolutionsandNetworksreservestheright
tochangeanysuchinformationandstatementswithoutnotice.NokiaSolutionsandNetworkshasmadeall
reasonableeffortstoensurethatthecontentofthisdocumentisadequateandfreeofmaterialerrorsand
omissions, and Nokia Solutions and Networks will correct errors that You identify in this document. But,
NokiaSolutionsandNetworks'totalliabilityforanyerrorsinthedocumentisstrictlylimitedtothecorrection
ofsucherror(s).NokiaSolutionsandNetworksdoesnotwarrantthattheuseofthesoftwareintheProduct
willbeuninterruptedorerror-free.
NO WARRANTY OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO
ANY WARRANTY OF AVAILABILITY, ACCURACY, RELIABILITY, TITLE, NON-INFRINGEMENT,
MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE, IS MADE IN RELATION TO THE
CONTENT OF THIS DOCUMENT. IN NO EVENT WILL NOKIA SOLUTIONS AND NETWORKS BE
LIABLE FOR ANY DAMAGES, INCLUDING BUT NOT LIMITED TO SPECIAL, DIRECT, INDIRECT,
INCIDENTAL OR CONSEQUENTIAL OR ANY LOSSES, SUCH AS BUT NOT LIMITED TO LOSS OF
PROFIT, REVENUE, BUSINESS INTERRUPTION, BUSINESS OPPORTUNITY OR DATA THAT MAY
ARISEFROMTHEUSEOFTHISDOCUMENTORTHEINFORMATIONINIT,EVENINTHECASEOF
ERRORSINOROMISSIONSFROMTHISDOCUMENTORITSCONTENT.
ThisdocumentisNokiaSolutionsandNetworksproprietaryandconfidentialinformation,whichmaynotbe
distributed or disclosed to any third parties without the prior written consent of Nokia Solutions and
Networks.
Nokia is a registered trademark of Nokia Corporation. Other product names mentioned in this document
maybetrademarksoftheirrespectiveowners,andtheyarementionedforidentificationpurposesonly.
Copyright2016NokiaSolutionsandNetworks.Allrightsreserved.

Important Notice on Product Safety


Thisproductmaypresentsafetyrisksduetolaser,electricity,heat,andothersourcesofdanger.
Only trained and qualified personnel may install, operate, maintain or otherwise handle this
productandonlyafterhavingcarefullyreadthesafetyinformationapplicabletothisproduct.
The safety information is provided in the Safety Information section in the Legal, Safety and
EnvironmentalInformationpartofthisdocumentordocumentationset.

Nokia Solutions and Networks is continually striving to reduce the adverse environmental effects of its
productsandservices.Wewouldliketoencourageyouasourcustomersanduserstojoinusinworking
towardsacleaner,saferenvironment.Pleaserecycleproductpackagingandfollowtherecommendations
forpoweruseandproperdisposalofourproductsandtheircomponents.
IfyoushouldhavequestionsregardingourEnvironmentalPolicyoranyoftheenvironmentalserviceswe
offer,pleasecontactusatNokiaSolutionsandNetworksforanyadditionalinformation.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table of Contents
Thisdocumenthas276pages

Summaryofchanges................................................................... 20

RL40Features-notsupportedbyFlexiZoneMicro....................21

2
2
2.1

2.7
2.8
2.9
2.10
2.11
2.12
2.13
2.14
2.15
2.16

ActivatingLTERL40Features......................................................22
Summaryofchanges................................................................... 22
ActivatinganddeactivatingLTEfeaturesusingBTSSiteManager.
22
LTE46:ChannelAwareScheduler(UL)....................................... 23
LTE48:SupportofHighSpeedUsers.......................................... 25
ActivatingLTE48:SupportofHighSpeedUsers..........................25
Steps............................................................................................ 26
DeactivatingLTE48:SupportofHighSpeedUsers..................... 27
Steps............................................................................................ 27
LTE494:CommercialMobileAlertSystem...................................27
LTE495:OTDOA.......................................................................... 29
LTE496:SupportofQCI2,3and4;LTE497:SmartAdmission
Control;LTE534:ARPBasedAdmissionControl.........................31
LTE519:E-RABModification........................................................33
LTE587:MultipleGBREPSBearersperUE................................34
LTE612:SynchronizationHubusingBTSSiteManager..............36
LTE736:CSFallbacktoUTRAN.................................................. 39
LTE843:ETWSbroadcast............................................................40
LTE872:SRVCCtoWCDMA....................................................... 42
LTE873:SRVCCtoGSM............................................................. 45
LTE979:IRCfor2RXpaths.........................................................48
LTE984:GSMredirectwithsysteminformation........................... 49
LTE1387:IntraeNodeBinter-frequencyLB................................. 52

Descriptionsofradioresourcemanagementandtelecomfeatures.
54
LTE46:ChannelAwareScheduler(UL)....................................... 54
Benefits........................................................................................ 54
Requirements...............................................................................54
Functionaldescription.................................................................. 54
Systemimpact..............................................................................55
Managementdata........................................................................ 56
Salesinformation......................................................................... 57
DescriptionofLTE48:Supportofhighspeedusers..................... 57
Benefits........................................................................................ 57
Requirements...............................................................................57
Functionaldescription.................................................................. 58
Systemimpact..............................................................................59

2.2
2.3
2.3.1
2.3.1.1
2.3.2
2.3.2.1
2.4
2.5
2.6

3.1
3.1.1
3.1.2
3.1.3
3.1.4
3.1.5
3.1.6
3.2
3.2.1
3.2.2
3.2.3
3.2.4

Issue:01J

DN09185979

LTERL40,FeatureDescriptionsandInstructions

3.2.5
3.2.6
3.3
3.3.1
3.3.2
3.3.3
3.3.4
3.3.5
3.3.6
3.3.7
3.4
3.4.1
3.4.2
3.4.3
3.4.4
3.4.5
3.4.6
3.5
3.5.1
3.5.2
3.5.3
3.5.4
3.5.5
3.5.6
3.6
3.6.1
3.6.2
3.6.3
3.6.4
3.6.5
3.6.6
3.7
3.7.1
3.7.2
3.7.3
3.7.4
3.7.5
3.7.6
3.8
3.8.1
3.8.2
3.8.3
3.8.4
3.8.5
3.8.6
3.9

Managementdata........................................................................ 60
Salesinformation......................................................................... 60
LTE440:S1OverloadHandling....................................................60
Benefits........................................................................................ 61
Requirements...............................................................................61
Functionaldescription.................................................................. 61
Systemimpact..............................................................................64
Managementdata........................................................................ 65
Salesinformation......................................................................... 65
Configuration................................................................................65
LTE494:CommercialMobileAlertSystem...................................66
Benefits........................................................................................ 66
Requirements...............................................................................66
Functionaldescription.................................................................. 66
Systemimpact..............................................................................67
Managementdata........................................................................ 68
Salesinformation......................................................................... 69
LTE495:OTDOA.......................................................................... 69
Benefits........................................................................................ 69
Requirements...............................................................................69
Functionaldescription.................................................................. 70
Systemimpact..............................................................................71
Managementdata........................................................................ 72
Salesinformation......................................................................... 73
LTE496:SupportofQCI2,3and4.............................................. 73
Benefits........................................................................................ 75
Requirements...............................................................................76
Functionaldescription.................................................................. 76
Systemimpact..............................................................................79
Managementdata........................................................................ 80
Salesinformation......................................................................... 84
LTE497:SmartadmissionControl................................................84
Benefits........................................................................................ 86
Requirements...............................................................................86
Functionaldescription.................................................................. 86
Systemimpact..............................................................................88
Managementdata........................................................................ 89
Salesinformation......................................................................... 89
LTE519:eRABModification......................................................... 90
Benefits........................................................................................ 90
Requirements...............................................................................90
Functionaldescription.................................................................. 91
Systemimpact..............................................................................93
Managementdata........................................................................ 94
Salesinformation......................................................................... 94
LTE534:ARPbasedadmissioncontrolforE-RABs.....................94

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

3.9.1
3.9.2
3.9.3
3.9.4
3.9.5
3.9.6
3.10
3.10.1
3.10.1.1
3.10.1.2
3.10.1.3
3.10.1.4
3.10.1.5
3.10.1.6
3.10.2
3.10.3
3.11
3.11.1
3.11.2
3.11.3
3.11.3.1
3.11.3.2
3.11.3.3
3.11.3.4
3.11.3.5
3.11.3.5.1
3.11.3.5.2
3.11.4
3.11.5
3.11.6
3.12
3.12.1
3.12.2
3.12.3
3.12.3.1
3.12.4
3.12.5
3.12.6
3.13
3.13.1
3.13.2
3.13.3
3.13.4
3.13.5
3.13.6

Issue:01J

Benefits........................................................................................ 94
Requirements...............................................................................95
Functionaldescription.................................................................. 95
Systemimpact..............................................................................96
Managementdata........................................................................ 97
Salesinformation......................................................................... 98
LTE587:MultipleGBREPSBearersperUE................................98
DescriptionofLTE587:MultipleGBREPSBearersperUE.........98
Benefits........................................................................................ 99
Requirements...............................................................................99
Functionaldescription.................................................................. 99
Systemimpact............................................................................101
Managementdata...................................................................... 102
Salesinformation....................................................................... 102
ActivatingLTE587:MultipleGBREPSBearersperUE............. 103
DeactivatingLTE587:MultipleGBREPSBearersperUE......... 104
DescriptionofLTE736:CSFallbacktoUTRAN......................... 105
Benefits...................................................................................... 105
Requirements.............................................................................105
Functionaldescription................................................................ 106
CSFBtoUTRAN........................................................................ 106
CS-FallbackModeandTargetselection.................................... 106
NewManagedObjectClass(MOC)...........................................107
LicensingofCSFBtoUTRAN.................................................... 107
Userscenarios........................................................................... 107
Activation/DeactivationCSfallbacktoUTRAN.......................... 107
CSFBwithaUEinRRCIDLE(MobileoriginatedandMobile
terminated)................................................................................. 107
Systemimpact............................................................................108
Managementdata...................................................................... 109
Salesinformation........................................................................ 111
DescriptionofLTE843:ETWSbroadcast................................... 112
Benefits.......................................................................................112
Requirements............................................................................. 112
Functionaldescription.................................................................112
Relatedparameters.................................................................... 114
Systemimpact............................................................................ 114
LTE843:ETWSbroadcastmanagementdata............................ 115
Salesinformation........................................................................116
LTE872:SRVCCtoWCDMA......................................................116
Benefits.......................................................................................116
Requirements............................................................................. 116
Functionaldescription.................................................................117
Systemimpact............................................................................ 118
Managementdata...................................................................... 120
Salesinformation....................................................................... 121

DN09185979

LTERL40,FeatureDescriptionsandInstructions

3.14
3.14.1
3.14.2
3.14.3
3.14.4
3.14.5
3.14.6
3.15
3.15.1
3.15.2
3.15.3
3.15.3.1
3.15.3.2
3.15.3.3
3.15.3.3.1
3.15.3.3.2
3.15.4
3.15.5
3.15.6
3.16
3.16.1
3.16.2
3.16.3
3.16.4
3.16.5
3.16.6
3.17
3.17.1
3.17.2
3.17.3
3.17.4
3.17.5
3.17.6
3.18
3.18.1
3.18.2
3.18.3
3.18.3.1
3.18.4
3.18.5
3.18.6
3.19
3.19.1

LTE873:SRVCCtoGSM........................................................... 122
Benefits...................................................................................... 122
Requirements.............................................................................122
Functionaldescription................................................................ 122
Systemimpact............................................................................126
Managementdata...................................................................... 128
Salesinformation....................................................................... 130
DescriptionofLTE984:GSMRedirectwithSystemInformation......
130
Benefits...................................................................................... 130
Requirements.............................................................................130
Functionaldescription................................................................ 131
CSFBtoGSMwithsysteminformation......................................131
LicensingofCSFBtoGSMwithsysteminformation..................132
Userscenarios........................................................................... 132
ActivationandconfigurationCSFallbackwithredirectiontoGSM
withsysteminformation..............................................................132
PerformingCSFallbackwithredirectiontoGSMwithsystem
information................................................................................. 133
Systemimpact............................................................................133
Managementdata...................................................................... 134
Salesinformation....................................................................... 136
LTE979:IRCfor2RXpaths.......................................................136
Benefits...................................................................................... 136
Requirements.............................................................................137
Functionaldescription................................................................ 137
Systemimpact............................................................................139
Managementdata...................................................................... 140
Salesinformation....................................................................... 140
LTE1014:X2eNBConfigurationUpdate.................................. 140
Benefits...................................................................................... 141
Requirements.............................................................................141
Functionaldescription................................................................ 142
Systemimpact............................................................................143
Managementdata...................................................................... 144
Salesinformation....................................................................... 144
LTE1073:MeasurementbasedredirecttoUTRAN...................144
Benefits...................................................................................... 145
Requirements.............................................................................145
Functionaldescription................................................................ 145
Usecase.................................................................................... 146
Systemimpact............................................................................147
Managementdata...................................................................... 147
Salesinformation....................................................................... 148
LTE1387:IntraeNodeBinter-frequencyloadbalancing............ 148
Benefits...................................................................................... 148

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

3.19.2
3.19.3
3.19.4
3.19.5
3.19.6

Requirements.............................................................................149
Functionaldescription................................................................ 149
Systemimpact............................................................................152
Managementdata...................................................................... 152
Salesinformation....................................................................... 154

4
4.1
4.1.1
4.1.2
4.1.3
4.1.4
4.1.5
4.1.6
4.1.7
4.2
4.2.1
4.2.1.1
4.2.1.2
4.2.1.3
4.2.1.4
4.2.1.5
4.2.1.6

Descriptionsoftransportandtransmissionfeatures.................. 155
LTE612:SynchronizationHub....................................................155
Benefits...................................................................................... 155
Requirements.............................................................................155
Functionaldescription................................................................ 156
Systemimpact............................................................................157
Managementdata...................................................................... 157
Salesinformation....................................................................... 158
Abbreviations............................................................................. 158
LTE628:FTIFTransportPDH/Ethernet....................................159
DescriptionofLTE628:FTIFTransportPDH/Ethernet..............159
Benefits...................................................................................... 159
Requirements.............................................................................159
Functionaldescription................................................................ 159
Systemimpacts..........................................................................161
LTE628:FTIFTransportPDH/Ethernetmanagementdata........161
Salesinformation....................................................................... 162

5
5.1
5.1.1
5.1.2
5.1.3
5.1.4
5.1.5
5.1.6
5.2
5.2.1
5.2.2
5.2.3
5.2.4
5.2.5
5.2.6
5.3
5.3.1
5.3.2
5.3.3
5.3.4
5.3.5

Descriptionsofoperabilityfeatures............................................ 163
LTE162:CellTracewithIMSI.....................................................163
Benefit........................................................................................ 163
Requirements.............................................................................163
Functionaldescription................................................................ 163
Systemimpact............................................................................164
LTE162:CellTracewithIMSImanagementdata.......................164
Salesinformation....................................................................... 165
LTE524:CertificateManagementforiOMS...............................165
Benefits...................................................................................... 165
Requirements.............................................................................165
Functionaldescription................................................................ 166
Systemimpact............................................................................168
CertificateManagementforiOMSmanagementdata................169
Salesinformation....................................................................... 170
LTE593:SecurityforEthernetPortsonFCT/FSM3.................. 170
Benefits...................................................................................... 170
Requirements.............................................................................171
Functionaldescription................................................................ 171
Systemimpact............................................................................172
LTE593:SecurityforEthernetPortsonFCT/FSM3management
data............................................................................................ 172
Salesinformation....................................................................... 173

5.3.6

Issue:01J

DN09185979

LTERL40,FeatureDescriptionsandInstructions

5.4
5.4.1
5.4.2
5.4.3
5.4.4
5.4.5
5.4.6
5.5
5.5.1
5.5.2
5.5.3
5.5.4
5.5.5
5.5.6
5.6
5.6.1
5.6.2
5.6.3
5.6.3.1
5.6.4
5.6.5
5.6.6
5.7
5.7.1
5.7.1.1
5.7.1.2
5.7.1.3
5.7.1.3.1
5.7.1.3.2
5.7.1.3.3
5.7.1.3.4
5.7.1.3.5
5.7.1.3.6
5.7.1.3.7
5.7.1.3.8
5.7.1.4
5.7.1.5
5.7.1.6
5.7.1.7
5.8
5.8.1
5.8.2

LTE622:LocalLinkLayerSecurity.............................................173
Benefits...................................................................................... 173
Requirements.............................................................................173
Functionaldescription................................................................ 174
Systemimpact............................................................................175
LTE622:LocalLinkLayerSecuritymanagementdata...............176
Salesinformation....................................................................... 176
LTE623:CryptoAgent................................................................ 176
Benefits...................................................................................... 176
Requirements.............................................................................177
Functionaldescription................................................................ 177
Systemimpact............................................................................178
LTE623:CryptoAgentmanagementdata.................................. 179
Salesinformation....................................................................... 179
LTE646:SWMonitoringExtensionwithPMCounters............... 179
Benefits...................................................................................... 180
Requirements.............................................................................180
Functionaldescription................................................................ 180
Functionaloverview................................................................... 180
Systemimpact............................................................................181
LTE646:SWMonitoringExtensionwithPMCounters
managementdata...................................................................... 181
Salesinformation....................................................................... 181
................................................................................................... 182
LTE771:OptimizationofIntra-LTENeighborRelations..............182
Benefits...................................................................................... 182
Requirements.............................................................................182
Functionaldescription................................................................ 183
RANsystemlevelscope............................................................ 184
UsecaseANRoptimization....................................................... 185
UsecasescheduledworkflowforLTE771:OptimizationofIntraLTENeighborRelations............................................................. 186
UsecasemanualtriggeredworkflowforLTE771:Optimizationof
Intra-LTENeighborRelations..................................................... 187
UseCasefortheoperatortomanuallycleartheblacklist..........187
SONmodus................................................................................188
Reporting....................................................................................188
OperatorinteractionoutsideofLTE771:OptimizationofIntra-LTE
NeighborRelations.....................................................................189
Systemimpact............................................................................189
LTE771:Optimizationofneighborrelationsmanagementdata.. 191
Salesinformation....................................................................... 192
Abbreviations............................................................................. 192
LTE877:AdjustablePerformanceUpload.................................. 193
Benefits...................................................................................... 193
Requirements.............................................................................193

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

5.8.3
5.8.4
5.8.5
5.8.6
5.9
5.9.1
5.9.2
5.9.3
5.9.4
5.9.5
5.9.6
5.10
5.10.1
5.10.2
5.10.3
5.10.4
5.10.5
5.10.6
5.11
5.11.1
5.11.1.1
5.11.1.2
5.11.1.3
5.11.1.3.1
5.11.1.3.2
5.11.1.3.3
5.11.1.4
5.11.1.5
5.11.1.6
5.12
5.12.1
5.12.1.1
5.12.1.2
5.12.1.3
5.12.1.3.1
5.12.1.3.2
5.12.1.4
5.12.1.5
5.12.1.6
5.13
5.13.1
5.13.2
5.13.3
5.13.4
5.13.5

Issue:01J

Functionaldescription................................................................ 194
Systemimpact............................................................................194
LTE877:AdjustablePerformanceUploadmanagementdata.... 195
Salesinformation....................................................................... 195
LTE940:SWVerificationAgent.................................................. 195
Benefits...................................................................................... 195
Requirements.............................................................................196
Functionaldescription................................................................ 196
Systemimpact............................................................................197
LTE940:SWVerificationAgentmanagementdata.................... 197
Salesinformation....................................................................... 198
LTE953:MDT(MinimizationofDriveTest).................................198
Benefits...................................................................................... 198
Requirements.............................................................................199
Functionaldescription................................................................ 199
Systemimpact............................................................................200
LTE953:MDT(MinimizationofDriveTest)managementdata...201
Salesinformation....................................................................... 202
LTE1019:SONReports..............................................................202
DescriptionofLTE1019:SONReports.......................................202
Benefits...................................................................................... 202
Requirements.............................................................................202
Functionaldescription................................................................ 203
Changeoriginreport.................................................................. 203
SONreportingmechanism.........................................................204
SONreportingcontent............................................................... 205
Systemimpact............................................................................208
Managementdata...................................................................... 209
Salesinformation....................................................................... 209
LTE1045:FullSONsupportfordistributedsites....................... 210
DescriptionofLTE1045:FullSONSupportforDistributedSites.....
210
Benefits...................................................................................... 210
Requirements.............................................................................210
Functionaldescription.................................................................211
NetActOptimizer........................................................................ 212
NetActusecase......................................................................... 214
Systemimpact............................................................................214
Managementdata...................................................................... 216
Salesinformation....................................................................... 217
LTE1078:SystemUpgradewithBackwardCompatibility.......... 217
Benefits...................................................................................... 217
Requirements.............................................................................217
Functionaldescription................................................................ 218
Systemimpact............................................................................220
Managementdata...................................................................... 220

DN09185979

LTERL40,FeatureDescriptionsandInstructions

5.13.6
5.14
5.14.1
5.14.2
5.14.3
5.14.4
5.14.5
5.14.6
5.15
5.15.1
5.15.1.1
5.15.1.2
5.15.1.3
5.15.1.3.1
5.15.1.3.2
5.15.1.3.3
5.15.1.3.4
5.15.1.3.5
5.15.1.4
5.15.1.5
5.15.1.6
5.16
5.16.1
5.16.2
5.16.3
5.16.4
5.16.5

5.17.6

Salesinformation....................................................................... 221
DescriptionofLTE1201:LTEiOMSHW,HPBladeGen8..........221
Benefits...................................................................................... 221
Requirements.............................................................................221
Functionaldescription................................................................ 221
Systemimpact............................................................................222
LTE1201:LTEiOMSHW,HPBladeGen8managementdata...222
Salesinformation....................................................................... 222
LTE1222:Inter-RATAutoSetupandScheduledOptimization..223
LTE1222:SONAutomationModes............................................ 223
Benefits...................................................................................... 223
Requirements.............................................................................223
Functionaldescription................................................................ 224
LTE533:MobilityRobustness....................................................224
LTE783:ANRforInterRATUTRAN...........................................225
LTE784:ANRforInterRATGERAN.......................................... 226
LTE510:SynchronizationofInter-RATneighbors...................... 228
LTE771:OptimizationofIntra-LTEneighborrelations................230
Systemimpact...........................................................................231
Managementdata...................................................................... 232
Salesinformation....................................................................... 232
LTE1340:Trace-basedRealTimeMonitoring............................232
Benefits...................................................................................... 232
Requirements.............................................................................233
Functionaldescription................................................................ 233
Systemimpact............................................................................234
LTE1340:Trace-basedRealTimeMonitoringmanagementdata....
235
Salesinformation....................................................................... 235
DescriptionofLTE1457:CelltraceConfigurationviaConfiguration
Management............................................................................. 235
Benefits...................................................................................... 236
Requirements.............................................................................236
Functionaldescription................................................................ 236
Systemimpact............................................................................237
LTE1457:CelltraceConfigurationviaConfigurationManagement
managementdata...................................................................... 237
Salesinformation....................................................................... 238

6
6.1
6.1.1
6.1.2
6.1.3
6.1.4
6.1.5

DescriptionsofBTSsitesolutionfeatures................................. 239
LTE179:DualBandwithOneSystemModule.......................... 239
Benefits...................................................................................... 239
Requirements.............................................................................239
Functionaldescription................................................................ 239
Systemimpact............................................................................243
LTE179:DualBandwithOneSystemModulemanagementdata...
244

5.16.6
5.17
5.17.1
5.17.2
5.17.3
5.17.4
5.17.5

10

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

6.1.6
6.2
6.2.1
6.2.2
6.2.3
6.2.4
6.2.5
6.2.6
6.3
6.3.1
6.3.2
6.3.3
6.3.4
6.3.5
6.4
6.4.1
6.4.2
6.4.3
6.4.4
6.4.5
6.4.6
6.5
6.5.1
6.5.2
6.5.3
6.5.4
6.5.5
6.5.6
6.6
6.6.1
6.6.2
6.6.3
6.6.4
6.6.5
6.6.6
6.7
6.7.1
6.7.2
6.7.3
6.7.4
6.7.5
6.8
6.8.1

Issue:01J

Salesinformation....................................................................... 245
LTE621:MultiradioSystemModulebasicLTEconfigurations... 245
Benefits...................................................................................... 245
Requirements.............................................................................245
Functionaldescription................................................................ 245
Systemimpacts..........................................................................246
LTE621:Flexi10BTSBasicConfigurationsmanagementdata. 246
Salesinformation....................................................................... 246
LTE763:FXFAFlexi3-sectorRFModule1900..........................247
Benefits...................................................................................... 247
Requirements.............................................................................247
Functionaldescription................................................................ 248
Systemimpacts..........................................................................251
Salesinformation....................................................................... 251
LTE947:FSMFFlexiMultiradio10SystemModule................... 251
Benefits...................................................................................... 252
Requirements.............................................................................252
Functionaldescription................................................................ 252
Systemimpacts..........................................................................255
LTE947:FlexiMultimodeSystemModuleFSMFmanagementdata
................................................................................................... 255
Salesinformation....................................................................... 255
LTE949:FPFDFlexiPowerDistributionSub-module................ 255
Benefits...................................................................................... 256
Requirements.............................................................................256
Functionaldescription................................................................ 256
Systemimpacts..........................................................................257
LTE949:Flexipowerdistributionsub-moduleFPFDmanagement
data............................................................................................ 258
Salesinformation....................................................................... 258
LTE950:FPFCFlexiPowerDistributionModule........................ 258
Benefits...................................................................................... 258
Requirements.............................................................................258
Functionaldescription................................................................ 259
Systemimpacts..........................................................................260
LTE950:FlexipowerdistributionmoduleFPFCmanagementdata.
261
Salesinformation....................................................................... 261
LTE1040:FXEBFlexi3-sectorRFModule1800....................... 261
Benefits...................................................................................... 262
Requirements.............................................................................262
Functionaldescription................................................................ 262
Systemimpacts..........................................................................263
Salesinformation....................................................................... 263
LTE1125:GNSSReceiverFYGB............................................... 264
Benefits...................................................................................... 264

DN09185979

11

LTERL40,FeatureDescriptionsandInstructions

6.8.2
6.8.3
6.8.4
6.8.5
6.8.6
6.9
6.9.1
6.9.2
6.9.3
6.9.4
6.9.5
6.9.6
6.10
6.10.1
6.10.2
6.10.3
6.10.4
6.10.5
6.11
6.11.1
6.11.2
6.11.3
6.11.4
6.11.5
6.11.6
6.12
6.12.1
6.12.2
6.12.3
6.12.4
6.12.5
6.12.6
6.13
6.13.1
6.13.2
6.13.3
6.13.4
6.13.5
6.13.6

12

Requirements.............................................................................264
Functionaldescription................................................................ 264
Systemimpact............................................................................265
LTE1125:GNSSReceiverFYGBmanagementdata................. 265
Salesinformation....................................................................... 266
LTE1148:FRIGFlexiRRH4TX1.7/2.1......................................266
Benefits...................................................................................... 267
Requirements.............................................................................267
Functionaldescription................................................................ 267
LTE1148:FRIGFlexiRRH4TX1.7/2.1managementdata........268
Systemimpacts..........................................................................268
Salesinformation....................................................................... 268
LTE1261:FHDBFlexiRRH2TX900......................................... 268
Benefits...................................................................................... 269
Requirements.............................................................................269
Functionaldescription................................................................ 269
Systemimpacts..........................................................................270
Salesinformation....................................................................... 270
LTE1263:FRGVFlexiRRH2TX2100....................................... 270
Benefits...................................................................................... 270
Requirements.............................................................................270
Functionaldescription................................................................ 271
Systemimpacts..........................................................................271
LTE1263:FRGVFlexiRRH2TX2100managementdata......... 272
Salesinformation....................................................................... 272
LTE1306:FRMDFlexi3-sectorRFModule800........................ 272
Benefits...................................................................................... 272
Requirements.............................................................................273
Functionaldescription................................................................ 273
Systemimpacts..........................................................................273
1306:FRMDFlexi3-sectorRFModule800managementdata.274
Salesinformation....................................................................... 274
DescriptionofLTE1514:AdditionalRFsharingConfigurations
LTE-GSM....................................................................................274
Benefits...................................................................................... 274
Requirements.............................................................................275
Functionaldescription................................................................ 275
Systemimpact............................................................................275
Managementdata...................................................................... 276
Salesinformation....................................................................... 276

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

List of Figures

Issue:01J

Figure1

RejectionofRRCConnectionRequestmessage(noMMEidentifier
provided)becauseMMEoverload......................................................63

Figure2

AcceptanceofRRCConnectionRequest(noMMEidentifier
provided)withoneMMEinoverloadstate......................................... 63

Figure3

RejectionofRRCConnectionRequestmessage(MMEidentifier
provided)becauseofMMEoverload..................................................64

Figure4

AcceptanceofRRCConnectionRequest(MMEidentifierprovided)
withMMEinoverloadstate................................................................ 64

Figure5

OTDOAoverview................................................................................70

Figure6

Interactionofdifferentfunctionblocks................................................ 87

Figure7

MSC:E-RABModifyRequest.............................................................91

Figure8

TheETWSoverview......................................................................... 114

Figure9

MessageflowduringSRVCChandover........................................... 123

Figure10

SRVCChandoverscenario.............................................................. 126

Figure11

BLER(SINR)forSDI,EPA30........................................................... 138

Figure12

BLER(SINR)forSDI,ETU70...........................................................139

Figure13

Overviewofinterfaces...................................................................... 141

Figure14

X2eNBConfigurationUpdate-successfulprocedure..................... 142

Figure15

X2eNBConfigurationUpdate-failedprocedure............................. 143

Figure16

FTIFTransportsub-modulefrontpanelview-physicallayerview...160

Figure17

FTIFinterfaces-logicallayerview.................................................. 160

Figure18

Signalingflowofinitialoperatorcertificateenrollment......................167

Figure19

Inter-secureenvironmentcommunication........................................ 175

Figure20

SecurestoragesupportbyCryptoAgent......................................... 178

Figure21

LTE771:OptimizationofIntra-LTENeighborRelations.................... 184

Figure22

NetAct-originatedparameterchange................................................205

Figure23

Topdownupgradeapproach............................................................ 218

Figure24

Trace-basedrealtimemonitoringarchitecture................................. 234

Figure25

Managedobjectsstructure............................................................... 237

Figure26

DualBandconfigurationwithfourRFModules................................ 240

Figure27

DualBandconfigurationwithsixRRHs,fromwhichthreearechained.
241

Figure28

DualBandconfigurationwithsixRRHs,fromwhichtwoarechained....
242

Figure29

DualBandconfigurationwithfourRRHs,fromwhichtwoarechained..
243

Figure30

IsometricviewofFXFARFModule.................................................. 247

Figure31

FXFAfrontpanelconnectorsandlabels...........................................248

Figure32

FrontpaneloftheSystemModule(FSMF)withoptionalsub-modules
FPFD,FTIF,andtwoFBBAs............................................................ 254

Figure33

FPFDsub-module............................................................................ 257

DN09185979

13

LTERL40,FeatureDescriptionsandInstructions

14

Figure34

FPFCmodule................................................................................... 260

Figure35

FXEBfrontpanelconnectorsandlabels.......................................... 263

Figure36

FlexiBTSSynchronizationwithGNSS.............................................265

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

List of Tables

Issue:01J

Table1

RL40Features-notsupportedbyFlexiZoneMicro.......................... 21

Table2

ParametersusedforactivatingandconfiguringLTE48:Supportof
highspeedusers................................................................................ 26

Table3

Softwarerequirements....................................................................... 54

Table4

Newparameters................................................................................. 56

Table5

Modifiedparameters...........................................................................56

Table6

Relatedexistingparameters...............................................................57

Table7

Salesinformation................................................................................57

Table8

Softwarerequirements....................................................................... 58

Table9

Maximumsupportedvelocitiesdependingonthecarrierfrequeny... 58

Table10

Newparameters................................................................................. 60

Table11

Relatedexistingparameters...............................................................60

Table12

Salesinformation................................................................................60

Table13

Softwarerequirements....................................................................... 61

Table14

Newparameters................................................................................. 65

Table15

Salesinformation................................................................................65

Table16

Softwarerequirements....................................................................... 66

Table17

Newparameters................................................................................. 68

Table18

Relatedexistingparameters...............................................................69

Table19

Salesinformation................................................................................69

Table20

Softwarerequirements....................................................................... 69

Table21

Newparameters................................................................................. 72

Table22

Relatedexistingparameters...............................................................73

Table23

Salesinformation................................................................................73

Table24

StandardizedQCIcharacteristics....................................................... 74

Table25

Softwarerequirements....................................................................... 76

Table26

CongestionHandlingconfiguredbygbrCongHandling.......................77

Table27

ParameterulsFdPrbAssignAlg........................................................... 78

Table28

Newcounters......................................................................................80

Table29

ParametersfortheworkaroundforQCI=2,3,4................................. 82

Table30

Newparameters................................................................................. 83

Table31

Salesinformation................................................................................84

Table32

Softwarerequirements....................................................................... 86

Table33

Abbreviationsofthefigureabove....................................................... 87

Table34

Thresholdsandmargins..................................................................... 88

Table35

Newparameters................................................................................. 89

Table36

Salesinformation................................................................................89

Table37

Softwarerequirements....................................................................... 90

Table38

Newparameters................................................................................. 94

DN09185979

15

LTERL40,FeatureDescriptionsandInstructions

16

Table39

Salesinformation................................................................................94

Table40

Softwarerequirements....................................................................... 95

Table41

Newcounters......................................................................................97

Table42

Newparameters................................................................................. 97

Table43

Salesinformation................................................................................98

Table44

Allowedmaximumnumberofbearers............................................... 99

Table45

Softwarerequirements....................................................................... 99

Table46

Newparameters............................................................................... 102

Table47

Modifiedparameters.........................................................................102

Table48

Salesinformation..............................................................................102

Table49

Softwarerequirements..................................................................... 105

Table50

Newcounters....................................................................................109

Table51

Newparameters............................................................................... 110

Table52

NewparametersforthePrimaryPLMNidentityinCGIofUTRAN
neighborcelllist............................................................................... 111

Table53

Relatedexistingparameters............................................................. 111

Table54

Salesinformation.............................................................................. 111

Table55

Softwarerequirements......................................................................112

Table56

Softwarerequirements......................................................................112

Table57

Newcounters.................................................................................... 115

Table58

Newparameters............................................................................... 115

Table59

Modifiedparameters......................................................................... 116

Table60

Salesinformation.............................................................................. 116

Table61

Softwarerequirements......................................................................117

Table62

Newcounters....................................................................................120

Table63

Newparameters............................................................................... 121

Table64

Relatedexistingparameters.............................................................121

Table65

Salesinformation..............................................................................121

Table66

Softwarerequirements..................................................................... 122

Table67

Newcounters....................................................................................128

Table68

Newparameters............................................................................... 128

Table69

Relatedexistingparameters.............................................................129

Table70

Salesinformation..............................................................................130

Table71

Softwarerequirements..................................................................... 131

Table72

Newparameters............................................................................... 134

Table73

Relatedexistingparameters.............................................................135

Table74

Salesinformation..............................................................................136

Table75

Softwarerequirements..................................................................... 137

Table76

Salesinformation..............................................................................140

Table77

Softwarerequirements..................................................................... 142

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Issue:01J

Table78

Salesinformation..............................................................................144

Table79

Softwarerequirements..................................................................... 145

Table80

Newparameters............................................................................... 148

Table81

Salesinformation..............................................................................148

Table82

Softwarerequirements..................................................................... 149

Table83

Newparameters............................................................................... 153

Table84

Modifiedparameters.........................................................................154

Table85

Salesinformation..............................................................................154

Table86

Softwarerequirements..................................................................... 155

Table87

Recoveryofsynchronizationoutputclock........................................ 156

Table88

Newparameters............................................................................... 158

Table89

Modifiedparameters.........................................................................158

Table90

Salesinformation..............................................................................158

Table91

Softwarerequirements..................................................................... 159

Table92

Salesinformation..............................................................................162

Table93

Softwarerequirements..................................................................... 163

Table94

Salesinformation..............................................................................165

Table95

Softwarerequirements..................................................................... 166

Table96

Relatedexistingalarms.................................................................... 169

Table97

Newparameters............................................................................... 170

Table98

Salesinformation..............................................................................170

Table99

Softwarerequirements..................................................................... 171

Table100

Relatedexistingparameters.............................................................173

Table101

Salesinformation..............................................................................173

Table102

Softwarerequirements..................................................................... 174

Table103

Relatedexistingalarms.................................................................... 176

Table104

Salesinformation..............................................................................176

Table105

Softwarerequirements..................................................................... 177

Table106

Salesinformation..............................................................................179

Table107

Softwarerequirements..................................................................... 180

Table108

Newcounters....................................................................................181

Table109

Salesinformation..............................................................................181

Table110

SoftwarerequirementsforRL40.......................................................182

Table111

Newcounters....................................................................................192

Table112

Newparameters............................................................................... 192

Table113

Salesinformation..............................................................................192

Table114

Abbreviations....................................................................................192

Table115

Softwarerequirements..................................................................... 194

Table116

Newparameters............................................................................... 195

Table117

Salesinformation..............................................................................195

DN09185979

17

LTERL40,FeatureDescriptionsandInstructions

18

Table118

Softwarerequirements..................................................................... 196

Table119

Relatedexistingalarms.................................................................... 198

Table120

Salesinformation..............................................................................198

Table121

Softwarerequirements..................................................................... 199

Table122

Newparameters............................................................................... 201

Table123

Relatedexistingparameters.............................................................201

Table124

Salesinformation..............................................................................202

Table125

Softwarerequirements..................................................................... 202

Table126

Salesinformation..............................................................................209

Table127

Softwarerequirements..................................................................... 210

Table128

Salesinformation..............................................................................217

Table129

Softwarerequirements..................................................................... 217

Table130

Relatedexistingalarms.................................................................... 220

Table131

Salesinformation..............................................................................221

Table132

Softwarerequirements..................................................................... 221

Table133

Salesinformation..............................................................................222

Table134

Softwarerequirements..................................................................... 223

Table135

Salesinformation..............................................................................232

Table136

Softwarerequirements..................................................................... 233

Table137

Relatedexistingparameters.............................................................235

Table138

Salesinformation..............................................................................235

Table139

Softwarerequirements..................................................................... 236

Table140

Salesinformation..............................................................................238

Table141

Softwarerequirements..................................................................... 239

Table142

Newparameters............................................................................... 244

Table143

Relatedexistingparameters.............................................................244

Table144

Salesinformation..............................................................................245

Table145

Softwarerequirements..................................................................... 245

Table146

Salesinformation..............................................................................246

Table147

Softwarerequirements..................................................................... 248

Table148

FXFAfrontpanelconnectors,cabletypesandinterfaces................ 249

Table149

FXFAdimensionsandweight........................................................... 250

Table150

Salesinformation..............................................................................251

Table151

Softwarerequirements..................................................................... 252

Table152

FlexiMultiradioSystemModuleFSMFpeakthroughput..................253

Table153

Salesinformation..............................................................................255

Table154

Softwarerequirements..................................................................... 256

Table155

Salesinformation..............................................................................258

Table156

Softwarerequirements..................................................................... 259

Table157

Salesinformation..............................................................................261

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Issue:01J

Table158

Softwarerequirements..................................................................... 262

Table159

Salesinformation..............................................................................263

Table160

Softwarerequirements..................................................................... 264

Table161

Relatedexistingalarms.................................................................... 266

Table162

Relatedexistingparameters.............................................................266

Table163

Salesinformation..............................................................................266

Table164

Softwarerequirements..................................................................... 267

Table165

Salesinformation..............................................................................268

Table166

Softwarerequirements..................................................................... 269

Table167

Salesinformation..............................................................................270

Table168

Softwarerequirements..................................................................... 271

Table169

Salesinformation..............................................................................272

Table170

Softwarerequirements..................................................................... 273

Table171

Salesinformation..............................................................................274

Table172

Softwarerequirements..................................................................... 275

Table173

Salesinformation..............................................................................276

DN09185979

19

Summaryofchanges

LTERL40,FeatureDescriptionsandInstructions

Summary of changes
Changes between 01I (2014-03-15, RL40) and 01J (2015-12-16, RL40)
Thefollowingfeaturedescriptionhasbeenupdated:
LTE1387:IntraeNodeBinter-frequencyloadbalancing
Changes between 01H (2014-06-25, RL40) and 01I (2015-03-15, RL40)
Thefollowingfeaturedescriptionshavebeenadded:

LTE771:OptimizationofNeighborRelations
LTE1019:SONReports
LTE1045:FullSONsupportfordistributedsites
LTE1222:SONAutomationModes

Changes between 01G (2013-07-22, RL40) and 01H (2014-06-25, RL40)


Thefollowingfeaturedescriptionshavebeenupdated:

LTE646:SWMonitoringExtensionwithPMCounters

Changes between 01F (2013-04-15, RL40) and 01G (2013-07-22, RL40)


Thefollowingfeaturedescriptionhasbeenadded:

LTE1125:GNSSReceiverFYGB

Thefollowingfeaturedescriptionhasbeenupdated:

20

LTE524:CertificateManagementforiOMS

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

RL40Features-notsupportedbyFlexiZoneMicro

1 RL40 Features - not supported by Flexi Zone


Micro
ThefollowingfeaturesarenotsupportedbyFlexiZoneMicro:
Table1

RL40Features-notsupportedbyFlexiZoneMicro
Features

Issue:01J

Category

LTE179:DualBandwithOneSystemModule

BTS

LTE612:SynchronizationHub

Operability

LTE621:Flexi10BTSBasicConfigurations

BTS

LTE622:LocalLinkLayerSecurity

Operability

LTE628:FTIFTransportPDH/Ethernet

BTS

LTE763:FXFAFlexi3-sectorRFModule1900

BTS

LTE947:FSMFFlexiMultiradio10SystemModule

BTS

LTE949:FPFDFlexiPowerDistributionSub-module

BTS

LTE950:FPFCFlexiPowerDistributionModule

BTS

LTE1040:FXEBFlexi3-sectorRFModule1800

BTS

LTE1078:SystemUpgrade

Operability

LTE1148:FRIGFlexiRRH4TX1.7/2.1

BTS

LTE1261:FHDBFlexiRRH2TX900

BTS

LTE1306:FRMDFlexi3-sectorRFModule800

BTS

LTE1514:LargeLTE-GSMRFsharingConfigurations

BTS

DN09185979

21

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

2 Activating LTE RL40 Features


Summary of changes
Changes between 01 (2012-07-31, RL40) and 01A (2012-10-30, RL40)
Thefollowingfeatureactivationinstructionhavebeenadded:

LTE534:ARPbasedadmissioncontrol
LTE872:SRVCCtoWCDMA
LTE873:SRVCCtoGSM
LTE979:IRCfor2RXpaths

2.1 Activating and deactivating LTE features using BTS


Site Manager
Purpose
FollowthisgeneralBTSSiteManager(BTSSM)proceduretoactivateordeactivateLTE
features.
Before you start
TheeNBmustalreadybecommissioned.TheBTSSiteManagercanbeconnectedto
theeNBeitherlocally,orfromaremotelocation.Forinformationonfeature-specific
prerequisites,seesectionBeforeyoustartofeveryfeature-specificprocedure.

Steps

Start the BTSSM application and establish the connection to the eNB.
Fordetails,seeLaunchingBTSSiteManagerinCommissioningFlexiMultiradioBTS
LTEortheBTSSMonlinehelp(sectionInstructions).

Upload the configuration plan file from the eNB.


WhentheBTSSMisconnectedtotheeNB,itautomaticallyuploadsthecurrent
configurationplanfilefromtheeNB.
a) SelectViewCommissioningorclickCommissioningontheViewbar.
b) TheBTS Sitecheckbox,locatedintheTargetsection,isselectedbydefault.
Thisistherecommendedsetting.
c) Choosethecommissioningtype.UsetheTemplate,Manual,or
ReconfigurationoptiondependingontheactualstateoftheeNB.
Fordetails,seeManualcommissioning,Performingtemplatecommissioning,and
PerformingreconfigurationcommissioninginCommissioningFlexiMultiradioBTS
LTE.

22

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Modify the feature-specific eNB configuration settings.


Thefeature-relatedsettingsarefoundinthesetofCommissioningpages.Inthetop
right-handcorneroftheBTSSMwindow,thereisalocationbarthatshowsatwhich
stageoftheCommissioningprocesstheuseris.Itisrecommendedthattheuser
carefullyreadsthepagescontainingfulleNBconfigurationinformation.

Send the commissioning plan file to the eNB.


Sub-steps
a) Go to the Send Parameters page.
b) In section Send, choose whether the BTSSM should send to the eNB only
the changed parameters: Only changes (may require reset), or a whole set
of parameters: All parameters (requires reset).
c) Click the Send Parameters button.

The new commissioning plan file is automatically activated in the eNB.


Sub-steps
a) After successful transmission of the parameters, the new configuration is
automatically activated.
TheBTSSMautomaticallysendsanactivationcommandafterfinishingthefile
download.

b) If the configuration changes require restart, the eNB performs the restart
now.

Note: Forinformationonpossiblerestarts,seesectionBeforeyoustartofevery
feature-specificprocedure.

2.2 LTE46: Channel Aware Scheduler (UL)


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE46:ChannelAware
Scheduler(UL)feature.

Issue:01J

DN09185979

23

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Activating LTE46: Channel Aware Scheduler (UL)


Before you start
RestartoftheeNBisrequiredafteractivationofthisfeatureonlyiftheInclude SRS
measurements In CL power control (ulpcSrsEn)parametervalueis
changed.
TheScheduling method of the UL scheduler (ulsSchedMethod)
parameterisusedtoactivatethefeature.
Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

SRS Configuration (srsConfiguration)


Power offset for SRS transmission power calculation
(srsPwrOffset)
Include SRS measurements In CL power control (ulpcSrsEn)

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) Setthe Scheduling method of the UL scheduler
(ulsSchedMethod)parametervaluetochannel aware (1).

Note: Thisstepactivatesthefeature.

Power offset for SRS transmission power


calculation(srsPwrOffset)parametermustbeconfigured.
Periodic PHR timer(tPeriodicPhr)parametermustbesettovalue
differentfrominfinity.
Include SRS measurements In CL power control (ulpcSrsEn)
parametermustbecofnfigured.
UL scheduler FD type(ulsFdPrbAssignAlg)parametermustbesetto
Mixed FD.
SRS Configuration (srsConfiguration)parametermustbe
configured.RangeoftheSRS Configuration (srsConfiguration)
parameterdependsonUplink channel bandwidth (ulChBw)
parameter.

24

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Deactivating LTE46: Channel Aware Scheduler (UL)


Before you start
RestartoftheeNBisrequiredafterdeactivationofthisfeatureonlyiftheInclude SRS
measurements In CL power control (ulpcSrsEn)parametervalueis
changed.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) Setthe Scheduling method of the UL scheduler
(ulsSchedMethod)parametervaluetochannel unaware (0)orinterference
aware (2).
If Scheduling method of the UL scheduler (ulsSchedMethod)
parametervalueisotherthatchannel aware(1), Include SRS
measurements In CL power control (ulpcSrsEn)parametermust
besettofalse.
IfInclude SRS measurements In CL power control(ulpcSrsEn)
issettofalse,Power offset for SRS transmission power
calculation (srsPwrOffset)parametermustnotbedefined.

2.3 LTE48: Support of High Speed Users


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE48:SupportofHighSpeed
Usersfeature.

2.3.1 Activating LTE48: Support of High Speed Users


Before you start

Issue:01J

DN09185979

25

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Table2

ParametersusedforactivatingandconfiguringLTE48:Supportofhigh
speedusers
Parameter

Purpose

PRACHhighspeedflag
(prachHsFlag)

2.3.1.1

activationflag

Requires eNB restart or


object locking
requiresobjectlocking

HighspeedScenario(HsScenario) mandatoryconfiguration

requiresobjectlocking

PRACHcyclicshift(prachCS)

mandatoryconfiguration

requiresobjectlocking

RACHrootsequence
(rootSeqIndex)

mandatoryconfiguration

requiresobjectlocking

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modifythefeature-specificeNBconfigurationsettings)ofthegeneral
procedure,performthestepsdescribedinthisprocedure.

Set the activation flag.


a)
b)
c)
d)

GototheRadio Network Configurationpage.


ExpandtheMRBTSobject.
ExpandtheLNBTSobject.
SelecttheLNCELobjectcorrespondingtothecellwheretheLTE48:Supportof
highspeedusersfeaturewillbeactivated.
e) SetthePRACH high speed flag(prachHsFlag)parametervaluetotrue.
f) SettheHighspeed scenario(hsScenario)parametervaluetoscenario 1
orscenario 3.

Configure the existing parameter (mandatory).


a)
b)
c)
d)

GototheRadio Network Configurationpage.


ExpandtheMRBTSobject.
ExpandtheLNBTSobject.
UndertheLNCELobjectcorrespondingtothecellwheretheLTE48:Supportof
highspeedusersfeaturewillbeactivated,setthefollowingparameters:

26

RACH root sequence(rootSeqIndex)


PRACH cyclic shift(prachCS)

Send the parameters to the eNB according to the procedure described in


section Activating and deactivating LTE features using BTS Site Manager.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

2.3.2 Deactivating LTE48: Support of High Speed Users


Before you start
Thefollowingparametersareusedfordeactivation:

thePRACH high speed flag(prachHsFlag)parameter


theHigh speed Scenario(HsScenario)parameter

Bothofthemrequireobjectlocking.

2.3.2.1

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modifythefeature-specificeNBconfigurationsettings)ofthegeneral
procedure,performthestepsdescribedinthisprocedure.

Set the deactivation flag.


a)
b)
c)
d)

GototheRadio Network Configurationpage.


ExpandtheMRBTSobject.
ExpandtheLNBTSobject.
SelecttheLNCELobjectcorrespondingtothecellwheretheLTE48:Supportof
highspeedusersfeaturewillbedeactivated.
e) SetthePRACH high speed flag(prachHsFlag)parametervalueto
false.
f) SettheHigh speed Scenario(HsScenario)parametervaluetoempty.

Send the parameters to the eNB according to the procedure described in


section Activating and deactivating LTE features using BTS Site Manager.

2.4 LTE494: Commercial Mobile Alert System


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE494:CommercialMobileAlert
Systemfeature.

Activating LTE494: Commercial Mobile Alert System


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
TheActivation CMAS support(actCMAS)parameterisusedtoactivatethe
feature.

Issue:01J

DN09185979

27

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Thefollowingparametersareusedtoperformmandatoryconfigurationofthefeature:

PWS with emergency area ID(pwsWithEmAreaId)


Emergency area ID(emAreaId)
System information scheduling list (sibSchedulingList)

ItisnotpossibletoenableLTE494:CommercialMobileAlertSystemfeatureand
LTE843:ETWSbroadcastfeaturesimultaneouslyperoneeNB.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) Setthe Activation CMAS support(actCMAS)parametervaluetotrue.

Note: Thisstepactivatesthefeature.
c) IftheLTE843:ETWSbroadcastfeatureisactivated,settheActivation
ETWS support (actETWS)parametertofalse.
d) ConfigurethePWS with emergency area ID(pwsWithEmAreaId)
parameter.
e) SelecttheLNCELobject.
f) ConfiguretheSystem information scheduling list
(sibSchedulingList)parameter.ThesibSchedulingListmustcontain
SIB12configuration(siMessageSibTypeofonesetmustbesettoSIB12).
Periodicity,RepetitionandSIB typeforSIB12mustbeconfigured.
g) Ifthe PWS with emergency area ID(pwsWithEmAreaId)parameteris
settotrue,configuretheEmergency area ID(emAreaId)parameter.

Deactivating LTE494: Commercial Mobile Alert System


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

28

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) Setthe Activation CMAS support(actCMAS)parametervaluetofalse.

2.5 LTE495: OTDOA


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE495:OTDOAfeature.

Activating LTE495: OTDOA


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
ThePRS activation(actOtdoa)parameterisusedtoactivatethefeature.
Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

Issue:01J

SI window length(siWindowLen)
GPS connected to system module(gpsInUse)
DRX on duration timer(drxOnDuratT)
BTS network synchronization mode(btsSyncMode)
PRS power boost(prsPowerBoost)
PRS Tx diversity activation(actPrsTxDiv)
PRS configuration index (prsConfigurationIndex)
PRS bandwidth(prsBandwidth)
PRS Number of DL frames(prsNumDlFrames)

DN09185979

29

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) SetthePRS activation(actOtdoa)parametervaluetotrue.

Note: Thisstepactivatesthefeature.

SI window length(siWindowLen)mustbesetappropriatelydependingon
theindividualPRSconfiguration
DRX on duration timer(drxOnDuratT)indrxProfile2anddrxProfile3
mustbesettovaluegreaterthan3.
Thefollowingparametersmustbeconfigured:

PRS
PRS
PRS
PRS
PRS

power boost(prsPowerBoost)
Tx diversity activation(actPrsTxDiv)
configuration index (prsConfigurationIndex)
bandwidth(prsBandwidth)
Number of DL frames(prsNumDlFrames)

d) SelecttheBTSSCLobject.

GPS connected to system module(gpsInUse)mustbesettotrue.


BTS network synchronization mode(btsSyncMode)mustbeseto
PhaseSync.

Deactivating LTE495: OTDOA


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

30

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) SetthePRS activation(actOtdoa)parametervaluetofalse.

2.6 LTE496: Support of QCI 2, 3 and 4; LTE497: Smart


Admission Control; LTE534: ARP Based Admission
Control
Purpose
Followtheseprocedurestoactivateanddeactivatethefeatures:LTE496:SupportofQCI
2,3and4,LTE497:SmartAdmissionControl,LTE534:ARPBasedAdmissiionControl.

Activating LTE496: Support of QCI 2, 3 and 4; LTE497


Smart Admission Control; LTE534: ARP Based Admission
Control
Before you start
Thefeatures

LTE496:SupportofQCI2,3and4
LTE497:SmartAdmissionControl
LTE534:ARPBasedAdmissionControl

dependoneachotherandcanonlybeactivatedtogetherbysettingtheparameter

Activate enhanced AC and GBR services (actEnhAcAndGbrServices)


totrue.
ThefeatureLTE7:SupportofMultipleEPSBearer
mustbeactivatedbeforeactivationofthefeaturebundleabove.
Thefollowingparametersmustbeactivatedorconfigured:

LNBTS

Activate multiple bearers(actMultBearers)


Congestion weight algorithm (congWeightAlg)
Activate multiple GBR bearers (actMultGbrBearers)

LNCEL

UL scheduler FD type (ulsFdPrbAssignAlg)


Activate enhanced AC and GBR services (actEnhAcAndGbrServices)
canonlybesettotrueifActivate multiple bearers(actMultBearers)isset
totrueANDCongestion weight algorithm (congWeightAlg)isconfigured.

Issue:01J

DN09185979

31

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

WhenLTE497isactivatedthefollowingRACparametersmustbeconfiguredappropriate
(allareLNCELparameters):

Maximum GBR-DBR Traffic Limit (maxGbrTrafficLimit)


Add GBR-DRB Traffic for Radio Reason Handover
(addGbrTrafficRrHo)
Add GBR-DRB Traffic for Time Critical Reason Handover
(addGbrTrafficTcHo)

AchangeoftheactivationofthisfeaturebundlebecomesvalidatthenextBTSrestart.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) SettheActivateEnhancedACandGBRServices(actEnhAcAndGbrServices)
parametervaluetotrue.
Thisstepactivatesthefeatures.

Deactivating LTE496: Support of QCI 2, 3 and 4; LTE497


Smart Admission Control; LTE534: ARP Based Admission
Control
Before you start
Thefeatures

LTE496:SupportofQCI2,3and4
LTE497:SmartAdmissionControl
LTE534:ARPBasedAdmissionControl

dependoneachotherandcanonlybedeactivatedtogetherbysettingtheparameter
ActivateenhancedACandGBRservices(actEnhAcAndGbrServices)tofalse.
(ActivateenhancedACandGBRservices(actEnhAcAndGbrServices)cannotbesetto
falseif((Activate multiple GBR bearers (actMultGbrBearers) issetto
true))OR((ULschedulerFDtype(ulsFdPrbAssignAlg)issettoMixedFDinanyLNCEL
instance)
ThedeactivationofthisfeaturebundlebecomesvalidatthenextBTSrestart

32

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) SettheActivateEnhancedACandGBRServices(actEnhAcAndGbrServices)
parametervaluetofalse.
Thisstepdeactivatesthefeatures.

2.7 LTE519: E-RAB Modification


Purpose
Followtheseprocedurestoactivateanddeactivatethefeature:LTE519:E-RAB
Modification.

Activating LTE519: E-RAB Modification


Before you start
ThefeatureLTE519:E-RABModificationmustbeactivatedbysettingtheparameter
Activate E-RAB Modification (actERabModify)totrue,
ThefeatureLTE9:ServiceDifferentiationmustbeactivated(bysettingtheparameter
ActivatenonGBRServiceDifferentiation(actNonGbrServiceDiff)totrue)beforethe
featureLTE519:E-RABModifcationcanbeactivated.
AchangeoftheactivationofthisfeaturebecomesvalidatthenextarrivingS1AP
messageE-RABMODIFYREQUEST

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Issue:01J

DN09185979

33

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate E-RAB Modification (actErabModify)
parametervaluetotrue.
Thisstepactivatesthefeature.

Deactivating LTE519: E-RAB Modification


Before you start
ThefeatureLTE519:E-RABModifcationcanbedeactivatedbysettingtheparameter
Activate E-RAB Modification(actERabModify) tofalse.
AchangeoftheactivationofthisfeaturebecomesvalidatthenextarrivingS1AP
messageE-RABMODIFYREQUEST.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate E-RAB Modifcation (actERabModify) parameter
valuetofalse.
Thisstepdeactivatesthefeature.

2.8 LTE587: Multiple GBR EPS Bearers per UE


Purpose
Followtheseprocedurestoactivateanddeactivatethefeature:LTE587:MultpleGBR
EPSBearersperUE.

34

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Activating LTE587: Multiple GBR EPS Bearers per UE


Before you start
ThefeatureLTE587:MultipleGBREPSBearersperUEmustbeactivatedbysettingthe
parameterActivate Multiple GBR Bearers (actMultGbrBearers)totrue,
Thefeatures

LTE7:SupportofMultipleEPSBearer
LTE496:SupportofQCI2,3and4
LTE534:ARPBasedAdmissionControl

mustbeactivatedbeforeactivationofthefeatureLTE587:MultipleGBREPSBearers
perUE.
AchangeoftheactivationofthisfeaturebecomesvalidatthenextarrivingS1AP
messageINITIALCONTEXTSETUPREQUESTorE-RABSETUPREQUESToratthe
nexthandoverpreparation

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate multiple GBR bearers (actMultGbrBearers)
parametervaluetotrue.
Thisstepactivatesthefeature.

Deactivating LTE587: Multiple GBR EPS Bearers per UE


Before you start
ThefeatureLTE587:MultipleGBREPSBearersperUEcanbedeactivatedbysetting
theparameterActivate multiple GBR Bearers (actMultGbrBearers)to
false.
AchangeoftheactivationofthisfeaturebecomesvalidatthenextarrivingS1AP
messageINITIALCONTEXTSETUPREQUESTorE-RABSETUPREQUESToratthe
nexthandoverpreparation

Issue:01J

DN09185979

35

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) SettheActivate multiple GBR bearers (actMultGbrBearers)
parametervaluetofalse.
Thisstepdeactivatesthefeature.

2.9 LTE612: Synchronization Hub using BTS Site


Manager
Purpose
FollowtheseprocedurestoactivateordeactivatetheLTE612:SynchronizationHub
feature.

Activating LTE612: Synchronization Hub


Before you start
TheevolvedNodeBmustalreadybecommissioned.TheBTSSiteManager(BTSSM)
canbeconnectedtotheeNBeitherlocally,orfromaremotelocation.
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
ThesyncPropagationEnabledparameter("Forwardsynchronizationinco-siting")is
usedtoactivatethefeature.

Steps

Follow the general procedure described in section Activating and Deactivating


LTE features using BTS site manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

36

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Go to the BTS Settings page.


SelectForwardsynchronizationinco-siting.
Thisstepactivatesthefeature.Sotheoutputof1PPS,2.048MHzexternalsignal
and/orPDHsynchronizationsourcesisprovidedbytheeNB.

In case of 2.048 MHz output signal: Go to the BTS Settings page.


Toenablethe2.048MHzoutputalsoincaseofholdovermode.
SelectExternal2.048MHzsynchronizationoutputinuseinHOmode.
Thisstepenablesthe2.048MHzoutputalsoincaseofholdovermode.Incasethe
parameterisntselected,theoutputsignalisswitchedoff,iftheeNBisinholdover
mode.

In case of PDH output signal: Go to the Physical Layer Configuration page.


SelectPDHInterfacesIFnumber.
ThisstepenablesthePDHinterfacesfortheoutputPDHsignal.

In case of PPS output signal: Go to the BTS Settings page.


SelectExternal1ppsclockouton.
Thisstepenablesthe1PPSoutputalsoincaseofholdovermode.

Note: Remark:
ForFSME:cannotbeconfigured(HWlimitation).Incaseofholdovermodetheoutput
signalisswitched-off.
ForFSMF:cannotbeconfiguredinRL40(preparedforfuturedevelopment)

Deactivating LTE612: Synchronization Hub


Before you start
TheevolvedeNBmustalreadybecommissioned.TheBTSSiteManager(BTSSM)can
beconnectedtotheeNBeitherlocally,orfromaremotelocation.
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.
ThesyncPropagationEnabledparameter(Forwardsynchronizationinco-siting)is
usedtodeactivatethefeature.

Issue:01J

DN09185979

37

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS site manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the BTS Settings page.


UnselecttheForwardsynchronizationinco-siting.
Thisstepdeactivatesthefeature.

In case of PDH output signal: Go to the Physical Layer Configuration page.


UnselectPDHInterfacesIFnumber.
ThisstepdisablesthePDHinterfacesfortheoutputPDHsignal.

Configuration of the eNB receiving the synchronization


signal from a synchronization hub eNB
Before you start
WhenSyncHubconfigurationisactivetheSynchronizationHubeNBneedstobe
connectedtochainedeNBs.Dependingonthechosensynchronizationsignaleitherthe
syncoutneedstobeconnectedtosyncin(forPPSand2MHz)orthePDHinterfaces
needtobeconnected.Forsyncoutandsyncinthedifferentconnectortypesneedto
beconsidered(FSME:MDR14outandMDR26in;FSMF:HDMI).
Synchronizationinputfor2.048MHzandPDHneedstobedoneintheusualmanner.
1. IncaseofPPSoutputsignal:
GototheBTS Settingspage.
2. SelectGPSinuse
Thisstepenablesthe1PPSinput.
3. SelectNetworksynchronizationmode:FrequencysynchronizationorPhase
synchronization
Thisstepenableseitherfrequencyorphasesynchronization.
4. SelectGPScontrolinterfaceblockedforco-locatedBTS
ThisstepdisablesthecontrolinterfacefortheSynchronizationInterfaceProtocolfor
receivingandsending(forexampledayoftimeinfo).Incaseofsynchronization
chainedeNB,itneedstobedisabled.
IncaseofPhasesynchronization
Theoverallpropagationdelayneedstobecompensated.Thisneedstoincludedelay
ofthelinebetweentheGPSantenna/receiverandtheSynchronizationhubeNB
1ppsinputandtheline(s)betweentheinputandoutputofthechainedeNB(s).The
delaycanbeconfiguredeitherviaGPS cable lengthorviaGPS antenna line
delay.
SelectGPScablelengthandchooseappropriatecablelengthinmeter.

38

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Thisstepenablescompensationoftheantennalineincasewell-definedcablesare
used.
OR
SelectGPSantennalinedelayandentertheappropriatedelayinns.
Thisstepenablescompensationoftheantennaline.

2.10 LTE736: CS Fallback to UTRAN


FollowtheseprocedurestoactivateanddeactivatetheLTE736:CSFallbacktoUTRAN
feature.

Activating LTE736: CS Fallback to UTRAN


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
Thefollowingparametersareusedtoactivatethefeature:

Activate CS fallback with PS-HO to UTRA(actCsfbPsHoToUtra)


Activate handover from LTE to WCDMA(actHOtoWcdma)
Activate CS fallback via redirection(actCSFBRedir)

Thefollowingfeaturesneedtobeactivated/configuredbeforeactivationofLTE736:CS
FallbacktoUTRAN:

LTE56:InterRATHandovertoWCDMA
LTE562:CSFallbackwithredirection

FormoredetailedinformationseeSystemimpactofLTE736:CSFallbacktoUTRAN.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate CS fallback with PS-HO to UTRA
(actCsfbPsHoToUtra)parametervaluetotrue.
Thisstepactivatesthefeature.

Issue:01J

DN09185979

39

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Deactivating LTE736: CS Fallback to UTRAN


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate CS fallback with PS-HO to UTRA
(actCsfbPsHoToUtra)parametervaluetofalse.
Thisstepdeactivatesthefeature.

2.11 LTE843: ETWS broadcast


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE843:ETWSbroadcast
feature.

Activating LTE843: ETWS broadcast


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
TheActivation ETWS support (actETWS)parameterisusedtoactivatethe
feature.
Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

ETWS primary notification broadcast duration


(etwsPrimNotifBcDur)
PWS with emergency area ID(pwsWithEmAreaId)
Emergency area ID(emAreaId)
System information scheduling list (sibSchedulingList)

ItisnotpossibletoenableLTE843:ETWSbroadcastfeatureandLTE494:Commercial
MobileAlertSystemfeaturesimultaneouslyperoneeNB.

40

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SettheActivation ETWS support (actETWS)parametervaluetotrue.

Note: Thisstepactivatesthefeature.
c) IftheLTE494:CommercialMobileAlertSystemfeatureisactivated,setthe
Activation CMAS support(actCMAS)parametertofalse.
d) ConfiguretheETWS primary notification broadcast duration
(etwsPrimNotifBcDur)parameter.
e) Configurethe PWS with emergency area ID(pwsWithEmAreaId)
parameter
f) SelecttheLNCELobject.
g) ConfiguretheSystem information scheduling list
(sibSchedulingList) parameter.ThesibSchedulingListmust
containSIB10andSIB11configuration.Periodicity,RepetitionandSIB
typeforSIB10andSIB11mustbeconfigured.
h) IfthePWS with emergency area ID(pwsWithEmAreaId)parameteris
settotrue,configuretheEmergency area ID(emAreaId)parameter

Deactivating LTE843: ETWS broadcast


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Issue:01J

DN09185979

41

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SettheActivation ETWS support (actETWS)parametervaluetofalse.

2.12 LTE872: SRVCC to WCDMA


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE872:SRVCCtoWCDMA
feature.

Activating LTE872: SRVCC to WCDMA


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
Thefollowingparametersareusedtoactivatethefeature:

Activate SRVCC to WCDMA (actSrvccToWcdma)


Activate handover from LTE to WCDMA(actHOtoWcdma)
Activate support of conversational voice
bearer(actConvVoice)

Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

SRVCC HO indication(srvccHoInd)
Single radio voice call continuity allowed(srvccAllowed)
Frequency layer list for SRVCC to
WCDMA(freqLayListSrvccWcdma)inMODPRMOC
Frequency layer list for SRVCC to
WCDMA(freqLayListSrvccWcdma)inMOPRMOC
Target frequency(uTargetFreq)
WCDMA neighbor relation identifier(lnRelWId)
Primary PLMN identity in CGI of UTRAN neighbor cell(plmnId)
PS handover allowed(psHoAllowed)
Target cell Id in UTRAN CGI of related neighbor
cell(uTargetCid)
Target RNC Id(uTargetRncId)

Thefollowingfeaturesneedtobeactivated/configuredbeforeactivationofLTE872:
SRVCCtoWCDMA:

42

LTE7:SupportofMultipleEPSBearer
LTE10:EPSBearersforConversationalVoice
LTE56InterRATHandovertoWCDMA

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

FormoredetailedinformationseeSystemimpactofLTE872:SRVCCtoWCDMA.

Steps
Expected outcome
LTE872:SRVCCtoWCDMAisactivated.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate SRVCC to WCDMA (actSrvccToWcdma)parameter
valuetotrue.

Note: Thisstepactivatesthefeature.
d) Setthe Activate handover from LTE to WCDMA (actHOtoWcdma)
parametervaluetotrue.

Note: Thisstepactivatesthefeature.
e) Setthe Activate support of conversational voice bearer
(actConvVoice)parametervaluetotrue.

g
3

Note: Thisstepactivatesthefeature.

Expand the MRBTS object, expand LNBTS object (optional).

ForeachNeighborWCDMABTScell(inLNADJWobject)setTarger

frequency (InAdjWId)
ForeachNeighborWCDMABTScell(inLNADJWobject)setSRVCCHO
indication(srvccHoInd)

Expand the MRBTS object, expand LNBTS object, and select MODPR object
(optional).

Issue:01J

Setthe Frequency layer list for SRVCC to WCDMA


(freqLayListSrvccWcdma)parameter.

DN09185979

43

ActivatingLTERL40Features

Expand the MRBTS object, expand LNBTS object, and select MOPR object
(optional).

LTERL40,FeatureDescriptionsandInstructions

Setthe Frequency layer list for SRVCC to WCDMA


(freqLayListSrvccWcdma)parameter.

Expand the MRBTS object, expand LNBTS object, and for each LNCEL object
select LNRELW obejct (optional).

Setthe WCDMA neighbor relation identifier (lnRelWId)


parameter.
Setthe Primary PLMN identity in CGI of UTRAN neighbor cell
(plmnId)parameter.
Setthe PS handover allowed (psHoAllowed)parameter.
Setthe Target cell Id in UTRAN CGI of related neighbor
cell (uTargetCid)parameter.
Setthe Single radio voice call continuity allowed
(srvccAllowed)parameter.

Deactivating LTE872: SRVCC to WCDMA


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

Steps
Expected outcome
LTE872:SRVCCtoWCDMAisdeactivated.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate SRVCC to WCDMA (actSrvccToWcdma)parameter
valuetofalse.

44

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

2.13 LTE873: SRVCC to GSM


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE873:SRVCCtoGSMfeature.

Activating LTE873: SRVCC to GSM


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
TheActivateSRVCCtoGSM(actSrvccToGsm)parameterisusedtoactivatethe
feature.
Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

DTM capability (dtm)


Timer T304 for InterRAT GSM (t304InterRATGsm)
Supervision timer for handover preparation to GSM
(tS1RelPrepG)
Single radio voice call continuity allowed(srvccAllowed)
Reference freq list for SRVCC to GSM (refFreqListSrvccGsm)
Band indicator applied to reference ARFCN (bandIndicator)
Reference ARFCN (referenceARFCN)
Reference freq list for SRVCC to GSM (refFreqListSrvccGsm)
Band indicator applied to reference ARFCN (bandIndicator)
Reference ARFCN (referenceARFCN)
ARFCN value Geran (arfcnValueGeran)
ARFCN value list (arfcnValueListGERAN)
Activate support of conversational voice bearer
(actConvVoice)
PLMN identity in CGI of GERAN neighbor cell (plmnId)
MCC (mcc)
MNC (mnc)
MNC length (mncLength)
Location area code (lac)
Cell identity (ci)
Neighbour GERAN BTS cell identifier (lnAdjGId)
GERAN neighbor relation identifier (lnRelGId)

Thefollowingfeaturesneedtobeactivated/configuredbeforeactivationofLTE873:
SRVCCtoGSM:

LTE7:SupportofMultipleEPSBearer
LTE10:EPSBearersforConversationalVoice

TheconfigurationofthefollowingfeaturesaffectsLTE873:SRVCCtoGSM:

Issue:01J

LTE490:SubscriberProfileBasedMobility
LTE784:ANRInterRATGERAN

DN09185979

45

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

LTE442:NetworkAssistedCellChangeToGSM
LTE872:SRVCCtoWCDMA

Steps
Expected outcome
LTE873:SRVCCtoGSMisactivated.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate SRVCC to GSM (actSrvccToGsm)parametervalueto
true.
Thisstepactivatesthefeature.
d) Setthe Supervision timer for handover preparation to GSM
(tS1RelPrepG)parameter(optional).
e) Setthe Activate support of conversational voice bearer
(actConvVoice)parametervaluetotrue(optional).
f) UnderLNBTSobjectcreateorselectLNADJGobject,andsetthefollowing
parameters(optional):

DTM capability(dtm)
ARFCN value Geran(arfcnValueGeran)
Note: ForthefullconfigurationofLNADJGobject,see
LTE442NetworkAssistedCellChangetoGSM.

g) UnderLNBTSobjectcreateorselectMODPRobject.UndertheMODPRobject
createReferencefreqlistforSRVCCtoGSM,andsetthefollowingparameters
(optional):

Band indicator applied to reference


ARFCN(bandIndicator)
Reference ARFCN (referenceARFCN)

h) UnderLNBTSobjectcreateorselectMOPRobject.UndertheMOPRobject
createReferencefreqlistforSRVCCtoGSM,andsetthefollowingparameters
(optional):

46

Band indicator applied to reference


ARFCN(bandIndicator)
Reference ARFCN (referenceARFCN)

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Expand the LNBTS object, and select the LNCEL object (optional).
a) Setthe Timer T304 for InterRAT GSM (t304InterRATGsm)
parameter.
b) UndertheLNCELobjectselectorcreatetheLNHOGobject.SettheARFCN
value list(arfcnValueListGERAN)parameter.

Note: ForthefullconfigurationoftheLNHOGobject,see
LTE442NetworkAssistedCellChangetoGSM.
c) UndertheLNCELobjectselectorcreatetheLNRELGobject.IntheLNRELG
objectsetthefollowingparameters:

Single radio voice call continuity


allowed(srvccAllowed)
Location area code(lac)
Cell identity(ci)
GERAN neighbor relation identifier(lnRelGId)

ExpandtheLNRELGobjectandsetPLMN identity in CGI of GERAN


neighbor cell(plmnId)parameters:

MCC(mcc)
MNC(mnc)
MNC length(mncLength)

Deactivating LTE873: SRVCC to GSM


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.

Steps
Expected outcome
LTE873:SRVCCtoGSMisdeactivated.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) Setthe XXparametervaluetoYY.

Issue:01J

DN09185979

47

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

b) ExpandtheMRBTSobject.
c) SelecttheLNBTSobject.
d) Setthe Activate SRVCC to GSM (actSrvccToGsm)parametervalueto
false.

2.14 LTE979: IRC for 2 RX paths


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE979:IRCfor2RXpaths
feature.

Activating LTE979: IRC for 2 RX paths


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
TheUplink combination mode (ulCombinationMode)parameterisusedto
activatethefeature.
Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:

GPS connected to system module (gpsInUse)


BTS network synchronization mode (btsSyncMode)
PRACH high speed flag (prachHsFlag)

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the BTS settings page. (Optional)


a) ItisrecommendedtosettheGPS connected to system
module(gpsInUse)parametertotrue.
b) ItisrecommendedtosettheBTS network synchronization
mode(btsSyncMode)parametertoPhaseSync.

48

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) SettheUplink combination mode (ulCombinationMode)parameter
valuetoIRC.

g
g

Note: Thisstepactivatesthefeature.
Note: PRACH high speed flag (prachHsFlag)canonlybesettofalseif
Uplink combination mode (ulCombinationMode)parameterissetto
IRC.

Deactivating LTE979: IRC for 2 RX paths


Before you start
RestartoftheeNBisnotrequiredafterdeactivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio network configuration page.


a) ExpandtheLNBTSobject.
b) SelecttheLNCELobject.
c) SettheUplink combination mode (ulCombinationMode)parameter
valuetoMRC.
d) PRACH high speed flag (prachHsFlag)canonlybesettotrueif
Uplink combination mode (ulCombinationMode)parameterissetto
MRC.

2.15 LTE984: GSM redirect with system information


FollowtheseprocedurestoactivateanddeactivatetheLTE984:GSMredirectwith
systeminformationfeature.

Issue:01J

DN09185979

49

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

Activating LTE984: GSM redirect with system information


Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.
Thefollowingparametersareusedtoactivatethefeature:

Activate GSM redirect with system


information(actGsmRedirWithSI)
and
Activate emergency call via redirection(actEmerCallRedir)
or
Enable UE context release with redirect(actRedirect)
or
Activate CS fallback via redirection(actCSFBRedir)

Thefollowingparametersareusedtoperformanadditionalconfigurationofthefeature:
LNBTSparameter:

Enable UE context release with redirect(actRedirect)


Activate CS fallback via redirection(actCSFBRedir)
Activate emergency call via redirection(actEmerCallRedir)

MODREDparameter:

RAT for redirection(redirRAT)


Add GSM system information to redirection message
(addGsmSIToRedirMsg)

MOREDparameter:

RAT for redirection(redirRAT)


Add GSM system information to redirection message
(addGsmSIToRedirMsg)

REDRTparameter:

RAT for redirection(redirRat)


Add GSM system information to redirection message
(addGsmSIToRedirMsg)

Atleastoneofthefollowingfeaturesneedtobeactivated/configuredbeforeactivationof
LTE984:GSMredirectwithsysteminformation:

LTE22:EmergencyCallshandling
LTE423:RRCConnectionReleasewithRedirect
LTE562:CSFallbackwithredirection

Thereisnorealinterdependencybetweenfeatures.
FormoredetailedinformationseeSystemimpactofLTE984:GSMredirectwithsystem
information.

50

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate GSM redirect with system information
(actGsmRedirWithSI)parametervaluetotrue.
Thisstepactivatesthefeature.

Deactivating LTE984: GSM redirect with system


information
Before you start
RestartoftheeNBisnotrequiredafteractivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate GSM redirect with system information
(actGsmRedirWithSI)parametervaluetofalse.
Thisstepdeactivatesthefeature.

Issue:01J

DN09185979

51

ActivatingLTERL40Features

LTERL40,FeatureDescriptionsandInstructions

2.16 LTE1387: Intra eNodeB inter-frequency LB


Purpose
FollowtheseprocedurestoactivateanddeactivatetheLTE1387:IntraeNodeBinterfrequencyLBfeature.

Activating LTE1387: Intra eNodeB inter-frequency LB


Before you start
Thefollowingfeatureneedstobeactivated/configuredbeforeactivationofLTE1387:
IntraeNodeBinter-frequencyLB:
LTE55:Inter-frequencyhandover
TheparameteractIfHomustbesettoenabled.
TheparametersIFLBLoadThresholds,thresholdRsrpIFLBFilter,
thresholdRsrqIFLBFilter mustbeprovidedwithvalues.
RestartoftheeNBisnotrequiredafteractivationofthisfeature.

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activation of inter frequency load balancing
(IFLB)(actinterFreqLB)parametervaluetotrue.
Thisstepactivatesthefeature.

Deactivating LTE1387: Intra eNodeB inter-frequency LB


Before you start

52

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

ActivatingLTERL40Features

Steps

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activation of inter frequency load balancing
(IFLB)(actinterFreqLB)parametervaluetofalse.
Thisstepdeactivatesthefeature.

Issue:01J

DN09185979

53

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3 Descriptions of radio resource management


and telecom features
3.1 LTE46: Channel Aware Scheduler (UL)
Introduction to the feature
WithChannelAwareScheduler(UL),theevolvedNodeBsupportschannelawareuplink
schedulinginthefrequencydomain.

3.1.1 Benefits
Thefeatureprovidesanimproveduplinkcellcapacity.

3.1.2 Requirements
Software requirements
Table3:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table3

Softwarerequirements

UE

NetAct
OSS5.4CD2

iOMS

OMS4.0

MME
-

SAE GW
-

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.1.3 Functional description


WiththeLTE46:ChannelAwareScheduler(UL),theeNBprovidesanimprovedULcell
capacity,allocatingthePUSCHPRBswiththebestchannelconditionsfortheUEs
pendingforscheduling.TheeNBevaluatestheChannelStateIndicator(CSI)oftheUEs
inwhichboththeSoundingReferenceSignal(SRS)andPUSCHtransmissionaretaken
intoaccountforanimprovedestimationofthechannelquality.Basedonthese
measurementsChannelAwareScheduler(UL)optimallyallocatethePRBsfortheUEs
inthefrequencydomain.
TheChannelAwareScheduler(UL)isanalternativeschedulingapproachtothe
ChannelunawareULschedulingandtheLTE619:InterferenceawareULscheduling.

54

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

The Scheduling method of the UL scheduler(ulsSchedMethod)


parameterdefinestheschedulingmethodwhichisappliedinthecellfortheULbranch.
Threemethodscanbechosen:

channel unaware (0)


channel aware (1)
interference aware (2)

SRS Configuration
WiththeChannelAwareScheduler(UL)capableSRSconfigurationsaredefined.The
SRSconfigurationstakeintoaccounttheconditionsoftheeNBandprovide
measurementssufficientforthefavorableschedulingoftheUEsbytwoSRSclasses
whichareintroducedwiththefeature:

SRSclassthatassignsamultitudeofSRSresourcesforalimitednumberofUEs
SRSclassthatprovidessufficientSRSresourcesfortheproperschedulingofthe
UEs

TheoperatorcanchooseaSRSconfigurationfromagivensetofpredefined
configurationstailoredfortheusablePUSCHspectrum(configuringthe
srsConfigurationparameter;formoredetails,seeReferencedocumentation).The
SRSresourceswhichareselectedfortheUEsareassignedbymeansoftheRRC
ConnectionReconfigurationandRRCConnectionReestablishmentmessages.
TheusageofmeasurementsfromSRSinclosedloopuplinkpowercontrolcanbe
enabled/disabledbysettingtheparameterInclude SRS measurements In CL
power control (ulpcSrsEn)totrueorfalse,accordingly.
PRB allocation
ThePRBassignmentprocedurestartsineachsubframeatacertainstartingpointinthe
PUSCHspectrumwiththeUEwhichoffersthebestchannelconditionsexpressedbythe
averagerelativesignalstrengthparameterandcontinuestheassignmentofthephysical
resourcessequentially.WheneverthenextUEhastobeplacedinthePUSCH,the
schedulerselectstheUEwiththebestaveragerelativesignalstrengthrelatedtothe
nextfreePRBsfromthesetoftheremainingUEs.
Furthermore,ChannelAwareScheduler(UL)improvesthecellcapacitybyseparatingof
thePUSCHareasinadjacentcells.ThePUSCHissplitintoPUSCHschedulingareasof
approximatelyequalsizeandtheschedulerdefinesthebestPUSCHschedulingarea
withrespecttotheaverageinterferenceandnoisepower.

3.1.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity

Issue:01J

DN09185979

55

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Channelawareschedulingimprovestheaveragemulti-usercellthroughput.

3.1.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table4:Newparameterslistsparametersintroducedwiththisfeature.
Table4

Newparameters

Full name

Abbreviated name

Managed object

SRSConfiguration

srsConfiguration

LNCEL

IncludeSRSmeasurementsInCL
powercontrol

ulpcSrsEn

LNCEL

Table5:Modifiedparameterslistsparametersmodifiedbythisfeature.
RangeofthesrsConfigurationparameterdependsonulChBw.Formoredetails,
seeReferencedocumentation.
IfulpcSrsEnissetto false,srsPwrOffsetmustnotbedefined.
Table5

Modifiedparameters

Full name

Abbreviated name

SchedulingmethodoftheULscheduler

ulsSchedMethod

Managed object
LNCEL

Table6:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
IfulsSchedMethodparameterissettochannel aware,srsConfiguration
parametermustbeconfigured.
IfulsSchedMethodparameterissettochannel aware,srsPwrOffset parameter
mustbeconfigured.
ifulsSchedMethodparametervalueisotherthatchannel aware,ulpcSrsEn
parametermustbesettofalse.

56

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

fulsSchedMethodparameterissettochannel awareor interference aware,


ulsFdPrbAssignAlgparametermustbesettoMixed FD.
ifulsSchedMethodissettochannel awareorinterference aware,Periodic PHR
timer (PeriodicPhr)mustbesettovaluedifferentfrominfinity.
Table6

Relatedexistingparameters

Full name

Abbreviated name

PoweroffsetforSRStransmission
powercalculation

srsPwrOffset

Managed object
LNCEL

3.1.6 Sales information


Table7

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.2 Description of LTE48: Support of high speed users


Introduction to the feature
ThankstoLTE48:SupportofhighspeeduserstheevolvedNodeB(eNB)isableto
handleuserequipmentsspeed(UE)ofupto350km/hinopenspaceand300km/hin
tunnels.

3.2.1 Benefits
End-user benefits
Thisfeatureenablesend-usersusingLTEnetworkeveniftheirspeedinrelationtothe
eNBisupto350km/h.
Operator benefits
ThisfeatureallowstoservemoreUEs.

3.2.2 Requirements
Software requirements
Table8:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release
RL40

Issue:01J

Flexi Multiradio BTS


LBTS4.0

DN09185979

Flexi Multiradio 10 BTS


LBTS4.0

iOMS
OMS4.0(RL40)

57

Descriptionsofradioresourcemanagementand
telecomfeatures

Table8

LTERL40,FeatureDescriptionsandInstructions

Softwarerequirements

UE

NetAct

3GPPR8mandatory

MME

OSS5.4CD2

SAE GW
-

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.2.3 Functional description


Functional overview
TheeNBsupportshighspeedusersuptomaximumdopplerspread(Fd)of700Hzand
amaximumdopplershift/offset(Fo)of1400Hz.
LTE48:Supportofhighspeeduserscanbeconsideredintwoscenarios:
Scenariowithdopplerspread:mainlynon-line-of-sight(NLOS)scenarioswhere
thereisnofrequencyoffset(Fo=0)duetothevelocityoftheUEbuttheUEmoves
withacertainvelocityinascatteringenvironmentleadingtoadopplerspread(Fd>
0).ThemaximumFdiscomputedasfollows(simplifiedformula):
Fd[Hz]=Fc[GHz]xV[km/h]x0.926
whereFc-thecarrierfrequency,v-thevelocityoftheUE.
Scenariowithdopplershift/offset:mainlyline-of-sight(LOS)scenarioswherethe
mobilehasavelocitycomponentintothedirectionoftheeNB.Typicalscenarioslike
thisarefoundinhighspeedtrains,wheretheeNBislocatedneartothetracksor
somehighway-scenarios,wherecarsgofastandtheeNBisalsolocatedquitenear
tothehighway.Thesimplifiedformulatocalculatefrequencyoffsetis:
Fo[Hz]=2xFc[GHz]xV[km/h]x0.926

Allrequirementsforbothscenariosarelistedin3GPPRAN4,TS36.104(section8.2.1for
thescenariowithdopplerspreadandsection8.2.3forthescenariowithdoppler
shift/offset).
Table9:Maximumsupportedvelocitiesdependingonthecarrierfrequenyshowsan
overviewofthemaximumvelocitiesthattheeNBsupportsdependingonthecarrier
frequency.
Table9

Fc [GHz]

58

Maximumsupportedvelocitiesdependingonthecarrierfrequeny

max V [km/h]

Fd

Fo

0.7

1079

700

1400

0.8

944

700

1400

0.9

839

700

1400

1.8

420

700

1400

2.1

360

700

1400

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table9

Fc [GHz]
2.6

Descriptionsofradioresourcemanagementand
telecomfeatures

Maximumsupportedvelocitiesdependingonthecarrierfrequeny(Cont.)

max V [km/h]
291

Fd
700

Fo
1400

Configuring LTE48: Support of high speed users


Itispossibletoconfigureacelltosupporthigh-speedusersbysettingPrachHsFlagto
true.Itmakesthatrestrictedsetforphysicalrandomaccesschannel(PRACH)
preamblesisusedandthePRACHradioreceiver(Rx)algorithmischangedtohigh
speedreceiver.Inaddition,thePRACHhighspeedreceiverproducessomefrequency
offsetestimationforeachUE.Theseestimationsareimportanttoreceivethefollowing
PRACHmsg3onphysicaluplinksharedchannel(PUSCH).

Note: WhentheeNBusesrestrictedsetforPRACHpreambles,thecellrangeisupto
33km.

HsScenarioisthesecondparameter,whichconfiguresLTE48:Supportofhighspeed
users.Itcanhavethefollowingvalues:

Scenario 1:whenthisvalueisselectedUplinkphysicallayer(ULPHY)mainly
assumesthatthecellshouldworkforhighspeeduserswitheitherhighDoppler
spread(upto700Hz)orhighDoppleroffset(upto1400Hz).
ConcerningthehighDoppleroffsetthereceiverisoptimizedfortheRAN4highspeed
trainscenario1.
Scenario 3:whenthisvalueisselectedULPHYmainlyassumesthatthecellshould
workforhighspeeduserswitheitherhighDopplerspread(upto700Hz)orhigh
Doppleroffset(upto1400Hz).
ConcerningthehighDoppleroffsetthereceiverisoptimizedfortheRAN4highspeed
trainscenario3.
NoneofthesescenariosshouldbeselectedifthereisneitherabigDopplerspread
(around100Hz)norabigDoppleroffset(around200Hz)expected.ULPHYdoesnot
correctafasttimevaryingchannel,forexamplewithinchannelestimation.
Note: Itisrecommendedtohaveatleastaperiodicchannelqualityindicator(CQI)
configurationof40ms.

3.2.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity

Issue:01J

DN09185979

59

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

ThisfeatureenableshandlingUEs,whichspeedisupto350km/hinopenspaceand
300km/hintunnels.

3.2.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table10:Newparameterslistsparametersintroducedwiththisfeature.
Table10

Newparameters

Full name

Abbreviated name

HighspeedScenario

HsScenario

Managed object
LNCEL

Table11:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table11

Relatedexistingparameters

Full name

Abbreviated name

PRACHhighspeedflag

PrachHsFlag

Managed object
LNCEL

3.2.6 Sales information


Table12

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.3 LTE440: S1 Overload Handling


Introduction to the feature

60

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

WithLTE440: S1 Overload HandlingfeatureanevolvedNodeB(eNB)cansupport


overloadhandlingfor:
singleMME
MMEsinpool
multipleMMEpools(RANsharingconfiguration)

3.3.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
LTE440: S1 Overload Handlingfeatureensuresstablesystemoperationincaseof
MMEoverloadbylimitingloadincreaseinapool/singleMME.

3.3.2 Requirements
Software requirements
Table13:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table13

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.3.3 Functional description


MMEcanreportitsloadsituationtoaneNBsendingoneoftwomessages:

S1AP:OVERLOADSTART
S1AP:OVERLOADSTOP

TheMMEthatisexperiencingoverloadsendsanS1AP:OVERLOADSTARTmessage
toeitherallofitseNBsorasetofitseNBsselectedatrandom.MMEscanadjust:the
numberofeNBsthataresenttheS1AP:OVERLOADSTARTmessage,andthe
instructionscontainedinthismessage.FollowingtheeNBinstructionscanbeincluded:

Issue:01J

rejectallRRCconnectionestablishmentsfornon-emergencymobile-originateddata
transfer

DN09185979

61

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

rejectallRRCconnectionestablishmentsforsignaling
permitonlyRRCconnectionestablishmentsforemergencysessionsandmobileterminatedservices

TheMMEsendsS1AP:OVERLOADSTOPmessagetotheeNBtoindicatethatthe
overloadsituationhasendedandnormaloperationcanberesumed.
User scenarios
ThescenariospresentedinthissectiondescribehowaUEishandledwhenenteringa
cellcontrolledbyaneNBthatreceivedanoverloadmessagefromoneofitstwo
connectedMMEs.
UE enters a cell without a valid MME identifier
Connectionestablishmentprocedureforabovepreconditionsconsistofthefollowing
steps:

62

TheUEsendstheRRCConnectionRequest containingarandomvalue(noMME
identifier)andtheestablishmentCause.
TheeNBrecognizesthatitmustcompletetheRRCConnectionSetupprocedureto
getroutinginformationfromtheUEandsendstheRRCConnectionSetup
message.
TheUEconfirmsthesetupofRRCconnectionbysendingthe
RRCConnectionSetupCompletemessagethatcontainsPLMNidentifier.
TheeNBfindsallMMEsthatsupporttheprovidedPLMNidentifier.Inthiscaseboth
MMEAandMMEB.
TheeNBselectsMMEAorMMEBforthenewS1connectionusingtheloadbalancing
algorithm.
IftheeNBselectsMMEAandtheestablishmentCauseprovidedbytheUEisin
thelistofblockedcausessentbyMMEAinOverload Startmessage,theeNB
willsendRRCConnectionReleasemessage.AlltheUE-relatedresourcesare
released(seeFigure1:RejectionofRRCConnectionRequestmessage(noMME
identifierprovided)becauseMMEoverload).
IftheeNBselectsMMEAandtheestablishmentCauseprovidedbyUEisnotin
thelistofblockedcausessentbyMMEAinOverload Startmessage,theeNB
sendstheS1AP: Initial UEmessagetoMMEA(seeFigure2:Acceptanceof
RRCConnectionRequest(noMMEidentifierprovided)withoneMMEinoverload
state).
IftheeNBselectsMMEBitwillsendtheS1AP: Initial UEmessagetothatMME
(seeFigure2:AcceptanceofRRCConnectionRequest(noMMEidentifierprovided)
withoneMMEinoverloadstate).

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure1

Descriptionsofradioresourcemanagementand
telecomfeatures

RejectionofRRCConnectionRequestmessage(noMMEidentifier
provided)becauseMMEoverload

UE

eNB

MMEB
MMEA
S1AP:OverloadStart
RRC:RRCConnectionRequest
(randomvalue,establishmentcause)

RRC:RRCConnectionSetup

RRC:RRCConnectionComplete

RRC:RRCConnectionRelease

Figure2

AcceptanceofRRCConnectionRequest(noMMEidentifierprovided)
withoneMMEinoverloadstate

UE

eNB

MMEB
MMEA
S1AP:OverloadStart
RRC:RRCConnectionRequest
(randomvalue,establishmentcause)

RRC:RRCConnectionSetup

RRC:RRCConnectionComplete

S1AP:InitialUEMessage

UE with a valid MME identifier

Issue:01J

TheUEsendstheRRCConnectionRequest containinganS-TMSI(includinga
relevantMMECode)andtheestablishmentCausemessage.
TheeNBextractstheMMECodeandfindsMMEAbysearchingthroughthelistof
connectedMMEs.
TheeNBcomparestheestablishmentCauseoftheUEwiththelistofblocked
establishmentcausesofMMEA.
IftheestablishmentCauseoftheUEisinthelistofblockedestablishment
causesofMMEAtheeNBsendsRRCConnectionRejectmessagecontainingthe
waitingtimefortheUEandreleasesUE-relatedresources(seeFigure3:Rejection
ofRRCConnectionRequestmessage(MMEidentifierprovided)becauseofMME
overload).

DN09185979

63

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

IftheestablishmentCauseoftheUEisnotinthelistofblockedestablishment
causesofMMEAeNBperformsthenormalRCCConnectionSetupprocedure.
FinallytheeNBsendstheS1AP:Initial UEmessagetoestablishS1connection
(seeFigure4:AcceptanceofRRCConnectionRequest(MMEidentifierprovided)with
MMEinoverloadstate).

IftheeNBrejectsRRCconnection,UErepeatstheprocedureafterexpirationof
specifiedwaitingtime.
Figure3

RejectionofRRCConnectionRequestmessage(MMEidentifier
provided)becauseofMMEoverload

UE

eNB

MMEB
MMEA
S1AP:OverloadStart
RRC:RRCConnectionRequest
(MMEcode,establishmentcause)

RRC:RRCConnectionSetup

Waittime
RRC:RRCConnectionRequest

Figure4

AcceptanceofRRCConnectionRequest(MMEidentifierprovided)with
MMEinoverloadstate

UE

eNB

MMEB
MMEA
S1AP:OverloadStart
RRC:RRCConnectionRequest
(MMEcode,establishmentcause)

RRC:RRCConnectionSetup
RRC:RRCConnectionComplete

S1AP:InitialUEMessage

3.3.4 System impact


Interdependencies between features
TherearenoprerequisitefeaturesforLTE440: S1 Overload Handling.
Impact on interfaces
WiththisfeatureactivetheeNBwillsupportthefollowingClass2procedures:

64

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

OverloadStart(S1AP:Overload Startmessage)
OverloadStop(S1AP:Overload Stopmessage)

Impact on network and network element management tools


Thisfeatureallowstoavoidnetworkcongestionbyreducingtherateofsendingpackets
onanoverloadedS1-MMElink.
Impact on system performance and capacity
Systemresilienceisimproved.

3.3.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table14:Newparameterslistsparametersintroducedwiththisfeature.
Table14

Newparameters

Full name

Abbreviated name

ActivateS1overloadhandling

actS1OlHandling

Managed object
LNBTS

3.3.6 Sales information


Table15

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

3.3.7 Configuration
LTE440:S1OverloadHandlingcanbedeactivatedbysettingactS1OlHandling
parametertofalse.

Issue:01J

DN09185979

65

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.4 LTE494: Commercial Mobile Alert System


Introduction to the feature
WithCommercialMobileAlertSystem,itispossibletobroadcastcommercialwarning
informationtomanyUEsasquicklyaspossible.

3.4.1 Benefits
Theoperatorisabletoasupportpublicwarningservice.

3.4.2 Requirements
Software requirements
Table16:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table16

iOMS

OMS4.0

Softwarerequirements

UE
3GPPR9UE
capabilities

NetAct
OSS5.4CD2

MME
-

SAE GW
-

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.4.3 Functional description


ThepurposeofCMASistobroadcastcommercialwarninginformationtomanymobile
terminalsasquicklyaspossible.TheCMASnotificationissentbytheMMEtotheeNB
usingWRITE-REPLACEWARNINGREQUESTmessage.UEsinRRC_IDLEandin
RRC_CONNECTEDareinformedbypagingaboutthepresenceofCMASnotifications.
ThewarningnotificationcontainedintheWRITE-REPLACEWARNINGREQUEST
messagereceivedbyeNBismappedtoSIB12anditisbroadcastedtoallactiveandidle
UEs.
Thefollowingscenariosarepossible:
1. TheeNBstartsthebroadcast.

66

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

WhenconsistentWRITE-REPLACEWARNINGREQUESTmessageissentfrom
EPCviaMMEtoeNB.Iftherearenoinconsistencies,theeNBidentifiesthecellsto
whichsendsthewarningmessage,andstartsthebroadcast.TheeNB
acknowledgesthebroadcastinitiationbysendingWRITE-REPLACEWARNING
RESPONSEmessageviaMMEtoEPC.
IfthereceivedWRITE-REPLACEWARNINGREQUESTmessageisinconsistent,
theeNBsendsERRORINDICATIONmessagebacktotheMMEfromwhichthe
WRITE-REPLACEWARNINGREQUESTmessagewasreceived.
2. TheeNBstopsthebroadcast.
ToabortthebroadcastofawarningmessageEPCcansendaKILLREQUESTvia
MMEtoeNB.TheWRITE-REPLACEWARNINGREQUESTcontentwhichis
includedintheKILLREQUEST,isnolongerbroadcasted.Otherwarningsthathave
beenconcurrentlybroadcastedinSIB12arenotterminated.TheKILLRESPONSE
messageissendbackfromeNBviaMMEtoEPC.IfthereceivedKILLREQUEST
messageisinconsistent,theeNBsendsERRORINDICATIONmessagebacktothe
MMEfromwhichtheKILLREQUESTmessagewasreceived.
TheeNBalsostopsbroadcastingWRITE-REPLACEWARNINGREQUEST
messagewhenthemessagewassentthespecifiednumberoftimes.
TheoperatorcanactivateordeactivateCommercialMobileAlertSystembysettingthe
parameteractCMAS (Activation CMAS support)toTrueorFalseaccordingly.
TheparameterpwsWithEmAreaId (PWS with emergency area ID)indicatesif
theCMASusesEmergencyAreaIDstoindicateintheWRITE-REPLACEWARNING
REQUESTmessageinwhichcellsthewarningisbroadcasted.

IfaWarningMessageincludingEmergencyAreaIDsisreceivedbytheeNBandthe
parameterpwsWithEmAreaIdissettoFalse,thisWarningMessageisnot
broadcastedbytheeNB.
IfpwsWithEmAreaIdparameterissettoTrue,theconfigurationofemAreaId
parameterisrequired.

AnEmergencyAreaIDmaybeusedinsignalingmessagesreceivedviaS1interfaceto
indicatethesetofcellswhichhastheemergencyimpact(hastobroadcastthewarning
message).TheparameteremAreaId (Emergency area ID)identifiesthe
EmergencyAreaIDoftheeNBcell.

3.4.4 System impact


Interdependencies between features
ItisnotpossibletoenableLTE494:CommercialMobileAlertSystemfeatureand
LTE843:ETWSbroadcastfeaturesimultaneouslyperoneeNB.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

Issue:01J

DN09185979

67

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.4.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table17:Newparameterslistsparametersintroducedwiththisfeature.
Table17

Newparameters

Full name

Abbreviated name

Managed
object

Structure

ActivationCMASsupport

actCMAS

LNBTS

PWSwithemergencyareaID

pwsWithEmAreaId

LNBTS

EmergencyareaID

emAreaId

LNCEL

Systeminformationscheduling
list

sibSchedulingList

LNCEL

Periodicity

siMessagePeriodicity

LNCEL

sibSchedulingList

Repetition

siMessageRepetition

LNCEL

sibSchedulingList

SIBtype

siMessageSibType

LNCEL

sibSchedulingList

IfactCMASissettoTrue,thesibSchedulingListmustcontainSIB12configuration
(siMessageSibTypeofonesetmustbesettoSIB12).Periodicity,Repetition
andSIB typeforSIB12mustbeconfiguredbytheoperator
IfactCMASissettoTrue,pwsWithEmAreaIdconfigurationisrequired.
IfactCMASissettoTrue,ActivationETWSsupport(actETWS)parametermustbeset
tofalse.
IfpwsWithEmAreaIdissettoTrue,emAreaIdconfigurationisrequired.
Table18:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.

68

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table18

Descriptionsofradioresourcemanagementand
telecomfeatures

Relatedexistingparameters

Full name

Abbreviated name

SIwindowlength

siWindowLen

Managed object
LNCEL

3.4.6 Sales information


Table19

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.5 LTE495: OTDOA


Introduction to the feature
TheevolvednodeBsupportsOTDOA(ObservedTimeDifferenceofArrival).The
locationmethodOTDOAprovidesanimprovedlocationaccuracy.

3.5.1 Benefits
TheoperatorisabletoprovidelocationservicesbetterthancellIDwhereGPS
positioningisnotworking.

3.5.2 Requirements
Software requirements
Table20:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table20

iOMS

OMS4.0

Softwarerequirements

UE
3GPPR9UE
capabilities

NetAct
OSS5.4CD2

MME
-

SAE GW
-

Hardware requirements

Issue:01J

DN09185979

69

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

GPSreceiverisrequired.

3.5.3 Functional description


Observedtimedifferenceofarrival(OTDOA)isoneofthetypesofLocationServices
(LCS)features.ThesupportofLCSallowstodeterminethepositionofaUEwithinthe
RAN.ThenetworkisabletolocalizeaUEusuallywithinthe2Dgrid(xandydimension).
InLTE495:OTDOA,specialsignalsintheDLareintroduced(positioningreference
signals(PRS).TheUEsareabletodetectthePRSandderivemeasurementsbasedon
thePRS(thisabilitywillbedescribedintherestofthedocumentashereability).
Inprincipletherearethreeunknowns,thatisx,yandoneabsolutetimeorequivalently
oneabsolutedistancetooneoftheeNBs.Theseunknownscanbeobtainedviatime
differencemeasurementsasshownintheFigure5:OTDOAoverview
Figure5

OTDOAoverview
The!UE!measures!OTDOA!of!each
neighbor!it!detects!relative!to!the!serving!cell

Cell2
Location!server!knows:
-!location!of!each!cells!transmit!antenna
-!relative!transmit!frame!timing!of!each!cell

T2
T3

T1

E-SMLC/SLP
iGMLC

Serving
eNB

Cell3

OTD!=!Observed!Time!Difference
PCI!=!Physical!Cell!ID

Measurement!report:
T1-T2;!Cell!ID!of!cell2
T1-T3;!Cell!ID!of!cell3

InthiscasetheUEreceivesPRSfromthreecells,theservingcell,cell1andcell2.The
servingcell,cell1andcell2mustbesynchronized.TheUEtakesthereceivedtimingof
thePRSfromtheservingcellasareferenceandmeasuresthetimedifferencetothe
PRSreceivedfromtheothercells.IftheUEisabletoreceivethePRSfrom3eNBsit
couldhappenthatthereisnouniquesolutionfortheequationsystemandsome
assistanceinformationneedstobeusedtosortoutthecorrectposition.IftheUEisable
toreceivethePRSfrom4ormoreeNBsthesystemisoverdeterminedasthenumberof
measurementsisgreaterthanthenumberofunknownsandoneuniquesolutionexists.
TheUEisinformedaboutthePRSconfigurationviatheLPP(LTEPositioningProtocol).
TheLPPisaprotocoldefinedbetweentheUEandtheE-SMLC(enhancedServing
MobileLocationCentre).ItcommunicatesthePRSsettingsofthenetworktotheUEsas
wellastheOTDOAmeasurementsalsocalledRSTD(referencesignaltimedifference)
fromtheUEstotheE-SMLC.TheLPPprotocolentitiesaretransparenttotheeNBsand
thecomputationoftheUEpositionsaredoneintheE-SMLC.Theoperatorneedsto
providePRSsettingsofthenetworkandantennapositionsofeNBstotheE-SMLC.
Configuration

70

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

ThefeaturecanbeactivatedordeactivatedbysettingtheactOtdoatotrueorfalse
accordingly.Whenthefeatureisactivatedthefollowingparametershavetobe
configured:

PRS Power Boost (prsPowerBoost)


PowerBoostingforPRSincreaseshearabilityandallowsforamoreflexibleuseof
theDLTxpower
PRS Configuration Index (prsConfigurationIndex)
DeterminestheperiodicityandoffsetofthePRSoccasions
PRS Bandwidth (prsBandwidth)
TheparameterdeterminesonwhichresourceblocksPRSispresentwithinaPRS
subframe
PRS Number of DL Frames (prsNumDlFrames)
TheparameterspecifiesthenumberofconsecutivedownlinksubframeswithPRS.
WiththisPRStransmissioncanberepeatedwithinaPRSoccasiontoincreasethe
hearabilityofPRS.
PRS Tx Diversity Enable (actPrsTxDiv)
IfTxDiversityisenabledforPRStransmission,thenprecodingvectorswitchingis
usedandhenceallconfiguredTxantennasareusedforthetransmissionofthePRS
signal.IfTxdiversityisdisabledthenthePRSsignalistransmittedonasingle
antenna(thephysicalantennacorrespondingtoantennaport{0}).
SI window length(siWindowLen)
IftheeNBsupportsOTDOA,thesiWindowLengthparameterisrestrictedtoa
size,thatguaranteesaperiodicgapinthesysteminformationbroadcastschedule.
ThisgapisusedfortransmissionofPRS.Fordetails,seeReferencedocumentation.

Furthermore,theparameterprsMuting definesthePRSMutingpatternthatis
applied.Mutingwillbedeactivatediftheparameterisomitted.Thestructurecontainsthe
followingparameters:

PRS muting info(prsMutingInfo)isabitstringconsistingof16bit.Onlythe


firstprsMutingInfoPatternLenbitswillbetakenintoaccountstartingfromthe
mostsignificantbit(MSB).ThismeansthefirstprsMutingInfoPatternLenbits
oftheprsMutingInfobitstringwilldeterminethePRSMutingInfopatternwitha
givenperiodicity.DetailsofthedescriptioncanbefoundinTS36.355.Muting
configurationallowstoincreasethereuseofthePRSsignal.PRSofindividualcells
canbemutedtoincreasehearabilityofcellswiththesamefrequencyreuse.
PRS muting info pattern length(prsMutingInfoPatternLen)
determinesthenumberofbitsthatareusedtodescribethePRS Muting info
startingfromthemostsignificantbit(MSB)ofthebitstringwithsize16bit.

TheparameterMax phase drifting (maxPhaseDrifting) definesmaximum


alloweddriftingvaluefortheeNBtimingsourcephasesynchronization.

3.5.4 System impact


Interdependencies between features
LTE80:GPSSynchronizationmustbeenabled.
Impact on interfaces
ThisfeatureimpactsonairinterfaceduetoPRStransmission.Effectsaredescribedin
Impactonsystemperformanceandcapacitychapter.
Impact on network and network element management tools

Issue:01J

DN09185979

71

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
ThisfeaturereducesthenumberofavailableresourceelementsforDLtraffichence
affectingtheDLthroughput.Dependingontheconfigurationtheoverheadatfulldata
trafficcanvary.WithdefaultconfigurationtheoverheadatfullusageofPDSCHreaches
approximately0.6%(theoverheadcanincreaseifnotthesmallestPRSconfigurationis
used).

3.5.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table21:Newparameterslistsparametersintroducedwiththisfeature.
Table21

Newparameters

Full name

72

Abbreviated name

Managed
object

Structure

Maxphasedrifting

maxPhaseDrifting

BTSSCL

PRSactivation

actOtdoa

LNCEL

PRSTxdiversityactivation

actPrsTxDiv

LNCEL

PRSbandwidth

prsBandwidth

LNCEL

PRSconfigurationindex

prsConfigurationIndex

LNCEL

PRSmuting

prsMuting

LNCEL

PRSmutinginfo

prsMutingInfo

LNCEL

prsMuting

PRSmutinginfopatternlength

prsMutingInfoPatternLen

LNCEL

prsMuting

PRSNumberofDLframes

prsNumDlFrames

LNCEL

PRSpowerboost

prsPowerBoost

LNCEL

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Parameter relationships:

IfbtsSyncModeissettoPhaseSync,maxPhaseDriftingmustbeconfigured.
IfactOtdoaissettotrue:

IfnumOfTxPortsissetto1,actPrsTxDivmustbesettofalse.
IfactPrsTxDivissetto true:

siWindowLenmustbesetappropriatelydependingontheindividualPRS
configuration.Fordetailsonappropriatevalues,refertoparameter
siWindowLeninReferencedocumentation
configurationofthefollowingparametersisrequired:prsPowerBoost,
prsConfigurationIndex, prsBandwidth, prsNumDlFrames,
actPrsTxDiv

drxProfile2-drxOnDuratTmustbegreaterthan3
drxProfile3-drxOnDuratTmustbegreaterthan3

prsBandwidthrangedependsonthedlChBw.

Table22:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table22

Relatedexistingparameters

Full name

Abbreviated name

Managed
object

SIwindowlength

siWindowLen

LNCEL

DRXondurationtimer

drxOnDuratT

LNCEL

Structure

drxProfile2,
drxProfile3

3.5.6 Sales information


Table23

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.6 LTE496: Support of QCI 2, 3 and 4


Introduction to the feature
ThisfeatureLTE496:SupportofQCI2,3and4allowstheoperatortoofferGBR
(guaranteedbitrate)featureswithhigherbitratesastheQCI=1service.

Issue:01J

DN09185979

73

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

TheQCI(QoSclassidentifier)isanindexthatidentifiesasetoflocallyconfiguredvalues
forthreeQoS(qualityofservice)attributes:priority,delayandlossrate.TheQCIis
signalledinsteadthevaluesoftheseparameters.Ninepre-configuredclasseshavebeen
specifiedontwocategoriesofbearers,GBRandNon-GBRbearers.Inaddition
operatorscancreatetheirownclassesthatapplywithintheirnetwork.
Table24:StandardizedQCIcharacteristicsliststhestandardizedQCIdefinitions
specifiedin3GPPTS23.203v9.7.0.
Table24

QCI

StandardizedQCIcharacteristics

Resource
type

GBR

Priority

Packet delay
budget
(NOTE 1)

Packet error
loss rate
(NOTE 2)

Example services

100ms

10-2

Conversationalvoice

150ms

10-3

Conversationalvideo(livestreaming)

50ms

10-3

Realtimegaming

300ms

10-6

Non-Conversationalvideo(buffered
streaming)

100ms

10-6

IMSsignaling

300ms

10-6

Video(bufferedstreaming)

(NOTE3)
2
(NOTE3)
3
(NOTE3)
4
(NOTE3)
5

Non-GBR

(NOTE3)
6
(NOTE4)

TCP-based(e.g.,www,e-mail,chat,ftp,
p2pfilesharing,progressivevideo,etc.)
7

100ms

10-3

Voice,video(livestreaming),interactive
gaming

300ms

10-6

Video(bufferedstreaming)

(NOTE3)
8
(NOTE5)
9

TCP-based(e.g.,www,e-mail,chat,ftp,
p2pfilesharing,progressivevideo,etc.)
9

(NOTE6)
NOTE 1:
Adelayof20msforthedelaybetweenaPCEFandaradiobasestationshouldbesubtractedfromagivenPDBtoderive
thepacketdelaybudgetthatappliestotheradiointerface.ThisdelayistheaveragebetweenthecasewherethePCEFis
located"close"totheradiobasestation(roughly10ms)andthecasewherethePCEFislocated"far"fromtheradiobase
station,e.g.incaseofroamingwithhomeroutedtraffic(theone-waypacketdelaybetweenEuropeandtheUSwestcoast
isroughly50ms).Theaveragetakesintoaccountthatroamingisalesstypicalscenario.Itisexpectedthatsubtracting

74

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table24

Descriptionsofradioresourcemanagementand
telecomfeatures

StandardizedQCIcharacteristics(Cont.)

QCI

Resource
type

Priority

Packet delay
budget
(NOTE 1)

Packet error
loss rate
(NOTE 2)

Example services

thisaveragedelayof20msfromagivenPDBwillleadtodesiredend-to-endperformanceinmosttypicalcases.Also,
notethatthePDBdefinesanupperbound.Actualpacketdelays-inparticularforGBRtraffic-shouldtypicallybelower
thanthePDBspecifiedforaQCIaslongastheUEhassufficientradiochannelquality.
NOTE 2:
TherateofnoncongestionrelatedpacketlossesthatmayoccurbetweenaradiobasestationandaPCEFshouldbe
regardedasnegligible.APELRvalueisspecifiedforastandardizedQCIthereforeappliescompletelytotheradio
interfacebetweenaUEandradiobasestation.
NOTE 3:
ThisQCIistypicallyassociatedwithanoperatorcontrolledservice,i.e.,aservicewheretheSDFaggregate'suplink/
downlinkpacketfiltersareknownatthepointintimewhentheSDFaggregateisauthorized.IncaseofE-UTRANthisis
thepointintimewhenacorrespondingdedicatedEPSbearerisestablished/modified.
NOTE 4:
ThisQCIcouldbeusedforprioritizationofspecificservicesaccordingtooperatorconfiguration.
NOTE 5:
ThisQCIcouldbeusedforadedicated"premiumbearer"(e.g.associatedwithpremiumcontent)foranysubscriber/
subscribergroup.Alsointhiscase,theSDFaggregate'suplink/downlinkpacketfiltersareknownatthepointintime
whentheSDFaggregateisauthorized.Alternatively,thisQCIcouldbeusedforthedefaultbearerofaUE/PDNfor
"premiumsubscribers".
NOTE 6:
ThisQCIistypicallyusedforthedefaultbearerofaUE/PDNfornonprivilegedsubscribers.NotethatAMBRcanbeused
asa"tool"toprovidesubscriberdifferentiationbetweensubscribergroupsconnectedtothesamePDNwiththesameQCI
onthedefaultbearer.

Note: Operator hint


WhenusingtheLTE496:SupportofQCI2,3and4orLTE497:SmartAdmissionControl
itishighlyrecommendedtosetthefollowingparameters:

Enable restricted PRB assignment in uplink (reBwRpaEnUl)


Enable reduced bandwidth DL (redBwEnDl)

tofalse. Otherwise,thepacketschedulerlimitsthenumberofPRBs/TTIscheduledfor
allUEstothevalueconfiguredwithredBwMaxRbUlresp.redBwMaxRbDllandit
mightbeimpossibletoreachthehighbitrates,whichareexpectedtoreachwith
LTE496/LTE497.

3.6.1 Benefits
End-user benefits

Issue:01J

DN09185979

75

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturebenefitstheenduserasfollows:TheendusercanusetheQCI(QoSclass
identifier)2,3and4.TheresourcetypesoftheseQCIsareallGBR,withhigher
supportedguaranteedbitrates(comparedtoQCI=1).Themaximumguaranteedbitrate
isoperatorconfigurativewiththemaximumlimitDLof2MbpsandthemaximumlimitUL
of512kbps.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:theoperatorcanofferserviceswithQCI2,3
and4withhigherGBRsthantheQCI=1service.

3.6.2 Requirements
Software requirements
Table25:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table25

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.6.3 Functional description


Functional overview
TheeNBsupportsthefollowingQCIvaluesinRL40:

QCIvalues1..9(accordingly3GPPTS23.203v9.7.0,Table24:StandardizedQCI
characteristics)
QCIvalues128..254(accordinglyLTE518:OperatorspecificQCI)

ThisfeaturedescriptionLTE496:SupportofQCI2,3and4handlesbearerswithQCI
value2,3and4.Accordingly3GPPTS23.203v9.7.0,Table24:StandardizedQCI
characteristicstheseareGBRbearers.
TheeNBtargetstoenforcethedelaytargetsfortheQCIsaccordingto3GPP(Table24:
StandardizedQCIcharacteristics).Toreachthisgoaltheparameter delay_target
canbeconfiguredforeachQCI(aspartofthestructureqcitab2,qcitab3,qcitab4).This
parameteristhemaximumpacketdelayvalueusedbytheeNBMACscheduling
algorithm.

76

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Themaximumguaranteedbitrateisoperatorconfigurativebytheparameter
maxGbrDlwiththemaximumlimitDLof2MbpsandtheparametermaxGbrUl withthe
maximumlimitULof840kbps.ThesevaluesdefinethemaximumGBRvaluesontheS1
interfacethatwillbeadmittedbytheeNB.Requestsfortheestablishmentofbearerswith
higherGBRarerejected.
Furthermorethesehighbitratescancausecongestion.Topreventcongestionon
guaranteedresourcestheLTE497:SmartadmissionControlfeatureisintroduced.In
addition,congestionhandlingissupportedwhichisbasedoncongestiondetectionon
celllevel(onPDSCH,PUSCHaswellonPDCCH)assoonastheresourceusageforthe
guaranteedbitratebearersexceedaconfigurativeloadlimit(Parameter
maxGBRTrafficLimit).
ThecongestionhandlingintheeNBisconfigurativeviatheParameter
gbrCongHandling.(Table26:CongestionHandlingconfiguredbygbrCongHandling.)
Table26

CongestionHandlingconfiguredbygbrCongHandling.

Value

Congestion Handling

nocongestionhandling

congestionhandlingwithinlayer2onlybyapplyingcongestion
priorizationofbearersaccordingtothecongestionweight(Parameter:
congWeightAlg)

congestionhandlingonlayer2andlayer3bydroppingbearersin
accordancewithselectioncriteriadefinedinLTE534:ARPbased
AdmissionControlforE-RABs

TheParameter congWeightAlg definesapriorizationbehaviourinlayer2(MAC)


untileitherthecongestionsituationendsoruntilthecongestionsituationisresolvedby
higherlayers.Therearetwodifferentalgorithmspossible:

qciPrio:BearersareprioritizedinorderoftheirQCIpriority.
arpPrioPerVul:FirstbearerswithARPvulnerabilitypreemptableareprioritizedin
orderoftheARPpriority,thenthebearerswithARPvulnerabilitynotpreemptable
alsoinorderofARPpriority.

Theactualpre-emptionisperformedinhigherlayersaccordingtorulesandcriteriaas
beeingdefinedinLTE534:ARPbasedadmissioncontrol.
ThefeaturesLTE497:SmartAdmissionControlandLTE534:ARPbasedadmission
controlforE-RABsfeaturedecideifanadditionalbearer(evolvedradioaccessbearer
(E-RAB))isestablishedorrejected.ThedecisioncriteriaaretakenbytheAllocationand
retentionpriority(ARP).
Thefeatures

Issue:01J

LTE496SupportofQCI2,3and4
LTE497:SmartadmissionControl
LTE534:ARPbasedadmissioncontrolforE-RABs

DN09185979

77

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

canonlybeenabledtogetherbysettingtheactEnhAcAndGbrServicesparameterto
true.ByenablingthisfeaturebundleonlyasingleGBRbearerperUEissupported.The
establishingofmultipleGBREPSbearersperUEissupportedbyLTE587:MultipleGBR
bearersperUEandneedstobeactivatedseparately.
Thenumberofuserswhichcanbesupportedwithacertainguaranteedbitrateis
(considerably)limited.Theactuallimitdependsforexampleon:
typeofuser(mobileversusfixedwirelessaccess)
cellcharacteristics

systembandwidth
cellsize/inter-sitedistance

userchannelcharacteristics

fadingprofiles
geometryfactors

QoSrequirements

Inconsequence,itisnotpossibletogiveanyexplicitvaluesregardingthenumberof
supporteduserswithacertainrequiredrate.
TheeNBsupportsdifferentRLCmodes(radiolinkcontrolmodes)forQCI=4.Thisis
configurativeviatheparameterrlcMode of qciTab4.PossiblevaluesareRLC_AM
(acknowledgedmode)andRLC_UM(unacknowledgedmode).
Thisfeaturebringsalsothesupportofperiodicsub-bandCQIreporting(channelquality
indicator)onPUCCH.Mainbenefitofthisfunctionisthatifthesystemisdominatedby
DLcentricUDPtrafficonRLC_UMmode,wherethenumberofaperiodicCQIreportsis
heavilyreduced,theperiodicsub-bandCQIreportsallowtohavestillsomefrequency
selectivechannelqualityinformation.
Toderiveaguaranteedbitrateinlayer2theparametersl2OHFactorDl and
l2OHFactorUL areintroduced.Theseparametersspecifytheoverheadfactorofthe
downlink/uplinkGBRinlayer2.TheeNBincreasestheGBRindownlink/uplinkdirection
forradiolayer2bytheproductofGBRindownlink/uplinkdirectionandL2Overhead
FactorGBR/100.Whilethoseparameterscouldbeoptimizedtofittothecharacteristics
ofthetrafficbeingmappedtoacertainQCI-ifthosearereallywellknown-itis
essentialthattheoverheadisalwaysestimatedconservatively(thatis,theoverhead
factorshallcorrespondrathertotheworstcase).
TheuplinkFDschedulertypeisdeterminedbytheparameterulsFdPrbAssignAlg.
(Table27:ParameterulsFdPrbAssignAlg).IfthisfeatureLTE496:SupportofQCI2,3
and4isactivated,theparameterulsFdPrbAssignAlg mustbesetto2(mixed
mode).
Table27

ParameterulsFdPrbAssignAlg

value
0

78

UL scheduler type
roundrobin:TheRoundRobinFDschedulerassignsthephysical
resourcesequallyfairtotheUEsselectedbythescheduleruntilthe
PRBsaresufficientfortheserviceorthephysicalresourcesofthecell
areexhaust.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table27

Descriptionsofradioresourcemanagementand
telecomfeatures

ParameterulsFdPrbAssignAlg(Cont.)

value

UL scheduler type

exhaustive:TheFDExhaustiveFDschedulerassignsinthepriority
sequencedefinedbytheschedulerasmanyphysicalresourcesas
possibletotheUEsuntilthenumberofPRBsaresufficientforthe
serviceortheresourcesofthecellareexhaust.

mixed:TheMixedFDschedulerisajointFDschedulerwhichassigns
thePRBsforSRBandGBRbearersbytheexhaustiveFDschedulerand
thePRBsforthenonGBRbearersbytheRoundRobinFDschedulerto
theUEs.

ThefeatureLTE534:ARPbasedadmissioncontrol.replacesthepermanentadmittance
(fromreleasesbefore)byawithdrawableacceptance.Incaseofaresourcelimitation,
theeNBmaywithdrawtheadmittancefromanalreadyadmittedE-RABtouseits
resourcesforadmittanceofamoreimportant(thatis,withhigherARPpriority)E-RAB
(evolvedradioaccessbearer).

3.6.4 System impact


Interdependencies between features
Thefeatures

Lte496:SupportofQCI2,3and4
LTE497:SmartadmissionControl
LTE534:ARPbasedadmissioncontrolforE-RABs

belongtogetherandmustbeenabledtogether.
AccordingtoLTE587:MultipleGBREPSbearersperUE,itispossibletoestablishupto
threeGBR-bearers(forQCI2,3,4)perUE
Thefeature
LTE7:SupportofmultipleEPSbearer
isaprerequisiteforthesefeaturesandmustbeenabled.
Thesenewfeatureshaveimpacton

LTE9:Servicedifferentiation
LTE10:EPSbearersforconversationalvoice
LTE144:Transportadmissioncontrol

Impact on interfaces
Thisfeatureimpactsinterfacesasfollows:
NetAct,BTSSM:

Issue:01J

Additionalparametersforenablingandconfiguringthefeature
Additionalperformancecounters

DN09185979

79

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeatureismanagedbytheparameterslistedinmanagementdata.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeatureimpactssystemperformanceandcapacityasfollows:

Noeffectonnetworkconnectivity
Potentialreductionofcellcapacity

Impactoncellcapacityisdeterminedbythevolume,thecharacteristicsandthe
QoSparametersofthetrafficflowsrequiringtobehandledspecifically.
Cellcapacityreductionisduetotheamountoftrafficwithspecialrequirements.

Noeffectonnetworkeventcapacity
NoeffectonO&Mcapacityandconnectivity

3.6.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table28:Newcounterslistscountersintroducedwiththisfeature.
Table28

Counter ID

80

Newcounters

Counter name

Measurement

M8001C228

UEswithbufferedDLdataforQCI2bearer

LTECellLoad

M8001C229

UEswithbufferedDLdataforQCI3bearer

LTECellLoad

M8001C230

UEswithbufferedDLdataforQCI4bearer

LTECellLoad

M8001C271

PDCPSDUdelayonDLDTCHMeanfor
GBRDRBsofQCI2

LTECellLoad

M8001C272

PDCPSDUdelayonDLDTCHMeanfor
GBRDRBsofQCI3

LTECellLoad

M8001C273

PDCPSDUdelayonDLDTCHMeanfor
GBRDRBsofQCI4

LTECellLoad

M8001C315

PDCPSDUDLQCI2

LTECellLoad

M8001C316

PDCPSDUDLQCI3

LTECellLoad

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table28

Counter ID

Descriptionsofradioresourcemanagementand
telecomfeatures

Newcounters(Cont.)

Counter name

Measurement

M8001C317

PDCPSDUDLQCI4

LTECellLoad

M8001C324

PDCPSDUdiscardedDLQCI2

LTECellLoad

M8001C325

PDCPSDUdiscardedDLQCI3

LTECellLoad

M8001C326

PDCPSDUdiscardedDLQCI4

LTECellLoad

M8006C162

InitialEPSBearersetupattemptsforGBR
DRBSofQCI2

LTEEPSBearer

M8006C163

InitialEPSBearersetupattemptsforGBR
DRBSofQCI3

LTEEPSBearer

M8006C164

InitialEPSBearersetupattemptsforGBR
DRBSofQCI4

LTEEPSBearer

M8006C165

AdditionalEPSBearersetupattemptsfor
GBRDRBsofQCI2

LTEEPSBearer

M8006C166

AdditionalEPSBearersetupattemptsfor
GBRDRBsofQCI3

LTEEPSBearer

M8006C167

AdditionalEPSBearersetupattemptsfor
GBRDRBsofQCI4

LTEEPSBearer

M8006C168

InitialEPSBearersetupcompletionsfor
GBRDRBsofQCI2

LTEEPSBearer

M8006C169

InitialEPSBearersetupcompletionsfor
GBRDRBsofQCI3

LTEEPSBearer

M8006C170

InitialEPSBearersetupcompletionsfor
GBRDRBsofQCI4

LTEEPSBearer

M8006C171

AdditionalEPSBearersetupcompletions
forGBRDRBsofQCI2

LTEEPSBearer

M8006C172

AdditionalEPSBearersetupcompletions
forGBRDRBsofQCI3

LTEEPSBearer

M8006C173

AdditionalEPSBearersetupcompletions
forGBRDRBsofQCI4

LTEEPSBearer

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters

Issue:01J

DN09185979

81

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

ThefollowingparametersaredefinedfortheworkaroundforQCI=2,3,4inRL30(Table
29:ParametersfortheworkaroundforQCI=2,3,4)andremainvalid:
Table29

ParametersfortheworkaroundforQCI=2,3,4

Full name

82

Abbreviated name

Managed object

Structure

DRXprofileindex

drxProfileIndex

MRBTS/LNBTS

qciTab2

DSCP

dscp

MRBTS/LNBTS

qciTab2

Logicalchannelgroupidentifier

lcgid

MRBTS/LNBTS

qciTab2

QCIsupport

qciSupp

MRBTS/LNBTS

qciTab2

Schedulingbucketsizeduration

schedulBSD

MRBTS/LNBTS

qciTab2

Schedulingpriority

schedulePrio

MRBTS/LNBTS

qciTab2

DRXprofileindex

drxProfileIndex

MRBTS/LNBTS

qciTab3

DSCP

dscp

MRBTS/LNBTS

qciTab3

Logicalchannelgroupidentifier

lcgid

MRBTS/LNBTS

qciTab3

QCIsupport

qciSupp

MRBTS/LNBTS

qciTab3

Schedulingbucketsizeduration

schedulBSD

MRBTS/LNBTS

qciTab3

Schedulingpriority

schedulPrio

MRBTS/LNBTS

qciTab3

DRXprofileindex

drxProfileIndex

MRBTS/LNBTS

qciTab4

DSCP

dscp

MRBTS/LNBTS

qciTab4

Logicalchannelgroupidentifier

lcgid

MRBTS/LNBTS

qciTab4

QCIsupport

qciSupp

MRBTS/LNBTS

qciTab4

Schedulingbucketsizeduration

schedulBSD

MRBTS/LNBTS

qciTab4

Schedulingpriority

schedulPrio

MRBTS/LNBTS

qciTab4

RLCprofileId

rlcProfileId

MRBTS/LNBTS

rlcProf102

SNfieldlengthdownlink

snFieldLengthDL

MRBTS/LNBTS

rlcProf102

SNfieldlengthuplink

snFieldLengthUL

MRBTS/LNBTS

rlcProf102

Timerreordering

tReord

MRBTS/LNBTS

rlcProf102

PDCPprofileId

pdcpProfileId

MRBTS/LNBTS

pdcpProf102

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table29

Descriptionsofradioresourcemanagementand
telecomfeatures

ParametersfortheworkaroundforQCI=2,3,4(Cont.)

Full name

Abbreviated name

Managed object

Structure

Sequencenumbersize

snSize

MRBTS/LNBTS

pdcpProf102

Timerdiscard

tDiscard

MRBTS/LNBTS

pdcpProf102

Table30:Newparameterslistsparametersrelatedtothisfeature.
Table30

Newparameters

Full name

Issue:01J

Abbreviated name

Structure

Managed object

ActivateenhancedAC
andGBRservices

actEnhAcAndGbrServic
es

MRBTS/LNBTS

Congestionweight
algorithm

congWeightAlg

MRBTS/LNBTS

DefaultprofileindexAM

defProfIdxAM

MRBTS/LNBTS

DefaultprofileindexUM

defProfIdxUM

MRBTS/LNBTS

PDCCHLAULDLpriority pdcchUlDlPrioTag1,
tag1,..PDCCHLAULDL ..pdcchUlDlPrioTag16
prioritytag16

pdcchUlDlPrio

MRBTS/LNBTS

PDCPprofileid

pdcpProfileId

pdcpProf103

MRBTS/LNBTS

Sequencenumbersize

snSize

pdcpProf103

MRBTS/LNBTS

Timerdiscard

tDiscard

pdcpProf103

MRBTS/LNBTS

PDCPprofileid

pdcpProfileId

pdcpProf104

MRBTS/LNBTS

Sequencenumbersize

snSize

pdcpProf104

MRBTS/LNBTS

Timerdiscard

tDiscard

pdcpProf104

MRBTS/LNBTS

L2overheadfactorGBR
DL

l2OHFactorDL

qciTab2,3,4

MRBTS/LNBTS

L2overheadfactorGBR
UL

l2OHFactorUL

qciTab2,3,4

MRBTS/LNBTS

RLCprofileid

rlcProfileId

rlcProf103

MRBTS/LNBTS

SNfieldlengthdownlink

snFieldLengthDL

rlcProf103

MRBTS/LNBTS

SNfieldlengthuplink

snFieldLengthUL

rlcProf103

MRBTS/LNBTS

DN09185979

83

Descriptionsofradioresourcemanagementand
telecomfeatures

Table30

LTERL40,FeatureDescriptionsandInstructions

Newparameters(Cont.)

Full name

Abbreviated name

Structure

Managed object

Timerreordering

tReord

rlcProf103

MRBTS/LNBTS

RLCprofileid

rlcProfileId

rlcProf104

MRBTS/LNBTS

SNfieldlengthdownlink

snFieldLengthDL

rlcProf104

MRBTS/LNBTS

SNfieldlengthuplink

snFieldLengthUL

rlcProf104

MRBTS/LNBTS

Timerreordering

tReord

rlcProf104

MRBTS/LNBTS

PeriodicCQIsubbands
cycles

cqiPerSbCycK

MRBTS/LNBTS/
LNCEL

GBRcongestionhandling

gbrCongHandling

MRBTS/LNBTS/
LNCEL

PeriodicCQIfeedback
type

periodicCqiFeedbackTyp
e

MRBTS/LNBTS/
LNCEL

MaximumGBRdownlink

maxGbrDl

qciTab2,3,4

MRBTS/LNBTS

MaximumGBRuplink

maxGbrUl

qciTab2,3,4

MRBTS/LNBTS

Delaytarget

delayTarget

qciTab2,3,4

MRBTS/LNBTS

ULschedulerFDtype

ulsFdPrbAssignAlg

MRBTS/LNBTS/
LNCEL

3.6.6 Sales information


Table31

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.7 LTE497: Smart admission Control


Introduction to the feature
Thetaskoftheadmissioncontrol(AC)istoadmitorrejecttheestablishmentrequests
fornewradiobearers(signalinganddataradiobearers).Inordertodothis,ACmust
careabout

84

theresourceconsumptioninacell

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

theQoSrequirementsofDRBs(dataradiobearers)
levelsofaccesspriorities
intracellaccess
handoveraccess

ThegoalofACistoallowhighradioresourceutilization(byacceptingradiobearer
requestsaslongasradioresourcesareavailable)butconsideringguaranteed
transmissioncapacityforcertainservices(GBRtraffic)ofalreadyadmittedusers.
ThisfeatureLTE497:SmartadmissionControlhasthefollowingcharacteristics:
ItisafeatureenhancementonlyforGBRtrafficandisrequiredtopreventcongestion
onguaranteedresources.
Thecounterbasedradioadmissioncontrolisreplacedbyameasurementbased
functionwhichleadstoamoreaccurateanddynamicsystembehavior.Countingof
usedresourcesandapplyingstatisticalmethodsonloadschemesdonotworkwhen
servinghighbitrateusers(usingQCI2,3,4).
RAC(radioadmissioncontrol)needstopredicttheloadasbeingcausedbyeach
newGBRradiobearerinthecellreflectingtherequestedtransmissionrates(UL/DL)
undergivenradioconditionsandconsideringtheexistingGBRloadinthecell.
Smartadmissioncontroloffersacongestinghandlingtogetridoftraffic(accordingto
ARPpriorities)whenanoverbookingofresourcesisdetected(inthescheduler):
Overbookingoroverloadmayoccurwhen

AdoptionoftransportadmissioncontroltoconsidervariousbitratesofQCI2,3,4
bearers(withoutcongestinghandling,withoutpartialadmission)
Partialadmissionmeans:IfmorethanoneDRBshallbeadmitted(forexample3),
andoneofthemcannotbeadmitted,thentheother2areadmitted.Onthecontrary
all-or-nothingmeans:IfmorethanonDRBshallbeadmitted(forexample3),and
oneofthemcannotbeadmitted,allofthemarerejected.TAC(transportadmission
control)worksalwaysinall-or-nothingmode.
RACworksforUEsinthecellinpartialadmissionmode,forhandoversinall-ornothingmode.

radioconditionsofhighbitrateusersgettingworse
atoooptimisticadmissionwasdone
burstingtrafficcannotbeservedovertime

Note: Operator hint


WhenusingtheLTE496:SupportofQCI2,3and4orLTE497:SmartAdmissionControl
itishighlyrecommendedtosetthefollowingparameters:

Enable restricted PRB assignment in uplink (reBwRpaEnUl)


Enable reduced bandwidth DL (redBwEnDl)

tofalse. Otherwise,thepacketschedulerlimitsthenumberofPRBs/TTIscheduledfor
allUEstothevalueconfiguredwithredBwMaxRbUlresp.redBwMaxRbDllandit
mightbeimpossibletoreachthehighbitrates,whichareexpectedtoreachwith
LTE496/LTE497.

Issue:01J

DN09185979

85

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.7.1 Benefits
ThisfeatureLTE497:SmartadmissionControlisdrivenbytheintroductionofGBR
trafficwithQCI2,3and4,thatiswithhighbitratedemandsonsingleUEs.
End-user benefits
Theenduserdoesnotseeanydifferenceduetothechangeofasysteminternal
admissionalgorithm.Hiscommunicationrequesttothenetworkiseitheradmittedor
rejected.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:
Radioadmissioncontrolreactsonmeasurementsandmustnotconsiderworstcase
scenariosallthetime(statisticconfiguration),thatisamoreoptimalsystem/resource
availabilityisexpected.
Acongestioncontrolfunctionallowsmoreoptimisticadmissiondecisions,andthe
systemcorrectsoverbookingsituationsusingpre-emptionsaccordingallocation
prioritiesonradiointerface.

3.7.2 Requirements
Software requirements
Table32:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table32

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturesrequiresnoneworadditionalhardware.

3.7.3 Functional description


Functional overview
WiththeintroductionofhighbitrateGBRbearerservicesthecountingofresourcesand
applyingstatisticalmethodsforadmissioncontrolisnotsufficientanymoreandthe
probabilityofcongestioninthesystemincreases.Onlyafewhighbitrateusersmay
consumeallradioresourcesandmayleadthesystemintocongestion.Smartadmission
controlfunctionsworkonlyforGBRtraffic.

86

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Resourceswithrespecttosignallingbearers,activeUEsandnumbersofDRBspercell
arestillcheckedusingcountersandconfiguredthresholds.ForGBRtrafficaforecast
calculationonneededresourcesforanewbearerisdoneandifthereareenough
resourcesleftinthecellthenewadmissionrequestisadmitted,Continuouslytheradio
resourceconsumptionismeasuredandadmissiondecisionstakethemeasurementsas
baseforanydecision,
AnoverviewoftheinteractionofdifferentfunctionblocksisgiveninFigure6:Interaction
ofdifferentfunctionblocks
Figure6
MM:Radio
bearer
request

Interactionofdifferentfunctionblocks

RBreq.
AdmittedRbs
RBreq.

BM:Radio
bearer
request

admitted

RBresp..

EPC

AdmittedRbs

PRB
allocation

RAC

AMC&
IFFT

Tx

congestion

RBrel.

Measurements

RBrelease
req

BM:Radio
bearer
release

Congestion
detection
congestion

RBrelease
req
Periodically:UEinformation(averagePRBusageUL/DL,transm.efficiencyUL/DL,
availiablePBRspersystemetc.)

TheagendaofFigure6:Interactionofdifferentfunctionblocksisgiveninthefollowing
Table33:Abbreviationsofthefigureabove(startingfromtheleft)
Table33

Abbreviationsofthefigureabove

Abbreviation

Issue:01J

Long name

EPC

evolvedpacketcore

MM

mobilitymanagement

BM

bearermanagement

RAC

radioadmissioncontrol

RB

radiobearer

PRB

physicalresourceblock

AMC

adaptivemodulationandcoding

IFFT

inversefastfouriertransformation

DN09185979

87

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

WiththenewchallengesoftheLTE496withvariousQCI-dependantbitratesthe
interfacebetweeneNBandS-GW(S1interface)isalsoconcerned.Theadmission
controloftheS1interfaceistheTAC(transportadmissioncontrol).TACworkswitha
configuredpacketsizeperQCIbearerontheS1interface.Thepacketratesare
calculatedusingtherequestedguaranteedbitrates.
Thefollowingthresholdsandmarginsareintroducedwiththisfeature(Table34:
Thresholdsandmargins):
Table34

Thresholdsandmargins

Parameter
maxGbrTrafficLimit

Description
Specifiesthelimitin%ofavailableradioresources.
Reachingtheresource-limitARPbasedpre-emption
istriggered.Ifpre-emptedDRBsareavailablethenew
bearermaybeadmitted,otherwiseitisrejected.
Example:10Mhz-system=>50PRBs,
maxGbrTrafficLimitissetto70%,whichleadstoa
thresholdof35PRBs.Theremaining15PRBsare
reservedforHOtrafficandnon-GBRtrafficandspare
incaseofbadradioconditionsofcertainUEs.

addGbrTrafficRrHo

SpecifiesabonusmarginincaseofGBR-DRB
requestsforhandoverwithcauseradioreason.RAC
usesthenthethreshold(maxGbrTrafficLimit+
addGbrTraffictRrHo)

addGbrTrafficTcHo

SpecifiesabonusmarginincaseofGBR-DRB
requestsforhandoverwithcausetimecritical.RAC
usesthenthethreshold(maxGbrTrafficLimit+
addGbrTraffictTcHo)

3.7.4 System impact


Interdependencies between features
Thefeatures

LTE496:SupportofQCI2,3and4
LTE497:SmartadmissionControl
LTE534:ARPbasedadmissioncontrolforE-RABs

belongtogetherandmustbeenabledtogetherbysettingthe
actEnhAcAndGbrServicesparametertotrue.
Thefeature
LTE7:SupportofmultipleEPSbearer
isaprerequisiteforthesefeaturesandmustbeenabled.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.

88

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

ThisfeatureismanagedbytheparameterslistedintheManagementdatasection.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.7.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table35:Newparameterslistsparametersintroducedwiththisfeature.
Table35

Newparameters

Full name

Abbreviated name

Managed object

ActivateenhancedACandGBR
services

actEnhAcAndGbrServices

MRBTS/LNBTS

AddGBR-DRBTrafficforRadioReason
Handover

addGbrTrafficRrHo

MRBTS/LNBTS/L
NCEL

AddGBR-DRBTrafficforTimeCritical
ReasonHandover

addGbrTrafficTcHo

MRBTS/LNBTS/L
NCEL

MaximumGBR-DRBTrafficLimit

maxGbrTrafficLimit

MRBTS/LNBTS/L
NCEL

3.7.6 Sales information


Table36

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

DN09185979

89

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.8 LTE519: eRAB Modification


Introduction to the feature
TheeNBallowschanging
theQCI(QoSclassindicator)valueofnon-GBR(guaranteedbitrate)QCIs
theARP(allocationandretentionpriority)valueofallQCIs
theUE-AMBR(aggregatemaximumbitrate)ofanUE

withthe:
S1AP:E-RABMODIFYREQUEST
S1AP:E-RABMODIFYRESPONSE

message.

3.8.1 Benefits
End-user benefits
Theend-usercanusesophisticatedtariff-modelsofferedbytheoperator.
Operator benefits
Theoperatorcanofferatarifflikethis:Forthefirst20GBpermonththeusergetsadata
rateof42mbpsasgoldenuser,fortheremainingdatahegets384kbpsasbronzeuser.
Iftheuserhasconsumedhisdatavolume(the20GB),theEPCstartsanEPSbearer
modificationtodowngradetheQoSandbandwidthoftheuser.
Theusercanchangehissubscription,forexamplefrombronzeusertogoldenuser.

3.8.2 Requirements
Software requirements
Table37:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table37

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

90

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

3.8.3 Functional description


Overview
Accordingto3GPP23.401theEPSbearerModificationProcedureisusedtomodifythe
QoSparametersQCI, ARP, GBR, MBR and UE-AMBR. ModificationfromaQCIof
resourcetypenon-GBRtoaresourcetypeGBRandviceversaisnotsupported,
TheFigure7:MSC:E-RABModifyRequestshowstheEPSBearerModification
procedureforQCI/ARPchangetriggeredbytheS1APmessageE-RABMODIFY
REQUEST.
Figure7

MSC:E-RABModifyRequest

UE

eNB

MME
S1AP: E-RABMODIFY REQUEST
(E-RABModList (QCI, ARP,
NAS: MODIFY EPSBEARERCONTEXTREQUEST),
opt. UE-AMBR)

Localreconfigurations
RRC: RRCConnectionReconfiguration
(drbToAddModifyList,
List (NAS: MODIFY EPSBEARERCONTEXTREQUEST))

LCHReconfiguration &
NASprocedure
RRC: RRCConnectionReconfigurationComplete
S1AP: E-RABMODIFY RESPONSE
RRC: ULInformationTransfer
(NAS: MODIFY EPSBEARERCONTEXT ACCEPT )

S1AP: UL NAS TRANSPORT


(NAS: MODIFY EPSBEARERCONTEXT ACCEPT )

MMEinitiatestheprocedureforanEPSBearerModificationforUE-AMBRandoptionally
QCI/ARPmodificationif:

PDNGWrequestthemodificationofanexistingEPSbearerbytheUpdateBearer
procedure(forallQoSparameters)-see[3GPP23.401]:"PDNGWinitiatedbearer
modificationwithbearerQoSupdate"
ThiscoversalsothecasethattheARPvaluesofadefaultbearerandIMSsignaling
beareraremodifiedtosupport"MultimediaPriorityServices"-see[3GPP23.401]:
"IMS-basedMultimediaPriorityServices".
HSSinitiatestheprocedure"InsertSubscriberData"(fordefaultQCIandARPfor
defaultbearersandUE-AMBR).TheMMEreceivesthenewsubscriberdataand
maystarttheEPSbearermodificationprocedure-see[3GPP23.401]:"HSS
InitiatedSubscribedQoSModification".
Inbothcases,MMEsendstheS1APmessageE-RABMODIFYREQUESTaddinga
NASPDU"MODIFYEPSBEARERCONTEXTREQUEST"foreachEPSbearerto
bemodified

WhentheeNBreceivestheS1APmessageE-RABMODIFYREQUESTfromMME(for
oneorseveralEPSbearers)thefollowingstepsaredone:

Issue:01J

TheeNBanalysistheprovidedQoSparameterstoderivetherequestedtypeof
modification.
TheeNBpreparestheradiobearermodificationforeachEPSbearertobemodified.

DN09185979

91

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

QCImodification:TheeNBconfiguresanewschedulingweightfortheULand
DLschedulersandanewtransportDSCPfortheEPSbearer.ForOperator
definedQCIstheeNBmaychangethecountergroup.
ARPmodification:TheeNBinformsadmissionandcongestioncontrolaboutthe
newARPvalue.OptionallytheeNBconfiguresanewcongestionweightforGBR
bearers.
NomodificationofbearerQoSparameters:TheeNBacceptsthemodification
withoutreconfiguringtheEPSbearer.
ForeachEPSbearerforwhichthemodificationhasbeenadmitted:TheeNB
repeatsthecurrentlogicalchannelconfiguration.[3GPP36.331]requiresthat
NASPDUscanonlybetransmittedbytheRRCmessage
RRCConnectionReconfiguration toUEifbearersaremodified(orsetup
orreleased).
UE-AMBRmodification:TheeNBinformsULandDLschedulersaboutthe
modifiedUE-AMBR.
TheeNBconfiguresthelocalU-PlaneandT-PlanefortheDRBofthemodified
EPSbearer(s).

TheeNBsendstheRRCmessageRRCConnectionReconfigurationtoUE.This
messagecontainsforeachsuccessfulmodifiedEPSbeareralogicalchannel
configurationandtheNASPDUoftheEPSbearerreceivedbytheS1APmessage
E-RABMODIFYREQUEST.
IftheeNBreceivestheRRCmessage
RRCConnectionReconfigurationComplete,theeNBsendstheS1AP
acknowledgmentE-RABMODIFYRESPONSEtotheMME
TheUEsendsinparallelNAS-PDU(s)containingtheNASacknowledgementofthe
EPSbearermodificationtotheeNBbyRRCmessage(s)ULInformationTransfer.The
eNBforwardsthisNAS-PDUs(non-access-stratumpacketdataunit)toMMEbythe
S1APmessageULNASTRANSPORT.
TheMMEcontinuestheUpdateBearerprocedure/InsertSubscriberDataprocedure.

Activation
Thisfeatureisactivated/deactivatedbysettingtheparameteractERabModifyto
true/false
QCI modification
BytheQCImodificationtheoldnonGBRQCIofanEPSbearerisreplacedbyanew
nonGBRQCIandtheconfigurationofthenewQCIisappliedtotheEPSbearer.
ThemodificationofaQCIisonlyallowedifallconfigurationparametersexceptfor

schedulWeight
dscp
counterGroup
scheduling priority
scheduling BSD

remainunchangedbythemodification.AnE-RABModifyRequestforQCImodificationis
rejectediftheQCIsdifferinotherparameters.
TheQCIofEPSbearerswiththeQCI=5andschedulingtypeSIGNALLINGarenotto
bechangedbecauseithasbeenreservedforIMSsignaling.
ARP modifcation

92

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

TheARPparameterofthebearerscanbemodifiedbytheBearerManagementduring
thelifetimeofthebearers.WiththemodificationoftheARPparameterthecongestion
weightofthebearerschangeistakenintoaccountimmediatelybytheDLcongestion
evaluationoftheGBRbearersinDL.
AnARPmodificationtoorfromanemergencyARPisrejected.
UE- AMBR
TheUE-AMBRischangediftheS1APmessageE-RABMODIFYREQUESTcontains
theIEUEAggregateMaximumBitrate.TheeNBinformstheratecappingfunctionof
MACschedulersaboutthenewUE-AMBR.

3.8.4 System impact


Interdependencies between features
Thefollowingfeatureshaveinterdependenciestothisfeature:

LTE9:ServiceDifferentiation:ThefeatureLTE519:eRABModificationmodifiesthe
schedulingweightsintroducedbyLTE9:ServiceDifferentiation.
LTE10:EPSbearersforconversationalvoice:ThefeatureLTE519:eRAB
ModificationmodifiestheGBRvaluesforQCI=1introducedbyLTE10:EPSbearers
forconversationalvoice(onlyforlowervalues).
LTE13:RateCapping:ThefeatureLTE519:eRABModificationmodifiestheUEAMBRintroducedbyLTE13:RateCapping.
LTE496:SupportofQCI2,3and4:ThefeatureLTE519:eRABModificationmodifies
theGBRvaluesforQCI234introducedbyLTE496:SupportofQCI2,3and4(only
forlowervalues).
LTE497:SmartadmissionControl:ThefeatureLTE519:eRABModificationmodifies
theGBRadmittedbytransport.
LTE518:OperatorSpecificQCI:ThefeatureLTE519:eRABModificationmodifiesthe
countergroupintroducedbyLTE518:OperatorSpecificQCI.IfaQCIismodified,it
mayhappenthatthenewQCIvaluebelongstoadifferentcountergroup.
LTE534:ARPbasedadmissioncontrolforE-RABs:LTE534:ARPbasedadmission
controlforE-RABsusesinternalARPmodification,thefeatureLTE519:eRAB
ModificationdescribeshowinternalandS1APARPmodificationarecoordinated.

Impact on interfaces
Thisfeatureimpactsinterfacesasfollows:LTE519:eRABModifcationintroducesthe
S1APprocedureE-RABModifyincludingthemessages

E-RABMODIFYREQUEST
E-RABMODIFYRESPONSE:

ThisfeatureismanagedbytheparameterslistedintheManagementDatasection.
Impact on network and network element management tools
Thisfeatureimpactsnetworkmanagementandnetworkelementmanagementtoolsas
follows:TheS1APprocedureE-RABModifyissupported.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

Issue:01J

DN09185979

93

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.8.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table38:Newparameterslistsparametersintroducedwiththisfeature.
Table38

Newparameters

Full name

Abbreviated name

ActivateE-RABModification

actERabModify

Managed object
LNBTS

3.8.6 Sales information


Table39

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.9 LTE534: ARP based admission control for E-RABs


Introduction to the feature
ThisfeatureLTE534:ARPbasedadmissioncontrolforE-RABsreplacesthepermanent
admittance(fromreleasesbefore)byawithdrawableacceptance.Incaseofaresource
limitation,theeNBmaywithdrawtheadmittancefromanalreadyadmittedE-RABtouse
itsresourcesforadmittanceofamoreimportantE-RAB(evolvedradioaccessbearer).
ThepolicyisbasedonARP(AllocationandretentionPolicy),whichisanE-RABpriority
conceptdefinedby3GPPTS23.203.

3.9.1 Benefits
End-user benefits
Thisfeatureoffersaprioritycontrolledadmissionandpre-emptionforGBRandnonGBRbearers.ThisisimportantfortheacceptanceforhighbitrateGBRfeatureswith
QCI2,3and4.TheendusercanusehighbitrateGBRservices.

94

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Operator benefits
Theoperatorcanofferserviceswithhigherbit-rates.

3.9.2 Requirements
Software requirements
Table40:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table40

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.9.3 Functional description


Functional overview
ThisfeatureimplementsanadmissionandretentionpolicyforE-RABswhich

admitsE-RABsaccordingtoadmissionpriority

regardsanadmissiononlytemporary,untilanE-RABwithhigherprioritiesneedsits
resources

ThispolicyiscalledARP(AdmissionandretentionPolicy)andtheframeworkforthis
policyisdefinedby3GPPTS23.203andTS36.413.ItisbasedononeE-RAB
parametercomprisingthefollowingthreevalues:

ARPprioritylevel,definingtheimportanceoftheE-RAB.AmoreimportantE-RAB
getsandkeepsneededresourcesmoreprioritizedthanlessimportantE-RABs
pre-emptionvulnerability,definingiftheE-RABmaybepre-emptedbyanE-RAB
withhigherARPpriority
pre-emptioncapability,definingiftheE-RABmaypre-emptanyE-RABwithlower
ARPpriority

Pre-emptionisaprocedurebywhichacallwithhigherprioritycancausethereleaseof
anongoingcallwithlowerpriority.Pre-emptionislimitedbytheparameter
maxNumPreEmptions.Thisparameterlimitsthenumberofpre-emptionswhichthe
admissionofasetofE-RABs(e.g.atinitialcontextsetup,E-RABsetup,handover
request)maycause.IfthisnumbergetsexceededforanE-RABset,theadmissionof
thissetsetwillpartlyorcompletelyfail.Becauseeachpre-emptiontakesatleast5ms

Issue:01J

DN09185979

95

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

(butmaytakemore,dependingoneNBload),thepre-emptionnumberlimitationshould
beconsideredcarefullytoavoidtimeoutsofprocedureswhichdependonE-RAB
admission(inparticularhandoverpreperations).
ThetimertimDelACContPreEmption delaysthecontinuationoftheadmisison
controlforpre-emptedbearers.IftheeNBsendstheS1APmessageE-RABRELEASE
INDICATIONforpre-emptedbearerstoMME,MMEneedstimetoreleasetheindicated
bearersintheEPC.UntilthereleaseofabearerS-GWmaystillsenddownlinkdata
packetsforthisbearertotheeNB.Theexpectedavaragetimeiscoveredbythistimer
thatdelaysthecontinuationoftheadmisisoncontrolbythegiventimervalue.
IfanE-RABisadmitted,theeNBdeterminestheneededresourcesandtriestoallocate
them.Ifnotenoughfreeresourcesareavailable,theeNBtriestoreleasethembypreemptionofalreadyadmittedE-RABsaccordingtotheaboveARPparameter.

3.9.4 System impact


Interdependencies between features
Thefeatures

LTE496:SupportofQCI2,3and4
LTE497:SmartadmissionControl
LTE534:ARPbasedadmissioncontrolforE-RABs

belongtogetherandmustbeenabledtogetherbysettingthe
actEnhAcAndGbrServices parametertotrue.
Thefeature
LTE7:SupportofmultipleEPSbearer
isaprerequisiteforthesefeaturesandmustbeenabled.
Thefeature
LTE572:IMSemergencysession
mustbeenabledforcorrecthandlingofemergencysessions.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
ThisfeatureismanagedbytheparameterslistedintheManagementDatasection
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
IncaseofE-RABsetupwithoutpre-emption,theARPbasedadmissioncontroldoesnot
degradethesetuptimeagainstthesetuptimewithoutLTE534:ARPbasedadmission
controlforE-RABs.Incaseofpre-emption,theE-RABsetuptimemayneedlongerthan
withoutpre-emption.
ForthisfeatureLTE534:ARPbasedadmissioncontrolforE-RABsnoreserved
resourcesforIMSemergencysessionE-RABSarelongernecessary.Therefore,the
eNBcapacityfornormalE-RABscanbeusedmoreeffectively.

96

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

3.9.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table41:Newcounterslistscountersintroducedwiththisfeature.
Table41

Newcounters

Counter ID

Counter name

Measurement

M8006C174

Pre-emptedGBRbearers

LTEEPSBearer

M8006C175

Pre-emptednon-GBRbearers

LTEEPSBearer

M8013C28

Pre-emptedUEcontextsduetopreemptionoflastnon-GBRbearer

LTEUEState

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table42:Newparameterslistsparametersintroducedwiththisfeature.
Table42

Newparameters

Full name

Abbreviated name

Structure

Activateenhanced actEnhAcAndGbrService
ACandGBR
s
services
Emergency
sessionsARP

Issue:01J

emerSessArp

Managed object
MRBTS/LNBTS

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
emerSessArpPreemCap
sessionARPpreemptionCapability

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
sessionARPpreemption
Vulnerability

imsEmerPlmnConfig

MRBTS/LNBTS

emerSessArpPreemVul

DN09185979

97

Descriptionsofradioresourcemanagementand
telecomfeatures

Table42

LTERL40,FeatureDescriptionsandInstructions

Newparameters(Cont.)

Full name

Abbreviated name

Structure

Managed object

Emergency
sessionsARP
prioritylevel

emerSessArpPrioLev

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
sessionslimited
servicemode
support

emerSessLimServ

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
sessionsMCC

emerSessMcc

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
sessionsMNC

emerSessMnc

imsEmerPlmnConfig

MRBTS/LNBTS

Emergency
sessionsMNC
length

emerSessMncLen

imsEmerPlmnConfig

MRBTS/LNBTS

Maximumnumber
ofpre-emptions

maxNumPreEmptions

MRBTS/LNBTS

TimerdelayedAC
continuationat
pre-emption

timDelACContPreempt

MRBTS/LNBTS

Timersuppress
GTP-Uerror
indicationatpreemption

timSuppGtpuErrIndPree
mpt

MRBTS/LNBTS

3.9.6 Sales information


Table43

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.10 LTE587: Multiple GBR EPS Bearers per UE


3.10.1 Description of LTE587: Multiple GBR EPS Bearers per UE
Introduction to the feature

98

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

WiththisfeatureLTE587:MultipleGBRbearersperUEthefollowingcombinationsof
DRBbearersaresupported:
Table44

Allowedmaximumnumberofbearers

Bearer

3.10.1.1

Maximum Number

DRBAM(AcknowledgedMode)

DRBUM(UnacknowledgedMode)

DRBGBR

DRB

Benefits
End-user benefits
Theendusercanuseadditionalservicecombinations.
Operator benefits
Theoperatorisabletoofferadditionalservicecombinations.

3.10.1.2

Requirements
Software requirements
Table45:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table45

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.10.1.3

Functional description
Functional overview
ThefollowingradiobearercombinationsaresupportedbyUE:

Issue:01J

DN09185979

99

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

SRB1+SRB2+NxAMDRB
SRB1+SRB2+NxAMDRB+1xUMDRB
SRB1+SRB2+NxAMDRB+2xUMDRB
SRB1+SRB2+NxAMDRB+3xUMDRB

withN=1...5.(SRB:signalingradiobearer,DRB:dataradiobearer,AM:acknowledged
mode,UM:unacknowledgedmode)NewwiththisfeatureisthattwoorthreeUMDRBs
areallowed.Therulesare:
1.
2.
3.
4.

Intotalmaximum6DRBsareallowed.
Ofthese6DRBs5AMDRBsareallowed.
Ofthese6DRBs3UMDRBsareallowed
Ofthese6DRBs3GBRDRBsareallowed.

TheeNBprovideschecksforthetotalnumberofDRBpercell,themaximumnumberof
DRBsperUEandthebearercombinationperUE.
TheeNBsupportsthefollowingscenariosforestablishingandreleasingEPSbearers:

establishindividualEPSbearers
releaseindividualEPSbearers
addmultipleEPSbearerstoexistingEPSbearers
releasemultipleEPSbearersfromexistingEPSbearers

ThedifferentEPSbearersperUEcanhavethesameoradifferentQCI(QoSclass
identifier).
Mapping of multiple GBR bearers to LCGs
WiththisfeatureconfigurationsofGBRbearersandnon-GBRbearersassignedtothe
sameLCG(logicalchannelgroup)arenowpossible.Thelogicalchannelgroupidentifier
(parameterlcgid)definesthemappingofthelogicalchannelstothecorresponding
LCGs.
UL scheduling
IfthesupportofmultipleGBRbearersperUEisactivated,thisbecomesimplicitlyvisible
forthetimedomainschedulerinULassoonasmorethanoneGBRbeareris
establishedforanyUE.InULtheschedulerhastodistinguishtheschedulingofthe
multipleGBRbearersdependingonthemappingoftheGBRbearerstotheLCG.Two
alternativesarepossible:

GBRbearersmappedtoaLCGservingonlyGBRbearers:Wheneverthisisthe
case,thetimedomainschedulingcriterioninULiscalculatedseparatelyforeachof
theGBRbearersassignedtotheUE.Thehighestofthosecriterionvaluesforall
GBRbearersofanUEisthenusedinthedeterminationoftheschedulingcandidate
set2.
GBRbearersmappedtoaLCGservingnon-GBRandGBRbearers:Forthiscase
theGBRbearerisscheduledlikeanon-GBRbearerinthetimedomainscheduler.

OnlythefirstalternativeofbothensuresthequalifiedschedulingoftheGBRbearersand
isrecommended.
DL scheduling
IfthesupportofmultipleGBRbearersperUEisactivated,thisbecomesimplicitlyvisible
fortheDLschedulerassoonasmorethanoneGBRbearerisestablishedforanyUE.

100

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Wheneverthisisthecase,theDLtimedomainschedulingcriterionforGBRbearers
needstobecalculatedforeveryGBRbearerofaUE.Thehighestofthosecriterion
valuesisthenusedindeterminationoftheschedulingcandidateset2.
Congestion handling for multiple GBR bearers
CongestionweightsforeachGBRbearerarecalculateddependingfromthevalueofthe
parameterconWeightAlg.AccordingtothevaluesqcipriooreitherarpPrioPerVul
differentformulas(withthevariablesQCI-PriorityorARP-Vulnerability)aretaken.
TheGBRbearerstobede-prioritizedinorexcludedfromschedulingortobereleased
aredeterminedinorderofthefollowingcriteria:
1. BearersofUEsinpowerlimitation(onlyrelevantforULbearers)
2. Fromlowertohighercongestionweightpriority(lowercongestionweightvalues
indicatehigherpriority)
3. WithinthesamecongestionweightpriorityfromhighertolowerPUSCHorPDDCH
GBRresourceusageofabearerofaUE
4. ForthesamePUSCHorPDDCHGBRresourceusagefromhighertolower
requestedGBR.
5. ForsamerequestedGBRinrandomorder.
Activation/Deactivation
Thisfeatureisactivated/deactivatedbysettingtheParameteractMultGbrBearers
totrue/false.Itcanonlybeactivatedwhenfollowingfeatureflagsaresettotrue:

3.10.1.4

actMultBearers (LTE7:SupportofMultipleEPSBearers)
actEnHAcAndGgbrServices (LTE496:SupportofQCI2,3and4,LTE497:
SmartAdmissionControl,LTE534:ARPAdmissionControl)

System impact
Interdependencies between features
Thefollowingfeatureshaveinterdependenciestothisfeature:

LTE496: Support of QCI 2, 3 and 4


LTE587isactivatedonlyifLTE496isactive.
LTE7: Support of multiple EPS bearers
LTE587isactivatedonlyifLTE7isactive.
LTE10: EPS bearers for conversational Voice
WithLTE587morethanoneQCI=1bearersperUEissupported.

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

Issue:01J

DN09185979

101

Descriptionsofradioresourcemanagementand
telecomfeatures

3.10.1.5

LTERL40,FeatureDescriptionsandInstructions

Management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table46:Newparameterslistsparametersintroducedwiththisfeature.
Table46

Newparameters

Full name

Abbreviated name

Managed object

ActivateMultipleGBRbearers

actMultGbrBearers

MRBTS/LNBTS

ActivateenhancedACandGBR
services

actEnhAcAndGbrServices

MRBTS/LNBTS

Table47:Modifiedparameterslistsparametersmodifiedwiththisfeature.
Table47

Modifiedparameters

Full name

3.10.1.6

Structure

Managed object

Resourcetype

resType

qcitab2,qcitab3,
qcitab4

MRBTS/LNBTS

Logicalchannelgroup
identifier

lcgid

qcitab2,qcitab3,
qcitab4

MRBTS/LNBTS

Sales information
Table48

102

Abbreviated name

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

3.10.2 Activating LTE587: Multiple GBR EPS Bearers per UE


Before you start
RestartoftheeNBisrequiredafteractivationofthisfeatureonlyiftheActivate
enhanced AC and GBR services(actEnhAcAndGbrServices)parameter
valueischanged.
TheActivate enhanced AC and GBR
services(actEnhAcAndGbrServices)andActivate multiple GBR
bearers(actMultGbrBearers)parametersareusedtoactivatethefeature.
Thefollowingsetsofparametersareusedtoperformanadditionalconfigurationofthe
feature:

TheQCI translation table QCI 2(qciTab2)parametersstructure.


TheQCI translation table QCI 3(qciTab3)parametersstructure.
TheQCI translation table QCI 4(qciTab4)parametersstructure.

Thefollowingfeaturesneedtobeactivated/configuredbeforeactivationofLTE587:
MultipleGBREPSBearersperUE:

LTE496:SupportofQCI2,3and4
LTE7:SupportofmultipleEPSbearers

Steps
Expected outcome
WhenthisfeatureisactivatedmorethanoneGBRbearercanbeestablishedforanyUE.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) Setthe Activate enhanced AC and GBR
services(actEnhAcAndGbrServices)parametervaluetotrue.
SettheActivate multiple GBR bearers(actMultGbrBearers)
parametervaluetotrue.

Issue:01J

Note: Thisstepactivatesthefeature.

DN09185979

103

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Expand the LNBTS object.


a) ExpandtheQCI translation table QCI 2(qciTab2)object.
b) SelecttheQCItranslationtableQCI2-1.
c) SetallparametersfromthestructuretodefinethetranslationoftheS1AP
parameterQCI2intoQCIcharacteristics.

Expand the LNBTS object.


a) ExpandtheQCI translation table QCI 3(qciTab3)object.
b) SelecttheQCItranslationtableQCI3-1.
c) SetallparametersfromthestructuretodefinethetranslationoftheS1AP
parameterQCI3intoQCIcharacteristics.

Expand the LNBTS object.


a) ExpandtheQCI translation table QCI 4(qciTab4)object.
b) SelecttheQCItranslationtableQCI4-1.
c) SetallparametersfromthestructuretodefinethetranslationoftheS1AP
parameterQCI4intoQCIcharacteristics.

3.10.3 Deactivating LTE587: Multiple GBR EPS Bearers per UE


Before you start
RestartoftheeNBisrequiredafterdeactivationofthisfeatureonlyiftheActivate
enhanced AC and GBR services(actEnhAcAndGbrServices)parameter
valueischanged.

Steps
Expected outcome
TheeNBcanestablishonyoneGBRbearerperUE.

Follow the general procedure described in section Activating and deactivating


LTE features using BTS Site Manager.
InStep3(Modify the feature-specific eNB configuration settings)ofthegeneral
procedureperformthestepsdescribedinthisprocedure.

104

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Go to the Radio Network Configuration page.


a) ExpandtheMRBTSobject.
b) SelecttheLNBTSobject.
c) SettheActivate multiple GBR bearers(actMultGbrBearers)
parametervaluetofalse.

Note: Thisstepdeactivatesthefeature.

3.11 Description of LTE736: CS Fallback to UTRAN


Introduction to the feature
PShandover-basedCSfallbackfromLTEtoUTRAN(WCDMA)formobile-originated
andmobile-terminatedcallsetupissupported.Thetargetcellselectionisbasedonfast
measurementsolicitation.

3.11.1 Benefits
Operator benefits
TheCScorenetworkinvestmentscanbereusedininitialphaseofLTE.TheCSFBmay
befurtherappliedinroamingscenarios.

3.11.2 Requirements
Software requirements
Table49:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table49

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

Issue:01J

DN09185979

105

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.11.3 Functional description


Functional overview
ThisfeatureintroducesafuncionalityforCSFallbacktoUTRANviaPSHO.
ItisassumedthattheeNBalreadysupportsPSHOtoWCDMAandthatthisfeatureis
activated.TargetfrequenciesforCSFBandPS-HOcanbedefinedindependently.Even
ifafrequencyisselectedforbothapplications,whitelistingoftargetcellswithinthis
frequencyisdoneseparately.Additionallytargetfrequencymightberestrictedper
SubscriberProfileIDvaluewithMobilityProfilesconfiguration.Mobile-originatedand
mobile-terminatedcallsetupissupported,forbothRRC_IDLEandRRC_CONNECTED
states.BlindHOisnotsupported,sotheeNBwilltriggermeasurementsbeforeCS
FallbacktoUTRAN.Thefeaturecanbeswitchedon/offintheeNBbyoperator.

3.11.3.1

CSFB to UTRAN
FromeNBpointofviewCSFallbacktriggerisreceivedfromMME.Dependingonfeature
activationandUEcapabilities,theeNBdecideswhichtypeofCSFallbackwillbe
performed.AlsopriorityofCSFallbackindicatorwillbetakenintoaccount:whenitisCS
FallbackHighPrioritythentheeNBwillhandlethecallasEmergencyCall,otherwiseit
willbehandledasanormalcall.WiththeLTE736:CSfallbacktoUTRANfeature,the
eNBchecksifB1measurementsaresupportedbytheUE.IftheUEsupportsB1event,
theeNBstartsmeasurementandadditionallysupervisiontimerforB1willbestarted,
otherwisetheeNBtriggersCSFallbackwithredirectiontoGERANorUTRANdepending
ontheconfiguration.WhentheUEprovidesB1measurementresultsbeforesupervision
timerexpires,theeNBselectssuitabletargetcelltakingintoaccountO&Mconfiguration
forCSFallbacktoUTRANwithPSHOtargets,MobilityProfiles(alreadytakeninto
accountduringMeasurementConfiguration),CSdomaininwhichUEisregisteredand
HandoverRestrictionList(thiswillnotbedoneforEmergencyCalls)andperformPSHO
(asspecifiedinLTE56:InterRATHandovertoWCDMAforHOtoWCDMA)tofirstcell
fromTargetCellList(withCSFBInformationindicationtoUEandMME).Incaseafterall
appliedrestrictionsTargetCallListisemptyorB1supervisiontimerexpired,theeNB
triggersCSFallbackwithredirectiontoGERANorUTRAN.IftheUEisnotsupporting
PSHOoriftheOperatorhasprohibittedPSHO,thentheeNBperformsCSFallback
withredirectionbasedonMeasurementsResults.
IfCSFallbackwithPSHOwasexecuted,butHandoverPreparationprocedurefailed,
theeNBtriesagainPSHOwithnextsuitablecellfromTCL.

3.11.3.2

CS-Fallback Mode and Target selection


Dependingonfeatureactivation,outputfromRRMHandoverAlgorithmandUE
Capabilities,theeNBdecideswhichtypeofCSFallbackwillbeused.Possiblemodes
are:

CSFallbackwithPSHOtoUTRAN
CSFallbackwithredirectiontoGERANorUTRAN

CSFallbackwithPSHOisonlypossible,iftheUEsupportsB1measurements,
otherwiseCSFallbackwithredirectionwillbeused.CellsprovidedbytheUE
measurementsassuitabletargetsmightbeexcludedfromTargetCellsListdepending
on:

106

OperatorconfigurationofCSFBsuitableUTRANtargetcells

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

3.11.3.3

Descriptionsofradioresourcemanagementand
telecomfeatures

MobilityProfilesconfiguration(alreadyduringmeasurements)
CSdomaininwhichtheUEisregistered(ifavailable)
HandoverRestrictionList(ifavailable)

New Managed Object Class (MOC)


LNRELW
TheLNCELparameteradjWInfListisreplacedbyinstancesofanewMOCLNRELW
(LTENeighborRELationtoWCDMAcell)subordinatetoLNCEL.Inadditionthe
cardinalityofWCDMAneighborrelationsisincreasedfrom32to256.

3.11.3.4

Licensing of CSFB to UTRAN


CSFBtoUTRANisanoptionalfeature.Whenenabled,itisactivatedforthewholeeNB.
Tokeepitactivated,alicensefortheeNBisrequired.Thelicensetypeison/off.The
licenseishandledbythemanagementsystem.
Ifactivated,theeNBtriestousePSHOtoUTRANwhenCSFallbackistriggered.To
handovertotheintendedUTRANtargetcell,theeNBconfigurestherespectiveUEto
measurespecificUTRANtargetcellssuitableforCSFallbacktoUTRANwithB1
measurement.Ifsuitablecellswillbefoundinmeasurements,theeNBtriggersPSHO
(includingCSFallbackinformationindicationtoUEandtargetRNC)tochosencell.
OtherwiseCSFallbackwithredirectionwillbeperformed.
Ifdeactivated,theeNBperformsCSFallbackwithredirection(dependingonLTE562:CS
Fallbackwithredirectionactivation).

3.11.3.5
3.11.3.5.1

User scenarios
Activation/Deactivation CS fallback to UTRAN
AneweNBlevelparameteractCsfbPsHoToUtraisintroducedtoactivateand
deactivatethefeature.
ThefeatureisactivatedbysettingtheLNBTSparameteractCsfbPsHoToUtrato
true.ThefeatureisdeactivatedbysettingtheLNBTSparameter
actCsfbPsHoToUtratofalse.
Theactivationofthisfeatureisonlyallowedif:

LTE562:CSFallbackwithredirectionisactivated
and
oneoffollowingisactive:

3.11.3.5.2

LTE56:InterRATHandovertoWCDMA
LTE898:TDDinter-RAThandovertoTD-SCDMA

and
LTE1441:CSFBto1XRTTisdisabled.

CSFB with a UE in RRC IDLE (Mobile originated and Mobile terminated)


Pre-condition

Issue:01J

DN09185979

107

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

UEisinIdlemodeandregisteredtoMSCforCScalls.
IncaseofMTC:RequestforCSservicewascomingtoMMEfromMSCwithPaging
RequestforspecificUEandMMEsendsPagingmessageviaeNBtowardstheUE.
IncaseofMOC:UserinitiatesCSvoicecallontheUE.
FeatureisenabledandproperlyconfiguredintheeNB.

Description

UEstartsInitialAccessprocedurewithExtendedServiceRequest.
MMEsendsInitial Context Setup RequestmessagewithCSFallback
IndicatortotheeNB.
TheeNBstartsMeasurementsforconfiguredUTRANtargetcellsandselectsa
targetbasedonMeasurementResults.
TheeNBperformsPSHOtoUTRANtochosentargetcell.
TheUEisinUTRANtargetcellandCScallisestablishedintargetsystem.

Post-condition
IftheUEwashandoveredfromLTEtoUTRANandCScallinthetargetUTRANcellin
ongoing(PSserviceiscontinuedinUTRANcellaswell).
Exceptions
Incasetherewasnosuitablecellfoundduringmeasurementsormeasurementswere
notperformedduetolackofUECapabilities,thentheeNBwilltrytouseCSFallback
withredirectiontoUTRANorGERANasconfiguredwithinLTE562:CSFallbackwith
redirection.

3.11.4 System impact


Interdependencies between features
LTE56:InterRATHandovertoWCDMA

ThisfeaturemustbeactivatedtoactivateLTE736:CSfallbacktoUTRAN.

LTE490:SubscriberProfileBasedMobility

LTE736:CSfallbacktoUTRANtakesMobilityProfilesintoconsiderationforselecting
UTRANtargetfrequenciesusedforCSFallbackwithPSHO.
ActivationofLTE490:SubscriberProfileBasedMobilityisoptionaltoactivate
LTE736:CSfallbacktoUTRAN.

LTE562:CSFallbackwithredirection

LTE736:CSfallbacktoUTRANwilluseredirectionmechanismspecifiedinLTE562:
CSFallbackwithredirectionwhenperformingPSHOtoUTRANwillnotbepossible.
ActivationofLTE562:CSFallbackwithredirectionismandatorytoactivateLTE736:
CSfallbacktoUTRAN.

LTE22:EmergencyCallshandling

Whenbothfeatures,LTE736:CSfallbacktoUTRANandLTE22:EmergencyCalls
handlingareactivated,thentheUEwithrequestforEmergencyCallcanuseCS
FallbacktoUTRANwithPS-HOifpossibleasspecifiedinthisfeature.

LTE898:InterRATHandovertoTD-SCDMA

108

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

ThisfeatureintroduceshandovertoTD-SCDMA.CSFallbacktoUTRANwilluse
proceduresspecifiedwithinLTE898.TheLTE898:InterRATHandovertoTDSCDMAfeaturemustbeactivatedtoactivatetheLTE736:CSFallbacktoUTRAN
feature.

LTE1441:CSFBto1XRTT

TheLTE1441:CSFBto1XRTTfeatureshallnotbeactivatedconcurrentlywiththe
LTE736:CSFallbacktoUTRANfeature.TheoperatordonotsupportCDMA1x
networkandWCDMA/GSMnetworkatthesametime.

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.11.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table50:Newcounterslistscountersintroducedwiththisfeature.
Table50

Counter ID
M8016C32

Newcounters

Counter name
CSFallbackattemptstoUTRANwithPS
Handover

Measurement
LTEInterSystemHandover
(WBTS)

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table51:Newparameterslistsparametersintroducedwiththisfeature.

Issue:01J

DN09185979

109

Descriptionsofradioresourcemanagementand
telecomfeatures

Table51

LTERL40,FeatureDescriptionsandInstructions

Newparameters

Full name

110

Abbreviated name

Managed object

ActivateCSfallbackwithPS-HOto
UTRA

actCsfbPsHoToUtra

LNBTS

FilteringcoefficientusedforCSFB
Cpich-Ecn0

filterCoefficientCSFBCpichEcn LNCEL
0

FilteringcoefficientusedforCSFB
Cpich-RSCP

filterCoefficientCSFBCpichRsc LNCEL
p

MeasurementquantityforUTRA-CSFB
FDDmeasurements

measQuantityCSFBUtra

LNCEL

ThresholdCSFBtoUTRA-WCDMAfor
EcN0neighborcell

b1ThresholdCSFBUtraEcn0

LNHOW

ThresholdCSFBtoUTRA-WCDMAfor
RSCPneighborcell

b1ThresholdCSFBUtraRscp

LNHOW

TimetotriggerUTRA-CSFB
measurementreport

b1TimeToTriggerCSFBUtraMe LNHOW
as

RelatedhysteresisofthresholdB1for
CSFBtoWCDMA

hysB1ThresholdCSFBUtra

LNHOW

MaximumnumberofCSFBtargetcells
perfrequency

maxNumCsfbTargets

LNHOW

CircuitswitchedfallbackwithPS
handoverallowed

csfbPsHoAllowed

LNRELW

WCDMAneighborrelationidentifier

lnRelWId

LNRELW

PrimaryPLMNidentityinCGIofUTRAN plmnId
neighborcell

LNRELW

TargetcellIdinUTRANCGIofrelated
neighborcell

uTargetCid

LNRELW

TargetRNCId

uTargetRncId

LNRELW

Frequencylayerlistforhighpriority
CSFBtoWCDMA

freqLayListCsfbHighWcdma

MODPR

Frequencylayerlistfornormalpriority
CSFBtoWCDMA

freqLayListCsfbNormWcdma

MODPR

Frequencylayerlistforhighpriority
CSFBtoWCDMA

freqLayListCsfbHighWcdma

MODR

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table51

Descriptionsofradioresourcemanagementand
telecomfeatures

Newparameters(Cont.)

Full name

Abbreviated name

Frequencylayerlistfornormalpriority
CSFBtoWCDMA

freqLayListCsfbNormWcdma

Managed object
MOPR

Table52:NewparametersforthePrimaryPLMNidentityinCGIofUTRANneighbor
celllistlistsnewparametersintroducedwiththisfeature.
Table52

NewparametersforthePrimaryPLMNidentityinCGIofUTRANneighbor
celllist

Full name

Abbreviated name

Managed object

Structure

MCCinprimaryPLMN
identityofneighboreNB

mcc

LNRELW

plmnId

MNCinprimaryPLMN
identityofneighboreNB

mnc

LNRELW

plmnId

MNClengthinprimary
PLMNofneighboreNB

mncLength

LNRELW

plmnId

Table53:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table53

Relatedexistingparameters

Full name

Abbreviated name

Managed object

NeighborWCDMABTScellidentifier

lnAdjWId

LNADJW

Targetfrequency

uTargetFreq

LNADJW

ActivateCSfallbackviaredirection

actCSFBRedir

LNBTS

ActivatehandoverfromLTEtoWCDMA

actHOtoWcdma

LNBTS

3.11.6 Sales information


Table54

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

DN09185979

111

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.12 Description of LTE843: ETWS broadcast


Introduction to the feature
WiththeLTE843:ETWSbroadcast,theeNBsupportsanEarthquakeandTsunami
WarningSystem(ETWS).Broadcastofprimaryandsecondarynotificationissupported
bythisfeature.

3.12.1 Benefits
Anemergencyinformationprovidedbylocalornationalgovernmentisbroadcastedas
fastaspossibletoalltheUEsthatareinactiveoridlemode.

3.12.2 Requirements
Software requirements
Table56:Softwarerequirementsliststhesoftwarerequiredforthisfeature.
Table55

Softwarerequirements

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table56

iOMS
OMS4.0

Softwarerequirements
UE

3GPPR9UE
capabilities

NetAct
OSS5.4CD2

MME
-

SAE GW
-

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.12.3 Functional description


ThepurposeoftheETWSistobroadcastemergencyinformationsuchasearthquakeor
Tsunamiwarningsprovidedbylocalornationalgovernmentssimultaneouslytomany
mobileterminalsasquicklyaspossible.ThewarningnotificationismappedonSystem
InformationBroadcast:SIB10/SIB11InformationElementsanditisbroadcastedtoall
activeandidleUEs
Thefollowingusecasesaresupported:

112

abroadcastofprimarynotificationasimmediatewarningaboutthreat,like
earthquakeand/ortsunami
abroadcastofsecondarynotificationsfordeliveringadditionalinformation,likewhere
togethelp
abroadcastofprimaryandsecondarynotification
astopdeliveringthenotification

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

WhentheeNBisconnectedtomultipleMMEs,thanthewarningmessagecancometo
allofthem.Inthiscase,theeNBchecksifthemessagesdonotoverlap.Inthiscase
onlyonewarningmessageisbroadcasted.FormoreinformationonmultipleMMEs,see
theLTE2:S1Flexfeaturedescription.
Theprocessofsendingthewarningmessageconsistsoftwosteps:
1. Sendingoftheprimary notification
Thenotificationisbroadcastedassoonaspossibletoallcampingandconnected
UEsunderthecoverageoftheeNB.Theprimarynotificationisbroadcasted(asnot
segmented)intheSystemInformationBlock10(SIB10).Thebroadcastdurationis
setbytheoperator,usingtheetwsPrimNotifBcDurparameter.
2. Sendingthesecondary notification
ThisisbroadcastedinSIB11andmightbesegmentedfortransmission.Theduration
iscalculatedbymappingtheWRITE-REPLACEWARNINGREQUEST(WRWR)
parametertotheLTESystemInformationBroadcastcharacteristics
ThewarningnotificationiscontainedintheWRITE-REPLACE WARNING REQUEST
messagereceivedbytheeNBfromtheePC(viaMME).AWRWRmessagecancontain
aprimaryand/orsecondarynotification.Thewarningnotificationmightbeupdated(when
WRWRmessagecontainsanewprimaryand/orsecondarynotification,andthe
notificationisbroadcasted).Inthatcase,anybroadcastednotificationsareabortedand
newnotificationsarebroadcasted.
TheeNBacknowledgesthebroadcastingbysendingtheWRITE-REPLACE WARNING
RESPONSEmessagebacktotheePC(viaMME).WithLTE2:S1Flexfeature,theeNB
acknowledgesalsodeliveryrequestspermessageitemwhilerequestedbymultiple
MMEs.
TheUEsareinformedaboutnewlyarrived/broadcastedwarningmessagesbymeansof
pagingincludingtheETWSnotificationbit.
WhentheLTE1755:MultipleemergencyareaspercellisactivatedinanEmergency
AreaIDmightbeusedinsignalingmessagesreceivedviaS1interfacetoindicatethe
setofcellsthathastheemergencyimpact.Inthiscase,theeNBparameter
pwsWithEmAreaIdindicatesiftheETWSusestheEmergencyAreaIDstoindicatein
theWRWRmessagewherecellsthewarningisbroadcasted.

IfaWarningMessageincludingEmergencyAreaIDsisreceivedbytheeNBandthe
parameterpwsWithEmAreaIdissettoFalse,thisWarningMessageisnot
broadcastedbytheeNB.
IfpwsWithEmAreaIdparameterissettoTrue,theconfigurationof
emAreaIdListEmergency area ID Listparameterisrequired.

WhentheWarningAreaListIEisincludedanditcontainstheCellIDlist/TrackingArea
IDlist/EmergencyAreaIDlist,thanthetransmittedETWSmessageisappliedtothe
eNBcell,inwhichthecorrespondingdataareinlinewiththeseincludedintheListofthe
receivedrequestmessage.
TheFigure8:TheETWSoverviewpicturepresentstheoverallfunctioningoftheETWS
messagetransmissionandreception.

Issue:01J

DN09185979

113

Descriptionsofradioresourcemanagementand
telecomfeatures

Figure8

LTERL40,FeatureDescriptionsandInstructions

TheETWSoverview

BC!sends!Warning!Message
to!all!MMEs!serving!the!warning
area;!for!example:
Warning!Message!(M-Identifier;
TAI2,!TAI5,!...)

Each!MME!distributes!the
Warning!Message!to!all!eNBs
serving!the!warning!area;
for!example:
S1AP:WRW-REQUEST
(M-Identifier;!TAI2,!TAI5,!...)

eNB!checks!which!cells!have!to
distribute!the!Warning!Message
and!initiates!sending!of!SIB
10/11/12
eNB!detects!duplicated
Warning!Messages (for
example!that!WM!from!MME1
is!identical!to!the!WM!received
earlier!from!MME2);
old Warning!Message!just
continues

eNB1

ENBC

eNB!sends!Warning!Message!out
on!BCCH!of!all!cells!belonging!to
the!Warning!area;
in!the!example!only!cells!with!TAI2
belong!to!the!Warning!Area
Used!SIBs:
ETWS:!SIB10/11
CMAS:!SIB12
cell1
(TAI1)

cell2
(TAI2)

MME1
cell3
(TAI2)

CBE/
CBC
eNB2

ENBC
MME2

3.12.3.1

cell1
(TAI2)

cell2
(TAI3)

cell3
(TAI4)

Related parameters
Emergency area ID
AnEmergencyAreaIDmaybeusedinsignalingmessagesreceivedviaS1interfaceto
indicatethesetofcellswhichhastheemergencyimpact(hastobroadcastthewarning
message).TheparameteremAreaIdidentifiestheEmergencyAreaIDoftheeNBcell.

3.12.4 System impact


Interdependencies between features
TheLTE843:ETWSbroadcastcannotbeactivated,whenthefollowingfeatureis
activatedinthesameeNB:

LTE494:CommercialMobileAlertSystem

ThefollowingfeaturecanbeusedtogetherwiththeLTE843:ETWSbroadcastfeature:

LTE1755:Multipleemergencyareaspercell
TheFlexiMultiradioBTSallowstoconfigureupto15emergencyareaIDspercellfor
CMASorETWS.TheemergencyareaIDsareusedtocheckifemergency
messagesneedtobebroadcastedinacell.

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.

114

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Impact on network and network element management tools


Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.12.5 LTE843: ETWS broadcast management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table57:Newcounterslistsexistingcountersrelatedtothisfeature:
Table57

Newcounters
Counter ID

Counter name

Measurement

M8000C39

NumberofWRITE-REPLACE
WARNINGREQUEST
messages

8000-LTES1AP

M8000C40

NumberofWRITE-REPLACE
WARNINGRESPONSE
messages

8000-LTES1AP

M8001C231

NumberofprimaryETWS
notifications

8001-LTECellLoad

M8001C232

NumberofsecondaryETWS
notifications

8001-LTECellLoad

M8008C16

NumberofRRCPagingsfor
ETWSorCMAS

8008-LTERRC

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table58:Newparameterslistsparametersintroducedwiththisfeature.
Table58

Newparameters
Full name

Issue:01J

Abbreviated name

Managed object

ActivationETWSsupport

actETWS

LNBTS

EmergencyareaIDList

emAreaIdList

LNCEL

ETWSprimarynotification
broadcastduration

etwsPrimNotifBcDur

LNBTS

PWSwithemergencyareaID

pwsWithEmAreaId

LNBTS

DN09185979

Structure

115

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

IfActivation ETWS support(actETWS)issettotrue,Activation CMAS


support(actCMAS)mustbesettofalse.
Table59

Modifiedparameters
Full name

Abbreviated name

Managed object

GERANfrequencyidlemodeconfigurationidentifier gfimId

GFIM

IRFIMidentifier

irfimId

IRFIM

Intrafrequencyidlemodeconfigurationidentifier

iafimId

IAFIM

SIwindowlength

siWindowLen

LNCEL

UtranFDDidlemodeconfigurationidentifier

uffimId

UFFIM

Systeminformationschedulinglist

sibSchedulingList

LNCEL

SystemInformation2Scheduling

sib2Scheduling

LNCEL

SystemInformation3Scheduling

sib3Scheduling

LNCEL

Periodicity

siMessagePeriodicity LNCEL

Table59:Modifiedparameterslistsparametersmodifiedbythisfeature.

3.12.6 Sales information


Table60

Salesinformation

BSW/ASW

License control in
network element

License control
attributes

ASW

SWAssetMonitoring

Activated by default
No

3.13 LTE872: SRVCC to WCDMA


Introduction to the feature
Singleradiovoicecallcontinuity(SRVCC)toWCDMAisalicense-basedfeaturethat
introducesahandover(HO)variantfromLTEtoWCDMAallowingcontinuityforvoice
calls.Avoicecall(includingemergencysession)inLTE,voiceoverIP(VoIP)usinga
QoSclassindicator(QCI)1bearer,mightbetransferredtowardsacallinthecircuit
switched(CS)domainofUMTSifSRVCCissupportedtowardsthetargetcellandifcore
network(CN)andtheuserequipment(UE)supportthisfeaturetoo.

3.13.1 Benefits
End-user benefits
SeamlesshandoverforvoiceservicestoWCDMAwhenleavingtheLTEcoverage.

3.13.2 Requirements
Software requirements
Table61:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

116

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table61

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.
Other requirements
Thisfeaturerequiresadditionallythat:

LTEandWCDMAnetworkareinthesamegeographicalarea.
LTERANisVoIP-capable.
LTERANandUTRANareconnectedwithanIPmultimediasubsystem(IMS)capableCN.

3.13.3 Functional description


ThegoalofthisfeatureistoprovidemechanismtoHOUEsthathaveaQCI-1bearer
(VoIP)activatedwhenchangingfromanLTEcelltoaWCDMAcell.Thevoicebearer,
whichisthesubjectofHO,isservedviatheCSdomainonWCDMAside.DuringHOtwo
differentscenariosarepossible:SRVCCcanbeexecutedwithorwithoutPS-HOsupport
dependingonthecapabilitiesofevolvedpacketcore(EPC)andtargetUTRAN.AllnonvoiceservicesarehandedovertothePSdomain.
TheselectionofWCDMAtargetlayersforSRVCCisindependentfromtheWCDMA
targetlayersusedforPS-HOtoWCDMA.

Note: TheoperatorhastospecifyseparatelythetargetfrequenciesforSRVCCand
PS-HO.Thesetwosetsoffrequenciesmaybedisjunctive,partlyoverlappingor
identical.TheselectionofoneofthesetwosetsdependsonthepresenceofanE-RAB
withQCI-1bearer.
IfPS-HOisexecutedtogetherwithSRVCC,SRVCCdeterminestheselectionoftarget
layers.ListofSRVCCtoWCDMATargetLayersiscalculated:
1. fromtheUE'sSubscriberProfileID(SPID)andtherelatedmanagedobjectclass
(MOC)MOPRparameterFrequency layer list for SRVCC to
WCDMA(freqLayListSrvccWcdma)ifSPIDisreceivedandknownindatabase,
otherwise
2. if Auto adaptation to freq. layers of all neighbour
cells(autoAdapt)flagissettotrue,allconfiguredWCDMAlayersareselected,
otherwise

Issue:01J

DN09185979

117

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3. fromtheMOCMODPRparameterFrequency layer list for SRVCC to


WCDMA(freqLayListSrvccWcdma)
ThefunctionalityisapplicableonlyforSRVCC-capablemultimodedevicessupporting
bothLTEandWCDMAatthecorrespondingfrequencyband.TheSRVCCcapabilityof
theUE(includingFGIbits)andthemobilitymanagemententity(MME)areachieved
withinthecontextoftheInitialContextSetupProcedure(formoredetailedinformation,
see3GPP36.413).Duringintra-LTEhandovertheSRVCCCapabilityIndicatoris
forwardedtothetargetevolvednodeB(eNB)eitherviatheS1AP:HANDOVER
REQUESTmessagebytheMMEorviatheX2AP:HANDOVERREQUESTmessageby
thesourceeNB.
IffrequenciesdonotdifferinMobilityProfilesetting,thehandoverprocedureitselfis
identicaltotheLTEtoWCDMAHO,thatisthesameneighborcellslist,measurements
andthresholdsareused.
TheeNBindicatestheMMEwiththeS1AP:HANDOVERREQUIREDmessagethat
SRVCCshouldbeinitiated.
ParameterActivate SRVCC to WCDMA(actSrvccToWcdma)isintroducedto
activateanddeactivatethisfeature.ItisdeactivatedbydefaultbecauseLTE872:SRVCC
toWCDMAisoptional.TosetactSrvccToWcdmatotrueActivate support of
conversational voice bearer(actConvVoice)and Activate handover
from LTE to WCDMA(actHOtoWcdma)alsoneedtobesettotrue.
IfthefeatureLTE872:SRVCCtoWCDMAisactivated,LTE1073:Measurementbased
redirecttoUTRANmustnotbeconfiguredtomoveallUEstoWCDMAbyredirect.
SRVCC HO
WhentheUErunsoutoftheLTEcoverage,eNBactivatesUEmeasurementsonthe
WCDMAfrequenciesconfiguredforSRVCC.ToknowwhichWCDMAcellssupportCSHOanew,optionalparameterSRVCC HO indication(SRVCC HO indication)
isintroduced.ThisparameterselectsifSRVCCtoaWCDMAtargetisperformedasa
combinedPSandCSSRVCCorwetherSRVCCisperformedfortheCSbeareronly.
ThisparameterisstoredintheeNB.

Note: TheHOcapabilityisinprincipleapropertyoftheUTRAN,however,no
informationisprovidedbystandardizedinterfaces.
Itisalsopossibletoallow/forbidSRVCCand/orPS-HOindividuallyperLTE-WCDMA
neighborrelation.Todefinethese
Single radio voice call continuity allowed(srvccAllowed)and
PS handover allowed(PS handover allowed)parametersareused.
WhentheUEreportsthatconditionsforHOtoWCDMAaremettheneNBinitiatesHO
proceduretowardsWCDMAindicatingtotheEPCtoapplySRVCCwithorwithoutPSHOsupport.EPCpreparesUTRANforanincomingdualmodeHO(incasePS-HOis
alsoneeded),whereastheVoIPbearerisconvertedtoanCS-VoicebeareronIu-CS.
TheremainingbearersaremappedonIu-PS.AfterthispreparationtheUEis
commandedtohandovertoUTRAN.
IftheUErunsoutoftheLTEcoverageandhasatleastoneemergencyVoIPbearer
(QCI=1)establishedthenHandoverRestrictionListprovidedbyMMEisignored.

3.13.4 System impact


Interdependencies between features

118

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Thisfeaturedependsonthefollowingfeatures:

LTE7:SupportofMultipleEPSBearerisapre-conditiontoestablishaVoIPbearer.
WithoutVoIPbearerSRVCCtoWCDMAisnotpossible.
LTE10:EPSBearersforConversationalVoiceisapre-conditiontoestablishaVoIP
bearer.WithoutVoIPbearerSRVCCtoWCDMAisnotpossible.
LTE56InterRATHandovertoWCDMAintroduceshandovertowardsWCDMA.
SRVCCtoWCDMAreusesproceduresspecifiedforandactivatedwiththisfeature.
ActivationofLTE56InterRATHandovertoWCDMAisaprerequisite.
LTE490SubscriberProfileBasedMobilitydefinesmobilityprofilestoselectspecific
subsetsoffrequencylayersasatargetforvariousmobilityfeatures.LTE872:
SRVCCtoWCDMAusesmobilityprofilestodefinetheWCDMAtargetfrequencies
usedforSRVCC.
OnlyincaseLTE490SubscriberProfileBasedMobilityisnotactivatedandno
defaultmobilityprofileisconfigured,eNBusesanyknownWCDMAfrequencyasthe
targetforSRVCC.
LTE507OptimizationofInterRATneighborschangestheobjectmodelforWCDMA
neighborcellobjectsandtheirrelationstoLTEcells.LTE507Optimizationof
InterRATneighborsdescribesamethodtoconfigurerequiredparametersfor
LTE872:SRVCCtoWCDMA,however,manualconfigurationofrequiredparameters
byoperatorisalsopossible.
LTE873:SRVCCtoGSMandLTE872:SRVCCtoWCDMAarecompetingfeatures
fordifferenttargetRAT.Bothmaybeactiveinparallel.Prioritizingisdoneby
measurementthresholds.
LTE1073MeasurementbasedredirecttoUTRANdescribesanalternativemethodto
sendUEinLTEactivemodetoUTRANbyUEContextReleasewithRedirect.
ThissolutionismainlyintendedforUEwhicharecapabletomeasureUTRANbut
notcapabletoperformPShandovertowardsUTRAN.However,thefeatureincludes
theoptiontosendallUEtoUTRANbyredirection,independentlywhetherthey
wouldbeabletoexecutePShandover.
ExecutingSRVCCandUEContextReleasewithRedirectforoneUEinparallel
wouldbeacontradiction.Therefore,theoptiontoprohibitPSHOtoWCDMAforall
UEisnotallowedifSRVCCisactivated.

Note: NotethattheUEwhichisSRVCCcapable,isalwayscapabletoperformPS-HO,
sonocontradictioncanoccurifredirectionisappliedonlyforUEsnotcapableofPSHO.
Impact on interfaces
Thisfeatureimpactsinterfacesasfollows:

S1-Interface
Theexistingmessages:

INITALCONTEXTSETUPREQUEST
HANDOVERREQUIRED
HANDOVERREQUEST

areextendedtosupportthenewIESRVCCOperationPossibleandSRVCCHO
Indication.
X2-Interface-theexistingmessagesHANDOVERREQUESTisextendedtosupport
newIESRVCCOperationPossible.

Impact on network and network element management tools

Issue:01J

DN09185979

119

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.13.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table62:Newcounterslistscountersintroducedwiththisfeature.
Table62

Counter ID

Newcounters

Counter name

Measurement

M8016C29

InterSystemHandoverattemptstoUTRAN
withSRVCC

8016-LTEInterSystem
Handover(WBTS)

M8017C11

InterSystemHandoverattemptstoUTRAN
withSRVCCperneighborcellrelationship

8017-LTEInterSystem
HandovertoUTRANper
NeighborCell(WBTS)

M8016C30

SuccessfulInterSystemHandover
completionstoUTRANwithSRVCC

8016-LTEInterSystem
Handover(WBTS)

M8017C12

SuccessfulInterSystemHandover
completionstoUTRANwithSRVCCper
neighborcellrelationship

8017-LTEInterSystem
HandovertoUTRANper
neighborCell(WBTS)

M8016C31

FailedInterSystemHandoverattemptsto
UTRANwithSRVCC

8016-LTEInterSystem
Handover(WBTS)

M8017C13

FailedInterSystemHandoverattemptsto
UTRANwithSRVCCperneighborcell
relationship

8017-LTEInterSystem
HandovertoUTRANper
NeighborCell(WBTS)

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table63:Newparameterslistsparametersintroducedwiththisfeature.

120

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table63

Descriptionsofradioresourcemanagementand
telecomfeatures

Newparameters

Full name

Abbreviated name

Managed object

ActivateSRVCCtoWCDMA

actSrvccToWcdma

LNBTS

SRVCCHOindication

srvccHoInd

LNADJW

Singleradiovoicecallcontinuityallowed srvccAllowed

LNRELW

FrequencylayerlistforSRVCCto
WCDMA

freqLayListSrvccWcdma

MODPR

FrequencylayerlistforSRVCCto
WCDMA

freqLayListSrvccWcdma

MOPR

Table64:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table64

Relatedexistingparameters

Full name

Abbreviated name

Managed object

NeighborWCDMABTScellidentifier

lnAdjWId

LNADJW

Targetfrequency

uTargetFreq

LNADJW

Activatesupportofconversationalvoice
bearer

actConvVoice

LNBTS

ActivatehandoverfromLTEtoWCDMA

actHOtoWcdma

LNBTS

WCDMAneighborrelationidentifier

lnRelWId

LNRELW

PrimaryPLMNidentityinCGIofUTRAN plmnId
neighborcell

LNRELW

PShandoverallowed

psHoAllowed

LNRELW

TargetcellIdinUTRANCGIofrelated
neighborcell

uTargetCid

LNRELW

3.13.6 Sales information


Table65

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

DN09185979

121

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.14 LTE873: SRVCC to GSM


Introduction to the feature
Singleradiovoicecallcontinuity(SRVCC)toGSMprovidesmechanismtohandover
(HO)userequipments(UEs),whichhaveaQoSclassindicator(QCI)-1bearer,voice
overIP(VoIP),activatedtoGSM.Thevoicebearerwhichisthesubjecttohandoveris
servedviathecircuitswitched(CS)-DomainonGERANside.

3.14.1 Benefits
End-user benefits
SeamlesshandoverforvoiceservicestoGSMwhenleavingtheLTEcoverage

3.14.2 Requirements
Software requirements
Table66:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table66

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
ThisfeaturerequiresthattheUEhas3GPPR8capabilitiesandsupportsLTEandGSM
attheaccordingfrequencyband.
Other requirements
Thisfeaturerequiresadditionallythat:

LTEandGSMnetworksareinthesamegeographicalarea(GSMhaswider
coverage).
LTEradioaccessnetwork(RAN)isVoIP-capable.
LTERANandGERANareconnectedwithanIPmultimediasubsystem(IMS)capablecorenetwork(CN).

3.14.3 Functional description


Functional overview

122

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

ThegoalofthisfeatureistoprovidemechanismtoHOUEsthathaveaQCI-1bearer
(VoIP)activatedwhenchangingfromanLTEcelltoaGERANcell.Thevoicebearer,that
isthesubjecttoHO,isservedviatheCSdomainonGERANside.SRVCCisalways
executedwithoutpacketswitched(PS)-HOsupport(itmeansthatestablishednon-voice
bearersarenothandedovertoGSM).Dependingonthedualtransfermode(DTM)
capabilitiesoftheUEandthetargetGERAN,twodifferentscenariosarepossible:
resourcescanbeeitherre-establishedviaroutingareaupdate(RAU)(theoperator
configurableswitch)orsuspendedaslongastheUEremainsinGERAN.
TheselectionofGSMtargetlayersforSRVCCisindependentfromtheGSMtarget
layersusedfornetwork-assistedcellchange(eNACC).
ThefunctionalityisonlyapplicableforSRVCC-capablemultimodedevicessupporting
bothLTEandGSMatthecorrespondingfrequencyband.TheSRVCCcapabilityofthe
UE(includingFGIbits)andthemobilitymanagemententity(MME)areachievedwithin
thecontextoftheInitialContextSetupProcedure(formoredetailedinformation,see
3GPP36.413).DuringintraLTEhandovertheSRVCCCapabilityIndicatorisforwarded
tothetargetevolvednodeB( eNB)eitherviatheS1AP:HANDOVERREQUEST
messagebytheMMEorviatheX2AP:HANDOVERREQUESTmessagebythesource
eNB.
Figure9:MessageflowduringSRVCChandovershowswholeSRCVCCHOprocess.
Figure9

MessageflowduringSRVCChandover
Source
eNB

UE

Target
BSS

MME

S-GW

SDSN

P-GW

UL&DLPayloadPDUs
1.Decisiontoperform
SRVCCtoGSM
TS1RELOCprep

3.HandoverPreparation
TS1RELOCoverall

Handover
Execution

4.S1AP:HANDOVERCOMMAND

Handover
Preparation

2.S1AP:HANDOVERREQUIRED

5.RRC:MOBILITY
FROMEUTRAN

UL&DL PayloadPDUs
7.S1AP:CONTEXTRELEASECOMMAND

Handover
Completion

6.Detach fromoldcellandcompletehandovertoGERAN

8.S1AP:CONTEXTRELEASECOMPLETE

Handover trigger
TheSRVCCisanetworkcontrolledhandoverwithsupportoftheUE.Thefollowing
measurementeventsareused:

Issue:01J

A1-deactivateinter-radioaccesstechnology(IRAT)measurements
A2-activateIRATmeasurements
B2-IRATmeasurements

DN09185979

123

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

ThemeasurementseventsA2andA1areusedtostartandstopIRATmeasurements
andtheyareconfiguredbytheoperator.TheeNBtriggersIRATmeasurementsonlyif
theUEhasaevolvedpacketsystem(EPS)bearerwithQCI=1establishedandtheMME
andtheUEareSRVCCcapable.
Theoperatorshouldconfigure:

thetargetcellsfortheIRATmeasurements
blacklistingoftargetcells
themeasurementconfigurationsuchas:

sourcecellthresholds(RSRP)
targetcellthresholds(RSSI)
hysteresis
timetotrigger
speed-dependentscaling

MoreinformationabouttheconfigurationcanbefoundinLTE442:NetworkAssistedCell
ChangetoGSM.
TheUEcapabilitiesareconsideredforthesetupoftheIRATmeasurementconfiguration,
thatissupportofmeasurementgapandsupportoffrequencybands.
Handover preparation
TheeNBinitiatesaHO(afterreceivingameasurementreportformtheUE)bysending
theS1AP:HANDOVERREQUIREDmessagewiththeSRVCCHOindicationtothe
MME.
TheeNBreceivestargetcelllist(TCL)indicatedbytheUEmeasurementsforthe
handover.AllcellsintheTCLarecheckedandthoseofthem,whichmeetatleastoneof
thefollowingconditionsaredeleted:

TheconfigurationtablefortheGERANneighborcellsdoesnotlisttheGERANcell
asapplicableforSRVCC.
ThefrequencybandoftheGERANcellisnotlistedasGERANSRVCCtarget
frequencyintheMobilityprofileapplicabletothespecificUE.
NeithertheServingPLMNoftheUEnoroneoftheUEsequivalentPLMNslistedin
theHandoverRestrictionList(whichwasoptionallyprovidedbyMME)issupported
intheGERANTargetCell.
ThecombinationofPLMN-IdentityoftheGERANtargetcellandLACoftheGERAN
targetcelliscontainedintheHandoverRestrictionListprovidedbytheMME.
HandoverRestrictionlistcontainstheIEForbiddeninterRATswhichissettoALL,
GERAN,orGERAN and UTRAN.
Note: MobilityprofileapplicabletotheUEisselectedaccordingtoSPIDif
LTE490:SubscriberProfileBasedMobilityisactivated.If
LTE490:SubscriberProfileBasedMobilityisnotactivatedbutaDefaultMobilityProfile
isdefined,thisDefaultMobilityProfileisapplied.

AfterTCLrevision,theeNBtakesthefirsttargetcellfromTCLfortheHO.TheHO
RestrictionListisnotevaluatedifthevoicebearerisforanemergencyservice.
TheMMErespondstothiswithaS1AP:HANDOVERCOMMANDmessageindicating
thattheresourcesatthetargethavebeenreserved.

124

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Handover execution
WhenS1AP:HANDOVERCOMMANDmessageisreceived,theeNBsendsa
RRC:MobilityfromEUTRAcommandtotheUE,whichforcestheUEtoaGSMcell(see
step5.inFigure9:MessageflowduringSRVCChandover).
TheSRVCCfunctionalitycanbeenabled/disabledpercellviaoperationand
maintenance(O&M)
Handover scenario
TheUEisattachedtotheLTEnetworkandhasaVoIPbearer(QCI=1)establishedin
LTEinparalleltoatleastonePSbearer.FromtheInitialContextSetupitisknownthat
boththeUEandtheevolvedpacketcore(EPC)areSRVCCcapable.WhentheUEruns
outoftheLTEcoverage,eNBactivatesUEmeasurementsontheGSMfrequencies
configuredforSRVCC.TheGERANmeasurementparametersforSRVCCtargets,
exceptARFCN Value List,areidenticaltothatonesfromLTEtoGERANeNACC.In
themeasurementobjectthesameNCC permitted bitmap(nccperm)andinreport
configurationsthesamethresholds,hysteresis,timetotrigger,andintervalareused.

Note: ARFCN Value List(arfcnValueListGERAN)togetherwiththe


Band indicator applied to reference ARFCN(bandindicator)definea
GERANfrequencybandtobemeasured.TheoperatorspecifiesMobilityProfilesfor
eNACCandSRVCCseperately.ThesesetsofGERANbandsmaybedisjunctive,partly
overlappingoridentical.
WhentheUEreportsthattheconditionsforHOtoGSMaremet,eNBinitiatesHO
proceduretowardsGSMindicatingtotheEPCtoapplySRVCCwithoutPS-HOsupport.
IftheUEorGERANtargetsystemdoesnotsupportDTMinGERAN,theeNBindicates
totheEPCthattheUEisnotavailableforPSservice,andthenEPSperformsbearer
splittingandsuspendsallremainingPSbearers(whentheUEsupportsDTM,theeNB
doesnotindicatetotheEPCthattheUEisnotavailableforPSservice,theEPS
performsbearersplitting,andPSbearersarenotsuspended).ThenextstepwhichEPC
performsisthepreparationofGERANviaMSCServerforanincomingCS-HO,whereas
theVoIPbearerisconvertedtoanCS-Voicebearer.AtthismomentoftimetheUEis
commandedtohandovertoGERAN.
IftheUEinGERANisDTMcapable,afterHOcompletion,itperformsRAUtoestablish
thePSbearers(whichcouldnotbeestablishedtogetherwiththeCS-HO)viageneral
packetradioservice(GPRS)usingDTM.
IftheUEGERANcapabilitiesdoesnotsupportDTM,whenCSCallisfinished,theUE
triggersRAUandthenEPCresumessuspendedPSbearers.TheUE'sEUTRAN
capabilitiesindicatetheUE'sGERANDTMCapabilitiesonlyfrom3GPPRel'9onwards,
sotheeNBconsiders3GPPRel'8UEsalwaysasnotDTMcapable.

Note: ItdependsonGERANimplementation/configurationwhetherRAUisexecuted
viaGERANortheUEisredirectedtoanotherRAT.
DuringanIMSemergencycalltheeNBdoesnotrestrictGERANmeasurementsfrom
activationintheUEifthecorrespondingcarrierfrequencyisassignedtotheSRVCC
targetlistintheSubscriberProfileID(SPID)mobilityprofileusedbytheUE.
Figure10:SRVCChandoverscenarioshowsSRVCCHOscenariooftheUEwhich
supportsDTMinGERAN.

Issue:01J

DN09185979

125

Descriptionsofradioresourcemanagementand
telecomfeatures

Figure10

SRVCChandoverscenario
Source
E-UTRAN

UE

LTERL40,FeatureDescriptionsandInstructions

Target
MSC

MSCServer
/MGW

Source
MME

1.Measurementreports

Target
SGSN

Target
BSS

Core

SGW/PGW

IMS

GERAN

2.DecisionforHO
3.HandoverRequired
(UEavailableforPSintargetcell)
4.BearerSplitting
5a.PStoCSReq
6.PrepHO
7.HOReq/Ack
8.PrepHOResp

DLflowofvoice
DLflowofvoice
Packetisswitched
Packetisswitched
towardstheCS
towardstheCS
accessleg
accessleg

9.Establishcicuit

STARTPS
interruption

10.InitiationofSessionTransfer(STN-SRorE-STN-SR)

IMS

13.PStoCSResp
LastUL/DLdata

11.Sessiontransferand
Updateremoteleg

14.Handover
Command

12.ReleaseofIMS
Accessleg

15.HOfromE-UTRAN
Command
16.UEtunesto
GERAN
17.HODetection

19.HOComplete
20.SES
(HOComplete)
21.Answer
ULspeechcircuitis
connectedthrough
inMSCserver

22.PStoCScomplet/Ack

23a.TMSIReallocation
23b.UpdateLoc

24.SubscriberLocationReport

HSS/
HLR
GMLC

25.RAUinsideGPRS,PSBearersreestablishment

STOPPS
interruption

3.14.4 System impact


Interdependencies between features
Thisfeaturedependsonthefollowingfeatures:

126

LTE7:SupportofMultipleEPSBearerisapre-conditiontoestablishaVoIPbearer.
WithoutVoIPbearerSRVCCtoGSMisnotpossible.
LTE10:EPSBearersforConversationalVoiceisapre-conditiontoestablishaVoIP
bearer.WithoutVoIPbearerSRVCCtoGSMisnotpossible.
LTE490:SubscriberProfileBasedMobilitydefinesmobilityprofilestoselectspecific
subsetsoffrequencylayersasatargetforvariousmobilityfeatures.LTE873:
SRVCCtoGSMusesmobilityprofilestodefinetheGSMtargetfrequenciesusedfor
SRVCC.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

OnlyincaseLTE490:SubscriberProfileBasedMobilityisnotactivatedandno
defaultmobilityprofileisconfigured,eNBusesanyknownGSMfrequencyasthe
targetforSRVCC.
LTE784:ANRInterRATGERANprovidesamethodtoderiveGERANneighborcell
configurationautomaticallyfromGERANdatabase.Thederivedconfigurationsmay
beusedbyLTE873:SRVCCtoGSM.
LTE442:NetworkAssistedCellChangeToGSMandLTE873:SRVCCtoGSMare
competingfeaturestoaccessGSM(eNACCtoGSMisnoprerequisiteforSRVCCto
GSM).Bothmaybeactiveinparallel.Selectionismadedependentontheactual
bearercombination.
LTE872:SRVCCtoWCDMAandLTE873:SRVCCtoGSMarecompetingfeatures
fordifferenttargetRAT.Bothmaybeactiveinparallel.Prioritizingisdoneby
measurementthresholds.

Impact on interfaces
Thisfeatureimpactsinterfacesasfollows:

S1-Interface
Theexistingmessages:

INITALCONTEXTSETUPREQUEST-transferandevaluationofGERAN-CS
capabilities
HANDOVERREQUIRED:newHOType"LTEtoGERAN",targetIDcodedfor
GERANcells,sourcetotargettransparentcontainercodedaccordingtothe
definitionofsourcebasestationsystem(BSS)totargetBSStransparent
container(codingaccordingtoGERANspecification),supportofMSclassmark2
andMSclassmark3,supportofIE"PSServiceNotAvailable",extensionofthe
sourceeNBtotargeteNBtransparentcontainerandthesourceRNCtotarget
RNCtransparentcontainertoforwardGERAN-CScapabilitiesincaseofintraLTEHOorHOtoWCDMA
HANDOVERCOMMAND:newHOtype"LTEtoGERAN",targettosource
transparentcontainercodedaccordingtothedefinitionoftargetBSStosource
BSStransparentcontainer
HANDOVERREQUEST:transferandevaluationofGERAN-CScapabilities

X2-Interface-theexistingHANDOVERREQUESTmessageisextendedtosupport
newIESRVCCOperationPossible.
Air-Interface

RRCmessageMOBILITYFROMEUTRANCOMMANDisextendedtosupport
"purpose"HOwith"targetRAT-Type"GERAN.
RRCmessagesUECapabilityEnquiryandUECapabilityInformationareextended
tosupportGERAN-CScapabilities.

Impact on network and network element management tools


Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeatureinfluencesinterruptiontimeforvoicebearers,seeFigure10:SRVCC
handoverscenario.
Thisfeaturehasnoimpactonsystemcapacity.

Issue:01J

DN09185979

127

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.14.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table67:Newcounterslistscountersintroducedwiththisfeature.
Table67

Newcounters

Counter ID

Counter name

Measurement

M8016C33

InterSystemHandoverattemptstoGERAN 8016-LTEInterSystem
withSRVCC
Handover(WBTS)

M8019C3

InterSystemHandoverattemptstoGERAN 8019-LTEInterSystem
withSRVCCperneighbourcellrelationship HandovertoGSMper
NeighbourCell(WBTS)

M8016C34

SuccessfulInterSystemHandover
completionstoGERANwithSRVCC

8016-LTEInterSystem
Handover(WBTS)

M8019C4

SuccessfulInterSystemHandover
completionstoGERANwithSRVCCper
neighbourcellrelationship

8019-LTEInterSystem
HandovertoGSMper
NeighbourCell(WBTS)

M8016C35

FailedInterSystemHandoverattemptsto
GERANwithSRVCC

8016-LTEInterSystem
Handover(WBTS)

M8019C5

FailedInterSystemHandoverattemptsto
GERANwithSRVCCperneighbourcell
relationship

8019-LTEInterSystem
HandovertoGSMper
NeighbourCell(WBTS)

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table68:Newparameterslistsparametersintroducedwiththisfeature.
Table68

Newparameters

Full name

Abbreviated name

Managed object

DTMcapability

dtm

LNADJG

ActivateSRVCCtoGSM

actSrvccToGsm

LNBTS

128

DN09185979

Structure

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table68

Descriptionsofradioresourcemanagementand
telecomfeatures

Newparameters(Cont.)

Full name

Abbreviated name

Managed object

TimerT304forInterRATGSM

t304InterRATGsm

LNCEL

Supervisiontimerforhandover
preparationtoGSM

tS1RelPrepG

LNBTS

Structure

Singleradiovoicecallcontinuityallowed srvccAllowed

LNRELG

ReferencefreqlistforSRVCCtoGSM

refFreqListSrvccGsm

MODPR

Bandindicatorappliedtoreference
ARFCN

bandIndicator

MODPR

ReferenceARFCN

referenceARFCN

MODPR

endofstructure

ReferencefreqlistforSRVCCtoGSM

refFreqListSrvccGsm

MOPR

structure

Bandindicatorappliedtoreference
ARFCN

bandIndicator

MOPR

ReferenceARFCN

referenceARFCN

MOPR

structure

endofstructure

Table69:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table69

Relatedexistingparameters

Full name

Abbreviated name

Managed object

ARFCNvalueGeran

arfcnValueGeran

LNADJG

ARFCNvaluelist

arfcnValueListGERAN

LNHOG

Activatesupportofconversationalvoice
bearer

actConvVoice

LNBTS

PLMNidentityinCGIofGERAN
neighborcell

plmnId

LNRELG

MCC

mcc

LNRELG

MNC

mnc

LNRELG

MNClength

mncLength

LNRELG

Locationareacode

lac

LNRELG

Cellidentity

ci

LNRELG

Issue:01J

DN09185979

Structure

structure

endofstructure

129

Descriptionsofradioresourcemanagementand
telecomfeatures

Table69

LTERL40,FeatureDescriptionsandInstructions

Relatedexistingparameters(Cont.)

Full name

Abbreviated name

Managed object

NeighbourGERANBTScellidentifier

lnAdjGId

LNADJG

GERANneighborrelationidentifier

lnRelGId

LNRELG

Structure

3.14.6 Sales information


Table70

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.15 Description of LTE984: GSM Redirect with System


Information
Introduction to the feature
TheCSfallbackwithredirecttoGSMaswellastheregularredirecttoGSMisenhanced
bysysteminformation.

3.15.1 Benefits
Operator benefits
Thecallsetuptimerespectivelytheserviceinterruptiontimeisimprovedincomparison
toabasicredirectsolution.

3.15.2 Requirements
Software requirements
Table71:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

130

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

DN09185979

OMS

OMS4.0

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table71

Descriptionsofradioresourcemanagementand
telecomfeatures

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.15.3 Functional description


Functional overview
ThisfeatureintroducesadditionalfuncionalityforCSFallbackwithRedirectionto
GERAN(LTE562:CSFallbackwithredirection),Emergencycallshandling(LTE22:
EmergencyCallshandling)andUEContextReleasewithRedirection(LTE423:RRC
ConnectionReleasewithRedirect).WiththisfeaturetheeNBprovidesSystem
InformationforGERANcellsinsideredirectionmessage.Thisreducestimeneededto
accesstargetGERANcell,inwhichCSservicewillbeperformed,astheUEwillnot
needtoreadSIBsfromairinterfacetoaccesstargetcell.Thecellselectionalgorithmin
theUEisnotinfluencedbyprovidingtheGERANsysteminformation,forexamplethe
UEdoesnotpreferGERANcellsforwhichsysteminformationhasbeenprovided.The
featurecanbeswitchedon/offintheeNBbytheoperator.

3.15.3.1

CSFB to GSM with system information


CSFallbackwithredirectiontoGSMwithsysteminformationisenhancingcurrent
behaviorwithrespecttoredirectionmessage(usedbothforCSFallbackandUEContext
Release)whentargetsystemisGERAN.Newfuncionalitywillallowincludingin
redirectionmessage(RRC: Connection Release)systeminformationofGERAN
cellsconfiguredforchosenGERANfrequencyband,forwhichsupportinredirection
messageisallowedbyoperatorconfiguration.
BysettingtherequiredO&Mparameter,theoperatorcandecideforwhichmobilitytype
GERANSIBswillbeaddedtoredirectionmessage(canbesettoCSFBonly,UE
ContextReleaseonlyorboth).CSFallbackistriggeredbyMMEasspecifiedinLTE562:
CSFallbackwithredirection,EmergencyCallsandhandlingasspecifiedinLTE22:
EmergencyCallshandlingandRRCConnectionReleasewithredirectionasspecifiedin
LTE423:RRCConnectionReleasewithRedirectinMOCREDRT.LTE984:GSMredirect
withsysteminformationusesthesametargetsasspecifiedinthesethreefeatures
mentionedaboveinMOCREDRTorincorrespondingMobilityProfile(MORED)/Default
Profile(MODRED)instanceintroducedintheLTE490:SubscriberProfileBasedMobility
feature.
Additionally,theoperatorcanspecifyperGERANrelationship(MOCLNRELG)ifthe
systeminformationisprovidedforthisGERANcellinredirectionmessageornot.The
systeminformationforGERANcellcanoptionallybeconfiguredandstoredinMOC
LNADJG.Furthermore,itispossiblethattheGERANsysteminformationisnotprovided
byO&Mconfiguration.IfnoSIsareavailable,thenredirectionwithoutSIstochosen
GERANfrequencybandwillbeperformed.

Issue:01J

DN09185979

131

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

ThesysteminformationinredirectionmessageisprovidedonlyiftheUEindicatedinUE
Capabilities,thatitiscapableofenhancedredirectiontoGERAN.TheeNBalsochecks
RegisteredLAIIEifprovidedbyMMEandexcludecells(SIs)notmatching
RegisteredLAI.ItwillbeexcludedonGERANneighboringcellbasis,soifGERAN
neigboringcellisnotmatchingRegisteredLAIthenSIforthiscellwillnotbeaddedto
redirectionmessage.IfnoSIsareavailable,thenredirectionwithoutSIstochosen
GERANfrequencybandwillbeperformed.TheeNBwilladditionallyallowupto16
numbersofSIsincludedinredirectionmessage.Iftheoperatorhasspecifiedmore
SystemInformationtobeincluded,thentheeNBwilluseonly16valuesandotherswill
beignored.TheeNBalsochecksHandoverRestrictionList,ifprovidedbyMME.This
checkisnotnecessaryincaseofemergencycalls(LTE22:EmergencyCallshandling).
IncaseforbiddenRATsaresettoallorincludeGERAN,thenredirectiontoGERANwill
notbepossible.

3.15.3.2

Licensing of CSFB to GSM with system information


CSFBwithredirectiontoGSMwithsysteminformationisanoptionalfeature.When
enabled,itisactivatedforthewholeeNB.
Ifactivated,theeNBtriestoaddsysteminformationtoredirectionmessagetoGERAN
targetRATsystem,usedforCSFallbackwithredirectionorUEContextReleasewith
redirection.IfnosuitableSystemInformationforGERANcellsareconfiguredthenCS
Fallbackwithredirection/UEContextReleasewithredirectionwillbeperformedwithout
includedSystemInformation.
Ifdeactivated,theeNBperformsCSFallbackwithredirection(dependingonLTE562:CS
FallbackwithredirectionorLTE423:RRCConnectionReleasewithRedirectactivation
andconfiguration).

3.15.3.3
3.15.3.3.1

User scenarios
Activation and configuration CS Fallback with redirection to GSM with
system information
Pre-condition

Atleastoneoffollowingfeatureshastobeenabled:LTE423:RRCConnection
ReleasewithRedirectorLTE562:CSFallbackwithredirectionorLTE22:Emergency
Callshandling.
AtleastoneobjectforredirectiontoGSMhasbeencreatedintheLTEcell:the
REDRTorrespectiveMobilityProfileforredirectionwhentheLTE490:Subscriber
ProfileBasedMobilityfeatureisactivatedandmappingsforSPIDareprovided.
AtleastoneGERANneighborcell(LNADJGobject)hasbeencreated.

Description

132

OperatorhastoenablethefeaturebysettingcorrespondingO&Mflag
actGsmRedirWithSIonBTSleveltotrue.
OperatorhastodecideforwhichtypeofmobilityGERANSIBswillbeaddedto
redirectionmessage:CSFBonly,A2basedredirectiononly,orboth.The
addGsmSIToRedirMsgisresponsibleparameteronselectedredirectionobject.
ThisparameterisneedinallREDRTobjectswiththeredirRATparametersetto
geran.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

IftheLTE490:SubscriberProfileBasedMobilityfeatureisactivatedandMOREDor
MODREDobjectswithredirRATsettogeranarecreated,theMORED
respectivelyMODREDparameteraddGsmSIToRedirMsghastobesettoo.
OperatorshouldprovideindicationwhichknownGERANtargetcellssystem
informationcanbeincludedinredirectionmessage(the
redirWithSysInfoAllowedisresponsibleparameter).
SelectionofGERANneighborcellswhichshallprovidesysteminformationGERAN
neighborcellsareselectedforeachLTEcellbysettingthe
redirWithSysInfoAllowedparameterinaccordingLNRELGobject(s)to
allowed.ForthoseGERANcellstheoptionalLNADJGparameters
systemInfoTypeandsystemInfoListGeranmustbeset.
ifsysteminformationisnotconfiguredinLNADJG,theoperatorhastoconfigureit
usingthesystemInfoListGeranparameter.

WithsuchpreparedconfigurationplanfiledownloadedtotheeNBLTE984:GSMredirect
withsysteminformationwillbeactivatedintheeNBsoftware.

3.15.3.3.2

Performing CS Fallback with redirection to GSM with system information


Pre-condition

ThefeatureLTE984:GSMredirectwithsysteminformationisenabled.
CSFallbackrequestwasreceivedfromMME.
OperatorconfiguredtheeNBthatGERANSIBscanbeaddedtoCSFBtoGERAN,
seeActivationandconfigurationCSFallbackwithredirectiontoGSMwithsystem
information.

Description

TheeNBdecidestoperformCSFallbackwithredirectiontoGERANsystem.
TheeNBbuildsRRC: Connection Releasemessagewithredirectiontowards
GERANsystemwithincludedsysteminformationforGERANcellsthatwere
configuredbyoperatorandsendsredirectionmessagetoUE.
TheUEaccessestargetGERANcellwithoutaneedtoreadallsysteminformation
fromairinterface,butreusesthosereceivedfromtheeNB.

Post-condition

TheUEwasredirectedfromLTEtoGERANandCSserviceinthetargetGERANcell
canbeperformed.

3.15.4 System impact


Interdependencies between features
LTE562:CSFallbackwithredirection
Thereisnorealinterdependency.Ifbothareactivatedthen,LTE562:CSFallbackwith
redirectionisenhancedwithLTE984:GSMredirectwithsysteminformationbehaviorfor
CSFallbackwithredirectiontoGERAN.WhenbothLTE984:GSMredirectwithsystem
informationandLTE562:CSFallbackwithredirectionareactivated,thentheUEcanuse
CSFallbacktoGERANwithsysteminformationasspecifiedinthisfeature.Activationof
LTE562:CSFallbackwithredirectionisoptionaltoactivateLTE984:GSMredirectwith
systeminformation.

Issue:01J

DN09185979

133

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

LTE423:RRCconnectionreleasewithredirect
IfLTE984:GSMredirectwithsysteminformationisactivatedthen,LTE423:RRC
connectionreleasewithredirectisenhancedwithLTE984:GSMredirectwithsystem
informationbehaviorforredirectiontoGERAN.WhenbothLTE984:GSMredirectwith
systeminformationandLTE423:RRCconnectionreleasewithredirectareactivated,
thentheUEcanuseUEContextReleasewithredirection(duetocoverage)withsystem
informationasspecifiedinthisfeature.ActivationofLTE423:RRCconnectionrelease
withredirectisoptionaltoactivateLTE984:GSMredirectwithsysteminformation.
LTE22:EmergencyCallshandling
WhenbothLTE984:GSMredirectwithsysteminformationandLTE22:EmergencyCalls
handlingareactivated,thentheUEwithrequestforEmergencyCallcanuseCS
FallbacktoGERANwithsysteminformationasspecifiedinthisfeature.Activationof
LTE22:EmergencyCallshandlingisoptionaltoactivateLTE984:GSMredirectwith
systeminformation.
Impact on interfaces
ThisfeatureimpactstheUuinterfaces.TheRRC:CONNECTION RELEASEmessageis
extendedtocarryGERANSYSINFO.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeatureimpactssystemperformanceandcapacity.Thedelayrequiredbysystem
informationreadingbytheUEintheotherRATissignificantlyreducedandthee2ecall
setuptimeforMOCandMTCwillbereducedaccordingly.

3.15.5 Management data


Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table72:Newparameterslistsparametersintroducedwiththisfeature.
Table72

Newparameters

Full name

Abbreviated name

ActivateGSMredirectwithsystem
information

134

actGsmRedirWithSI

DN09185979

Managed object
LNBTS

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table72

Descriptionsofradioresourcemanagementand
telecomfeatures

Newparameters(Cont.)

Full name

Abbreviated name

Managed object

Redirectwithsysteminformation
allowed

redirWithSysInfoAllowed

LNRELG

AddGSMsysteminformationto
redirectionmessage

addGsmSIToRedirMsg

MODRED

AddGSMsysteminformationto
redirectionmessage

addGsmSIToRedirMsg

MORED

AddGSMsysteminformationto
redirectionmessage

addGsmSIToRedirMsg

REDRT

Table73:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table73

Relatedexistingparameters

Full name

Issue:01J

Abbreviated name

Managed object

SysteminfolistGERAN

systemInfoListGeran

LNADJG

ActivateCSfallbackviaredirection

actCSFBRedir

LNBTS

Activateemergencycallviaredirection

actEmerCallRedir

LNBTS

EnableUEcontextreleasewithredirect

actRedirect

LNBTS

CellIdentity

ci

LNRELG

LocationAreaCode

lac

LNRELG

PLMNIdentityinCGIofGERAN
neighborcell

plmnId

LNRELG

MCCinprimaryPLMNidentityof
neighboreNB

mcc

LNRELG

MNCinprimaryPLMNidentityof
neighboreNB

mnc

LNRELG

MNClengthinprimaryPLMNof
neighboreNB

mncLength

LNRELG

RATforredirection

redirRAT

MODRED

RedirectionpriorityforCSfallbackwith
redirection

csFallBPrio

MODRED

DN09185979

135

Descriptionsofradioresourcemanagementand
telecomfeatures

Table73

LTERL40,FeatureDescriptionsandInstructions

Relatedexistingparameters(Cont.)

Full name

Abbreviated name

Managed object

RedirectionpriorityforUEcontext
release

redirectPrio

MODRED

Redirectionpriorityforemergencycall

emerCallPrio

MODRED

RATforredirection

redirRAT

MORED

RedirectionpriorityforCSfallbackwith
redirection

csFallBPrio

MORED

RedirectionpriorityforUEcontext
release

redirectPrio

MORED

Redirectionpriorityforemergencycall

emerCallPrio

MORED

RATforredirection

redirRAT

REDRT

RedirectionpriorityforCSfallbackwith
redirection

csFallBPrio

REDRT

RedirectionpriorityforUEcontext
release

redirectPrio

REDRT

Redirectionpriorityforemergencycall

emerCallPrio

REDRT

3.15.6 Sales information


Table74

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.16 LTE979: IRC for 2 RX paths


Introduction to the feature
Theinterferencerejectioncombining(IRC)improvesmainlyforhighlyloadedand
interferencelimitedcellstheuplinkperformanceofcelledgeusersandslightlyincreases
theuplinkcellcapacity.

3.16.1 Benefits
End-user benefits
WithIRCabetteruplinkcellperformancecanbeachieved.

136

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Operator benefits
Thesameasfortheend-userbenefits:withIRCabetteruplinkcellperformancecanbe
achieved.

3.16.2 Requirements
Software requirements
Table75:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

Table75

OMS4.0

Softwarerequirements

UE
n/a

OMS

NetAct
OSS5.4CD2

MME
-

SAE GW
-

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.16.3 Functional description


Functional overview
InterferenceinadedicatedcellintheULcanoccure.g.fromUEswithadifferentserving
cell.Othersourcesofinterferencemaybespuriousemissionsofothertechnologies
(GSM,WCDMA,..)Assumingthereareonlyafewdominantinterferers,IRCisaquite
goodapproachtosuppressthistypeofinterference.Thebasicruleofthumbisthatthe
numberofRXantennas-1dominantinterfererscanbesuppressed.Thismeans,for2
RXantennasonedominantinterferercanbesuppressed.Thisisonlyaroughrating
sincealsointerferencefrommoreuserscanbesuppressedbutthesuppressorgainwill
decreaseveryrapidly.
Ifontheotherhandthenumberofinterferersishigh,thentheinterferencestartstolook
likeGaussiannoiseandisnolongerfavorableforIRC.
SupportingIRCismainlyaRL1(radiolayer1)issue.IRCisonlyappliedtothePUSCH
(physicaluplinksharedchannel).AllotherchannelsandsignalslikePUCCH(physical
uplinkcontrolchannel),SRS(soundingreferencesignal)andPRACH(physicalrandom
accesschannel)donotapplyIRC.

Note: IRCfor2RXpathsperformsbestwithGPSsynchronizationwhereallcellsare
timelyaligned(synchronized),eventhecellsbelongingtodifferenteNBs.
IRCwith2RXpathsshowsreducedgainifthereisnospecialsynchronization
mechanism(e.g.GPS)forcellsbelongingtodifferenteNBs.

Issue:01J

DN09185979

137

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

Thefollowingtwofigures(Figure11:BLER(SINR)forSDI,EPA30,Figure12:BLER
(SINR)forSDI,ETU70)showthegainofIRCincomparisontoMRC(maximalratio
combining)inamatlab-simulation.BotharedoneforaSDI(singledominantinterferer).
TheBLER(blockerrorrate)istheratiooferroneousblocksagainstthetotalnumberof
blocks.SINRisthesignaltointerferenceandnoiseratio.ItisplottedattheX-axisindB.
TwoITU-definedfadingscenariosareconsidered:

EPA30:(enhancedpedestrian)
ETU70:(enhancedtypicalurban)

Conclusion:ThebestcurvesforSDIinbothfiguresshowtheIRC-method.
Figure11

138

BLER(SINR)forSDI,EPA30

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure12

Descriptionsofradioresourcemanagementand
telecomfeatures

BLER(SINR)forSDI,ETU70

3.16.4 System impact


Interdependencies between features
Thefollowingfeatureshaveinterdependenciestothisfeature:

LTE80:GPSSynchronization:Aphasesynchronizedairinterfaceisrequiredto
achievemaximumperformanceoftheIRCreceiver.
LTE134:TimingoverPacket:TheLTE134TimingoverPacketfeatureoffersonly
frequencysynchronizationanddoesnothelpforIRC.
LTE899:AntennalineSupervision:ThefeatureLTE899:AntennalineSupervision
offersbrokenantennalinedetection.IncaseoneoftheRxantennalinesgetsbroken
andtheeNBL1receivesonlyGaussianNoisefromthisantennaline,theIRCisable
tocontinueitsoperation.

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Sofar,notknown.

Issue:01J

DN09185979

139

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

3.16.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersintroducedwiththisfeature.

3.16.6 Sales information


Table76

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.17 LTE1014: X2 eNB Configuration Update


Introduction to the feature
WiththisfeatureLTE1014:X2eNBConfigurationUpdatetheeNBupdatesan
establishedX2link.UpdatesarecarriedoutviatheX2eNBConfigurationUpdate
procedure.
TheX2linkistheinterfacebetweentwodifferenteNodeBs(Figure13:Overviewof
interfaces).TheX2interfaceisforexampleneededfor,

Intra-LTEhandover
MMEconfigurationchanges

TheX2eNBConfigurationUpdateprocedureprovidesconfigurationinformationofthe
owneNBtotheneighboreNBinordertosupporthandoverviaX2.
TheeNBConfigurationUpdateprocedureallowstheupdateoftheX2-linkconfiguration
datawithoutrestartoftheX2-link.UE-associatedsignalingconnectionswhichmightbe
availableontheX2-linkarenotimpactedbytheprocedure.

140

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure13

Descriptionsofradioresourcemanagementand
telecomfeatures

Overviewofinterfaces

UTRAN

PDN

3G-SGSN

S3

MME

S1-MME

S4
S11

eNodeB

X2
LTEUu

UE

eNodeB

S1-U

Mobilityanchorfor
intra-LTEhandovers

S-GW

Mobilityanchorfor
intra-3GPPhandovers
(SGSNrel.8)

S5/S8

P-GW

Mobilityanchorfor
non-3GPPhandovers
(and3GPPhandoversviaSGSNrel.<8)

U-planedatapath

3.17.1 Benefits
End-user benefits
Thisfeaturebenefitstheenduserbyassuringhighermobilityrobustness.
Operator benefits
LTE1014: X2 eNB Configuration Update featureenablesautomaticalignmentofX2
linkconfigurationdatawithoutimpactingongoingtelecomprocedures(forexampleX2
handover).TheeNBautomaticallygetsconfigurationinformationaboutcellsservedby
eNBandofrelevantMMEconfigurationdata.

3.17.2 Requirements
Software requirements
Table77:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

Issue:01J

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

DN09185979

OMS

OMS4.0

141

Descriptionsofradioresourcemanagementand
telecomfeatures

Table77

LTERL40,FeatureDescriptionsandInstructions

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.17.3 Functional description


Functional overview
ThepurposeoftheX2eNBConfigurationUpdateprocedureistoupdateapplication
levelconfigurationdataneededfortwoeNBstointeroperatecorrectlyovertheX2
interface.TheX2eNBConfigurationUpdateprocedureisappliedforanavailableX2link
asdefinedin[3GPP36.423].ItwillbetriggeredbytheeNBifrelevantconfiguration
information,whichwastransmittedearliertoapeereNB,haschanged(seeTriggering
conditions).
Figure14

X2eNBConfigurationUpdate-successfulprocedure

RespondingeNB

InitiatingeNB

ENBCONFIGURATIONUPDATE

ENBCONFIGURATIONUPDATE
ACKNOWLEDGE

X2eNBConfigurationUpdateprocedureispresentedinFigure14:X2eNB
ConfigurationUpdate-successfulprocedure.Theprocedureconsistsoftwosteps:

142

TheinitiatingeNBtransfersitsmodifiedconfigurationinformationtotheresponding
eNBviatheX2AP:ENBCONFIGURATIONUPDATEmessage.
TherespondingeNBstoresthemodifiedconfigurationinformationoftheinitiating
eNBandreportssuccessfulstorageoftheinformationbysendingX2AP:ENB
CONFIGURATIONUPDATEACKNOWLEDGEmessagebacktotheinitiatingeNB.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure15

Descriptionsofradioresourcemanagementand
telecomfeatures

X2eNBConfigurationUpdate-failedprocedure

RespondingeNB

InitiatingeNB

ENBCONFIGURATIONUPDATE

ENBCONFIGURATIONUPDATE
FAILURE

Note: IftherespondingeNBcannotaccepttheupdateitwillrespondwithENB
CONFIGURATIONUPDATEFAILUREmessage(
Figure15:X2eNBConfigurationUpdate-failedprocedure).Insuchcasetheinitiating
eNBwillenforcerepetitionofX2setuptoaligntheX2configurationdata.
Triggering conditions
ConfigurationchangesthattriggerX2eNBConfigurationUpdateprocedurefallintotwo
groups:S1link-relatedchanges,andcell-relatedchanges.Tworelevantcasesare
presentedbelow.
1. X2 eNB Configuration Update due to cell-related changes
Thefollowingcell-relatedeventswilltriggerX2eNBConfigurationUpdateprocedure:

ThelistofPLMNIDssupportedbytheeNBcellismodified

IftheprocedureistriggeredbythisofeventX2APCONFIGURATIONUPDATEmessage
mayinclude,respectively:

IEthatlistsexistingcellsforwhichconfigurationhasbeenmodifiedandcomplete
informationabouttheircurrentconfiguration.

2. X2 eNB Configuration Update due to S1link-related changes


ThefollowingS1-relatedeventswilltriggerX2eNBConfigurationUpdateprocedure:

S1setupresultinginanewMMEpool
MMEConfigurationUpdateresultinginaneworremovedMMEpool
closingofS1linkresultinginremovedMMEpool

IftheprocedureistriggeredbyoneoftheseeventsX2APCONFIGURATIONUPDATE
messagewillincludealistofGUGroupIDstoaddordelete.

3.17.4 System impact


Interdependencies between features
ThisfeaturemodifiestriggeringconditionsoftheX2Setupprocedureemployedby
LTE654:LTEConfigurationManagementtocreateanX2link.Priortotheintroductionof
LTE1014: X2 eNB Configuration Update featuretheeNBhadtotriggertherepetitionof
X2SetupproceduretoupdateconfigurationdataofanestablishedX2linkinthepeer

Issue:01J

DN09185979

143

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

eNB.WithLTE1014: X2 eNB Configuration UpdatefeaturetheeNBwillnolongeruse


theX2SetupprocedureandwillstarttheX2eNBConfigurationUpdateprocedure
instead.
Impact on interfaces
TheLTE1014:X2eNBConfigurationUpdatefeatureintroducesthreeadditionalX2AP
interfacemessages:

ENBCONFIGURATIONUPDATE
ENBCONFIGURATIONUPDATEACKNOWLEDGE
ENBCONFIGURATIONUPDATEFAILURE

Impact on network and network element management tools


TheLTE1014:X2eNBConfigurationUpdatefeatureallowstheeNBtopersistentlystore
informationreceivedthroughtheX2eNBConfigurationUpdateprocedureandinform
NetActandBTSSiteManageraboutchangedconfigurationvianotification.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.17.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

3.17.6 Sales information


Table78

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

3.18 LTE1073: Measurement based redirect to UTRAN


Introduction to the feature

144

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

Thisfeatureprovidesanextendedpacket-switchedmobilityfunctionforUEssupporting
IRATmeasurementsbutnoPShandover.
LTE1073:MeasurementbasedredirecttoUTRANprovidesthemeanstosendanUEto
WCDMAbyUE Context Release with RedirectaftertheUEhasperformed
measurementsonWCDMA.Measurementconceptsandconfigurationforhandoverto
WCDMAarereused.

3.18.1 Benefits
Operator benefits
HigherreliabilityforLTEtoUTRANservicecontinuity.

3.18.2 Requirements
Software requirements
Table79:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table79

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.18.3 Functional description


Functional overview
ThefeatureLTE1073:Measurementbasedredirectisspecifiedasanenhancementto
LTE56:InterRATHandovertoWCDMA.AfterthetriggertohandovertoWCDMAis
receiveditisdecidedwhetheraclassicalhandovertoWCDMAaccordingtoLTE56:Inter
RATHandovertoWCDMAisappliedoraUE Context Releaseaccordingto
LTE1073:Measurementbasedredirect.ThefeatureLTE1073:Measurementbased
redirectisactivatedtogetherwithLTE56:InterRATHandovertoWCDMA.Thereisno
separateactivationand/orlicensingneeded.ThefeatureLTE1073:Measurementbased
redirecttoUTRANcanbeusedincontextwiththefeatureLTE736:CSfallbackto
UTRAN.
AsthefeatureLTE872:SRVCCtoWCDMAandthefeatureLTE1073:Measurement
basedredirecttoUTRANmaynotbeappliedtothesameUEinparallel,theoperator
mustnotprohibitPS-HOforallUEsifhehasactivatedSRVCCtoWCDMA.

Issue:01J

DN09185979

145

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

AsthisfeatureisanenhancementofLTE56:InterRATHandovertoWCDMAthemain
extensionsare:

WCDMAmeasurementsareconfiguredforallUEswhicharecapableofmeasuring
WCDMAnotonlyforUEwhicharecapableofperforminghandovertoWCDMA.
WhenmobilitytoWCDMAistriggeredbyUEmeasurementtheeNBdecideswhether
toexecuteahandoverorUEContextReleasewithredirectconsideringUE
capabilitiesandOperatorconfiguration.
ProcedureforUEContextReleasewithredirectisappliedbyselectingthe
redirectiontargetfrompreviouslyreceivedmeasurements.

Measurement-basedredirecttoUTRANiscomposedoffunctionsavailablefromthe
featuresLTE56:InterRATHandovertoWCDMAandLTE423RRCConnectionRelease
withRedirect.InthefirststepoftheproceduremeasurementsofWCDMAareperformed
exactlyinthesamewayasspecifiedforHandovertoWCDMA.Thecomplete
configurationforWCDMAmeasurements(includingallparametersandtheMobility
Profiles)isreusedfromLTE56:InterRATHandovertoWCDMA.Measurementsare
performedcommonlyforbothfeatures.TheonlyextensionisthecheckforUE
capabilities.Evaluationofmeasurementresultsandtargetcellselectionarethenagain
executedcommonlyforbothfeaturesincludingtheconsiderationofeverytargetcell
restrictiondefinedforLTE56:InterRATHandovertoWCDMA.Thetriggertostart
HandovertoWCDMAisnowmoregenerallyinterpretedasatriggertosendtheUEto
WCDMA.NowtheeNBdecideswhethertheUEissenttoWCDMAbyhandover
accordingtotheexistingfeatureLTE56:InterRATHandovertoWCDMAorbyUE
Contextrelease.IfeitherUEisnotabletoperformPShandoverortheOperatorhas
prohibitedPShandoverbyO&Mconfiguration,UEContextReleaseisperformed.Inthe
finalstepoftheLTE1073:MeasurementbasedredirectprocedureUEContextRelease
withredirectisexecutedasalreadydefinedforLTE423:RRCConnectionReleasewith
Redirect.Differencesarethat:

RedirectistriggeredbyUEmeasuringtheeventB2oftheWCDMAtargetfrequency
insteadofA2measuringtheeventontheservingLTEfrequency.
RedirectiontargetistakenfromthereportedWCDMAfrequencyoftheB2report
insteadfromaOperatorconfiguredparameter.
ThecheckoftheUEcapabilitiesfortheredirectiontargetcanbeskippedastheUE
hasalreadymeasuredthetarget.

WiththenewparameterProhibit PS-HO to WCDMA(Table80:Newparameters)


theoperatercanforceallUEs(independentoftheircapabilitytoperformPS-HO)togoto
WCDMAbyUE Context Release with Redirectmessage.

3.18.3.1

Use case
AnOperatorhasdeployedanLTEnetworkandaWCDMAnetworkinthesame
geographicalareawhereastheWCDMAnetworkprovidesawidercoveragethanthe
LTEnetwork.
Pre-Condition
OperatorhasenabledthefeatureHandovertoWCDMAineNB.AUEisattachedtoan
LTENetworkandtheUEiscapableofmeasuringWCDMA.TheUEisnotcapableof
performinghandovertoWCDMAortheOperatorhasprohibitedhandovertoWCDMA.
Description

146

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

TheUErunsoutoftheLTECoverageandtheeNBactivatestheUEmeasurementson
WCDMAfrequencies.TheUEreportsthattheconditionsforahandovertoWCDMAare
met.TheeNBtriggerstheUEContextReleasewithredirectiontotheWCDMA
frequency,reportedbytheUE.TheUEleavesLTEandperformscellselectionandRRC
ConnectionSetupinWCDMA
Post-Condition
TheUEisattachedtoUTRAN.

3.18.4 System impact


Interdependencies between features

LTE56:InterRATHandovertoWCDMA
TheLTE1073:Measurementbasedredirectisspecifiedasanenhancementto
LTE56:InterRATHandovertoWCDMA.AfterthetriggertohandovertoWCDMAis
receiveditisdecidedwhetheraclassicalhandovertoWCDMAaccordingtoLTE56:
InterRATHandovertoWCDMAisappliedoraUEContextReleaseaccordingto
LTE1073:Measurementbasedredirect.LTE1073:Measurementbasedredirectis
activatedtogetherwithLTE56:InterRATHandovertoWCDMA.Thereisnoseparate
activationand/orlicensing.
LTE423:RRCConnectionReleaseWithRedirect
TheLTE423:RRCConnectionReleaseWithRedirectproceduretoredirectanUEto
WCDMAisreused.
LTE736:CSfallbacktoUTRAN

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

3.18.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table80:Newparameterslistsparametersintroducedwiththisfeature.

Issue:01J

DN09185979

147

Descriptionsofradioresourcemanagementand
telecomfeatures

Table80

LTERL40,FeatureDescriptionsandInstructions

Newparameters

Full name

Abbreviated name

Managed object

Thisparameterenablesthefeature
HandoverfromLTEtoWCDMA

actHOtoWcdma

LNBTS

ProhibitPS-HOtoWCDMA

prohibitPsHOtoWcdma

LNBTS

3.18.6 Sales information


Table81

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

3.19 LTE1387: Intra eNodeB inter-frequency load


balancing
Introduction to the feature
TheLTE1387:IntraeNodeBinter-frequencyloadbalancingfeatureprovidesmeansto
moveload(intermsofairinterfaceusage)tocellsofanotherfrequency/bandwithinthe
sameeNodeB.
Therefore,multi-frequencysupportingUEsarehandedovertoanintra-eNBneighborcell
oftheotherfrequency/band.
Thefollowingconditionmustbefulfilled:

thesourcecellisinactiveloadbalancingstate(aftertheloadhavingexceededthe
highloadthreshold)
atleastoneofthepotentialtargetcellshasavailablecapacity
theUEreportssufficientRSRP(referencesymbolreceivedpower)andRSRQ
(referencesignalreceivedquality)forthetargetcell
theparametersfittothisfeature,onlyUEswithoutQCI1bearerarehandedover

3.19.1 Benefits
End-user benefits
Theloadbalancingimprovestheintra-eNodeBairinterfaceresourcesdistribution.It
leadstoabetteroverallairinterfaceuse.Theavailablebitratefornon-GBRservicesis
increased.
Operator benefits
TheairinterfacesresourcesincaseofadualbandLTEdeploymentsareoptimallyused.

148

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

3.19.2 Requirements
Software requirements
Table82:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table82

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

3GPPR8

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

3.19.3 Functional description


Functional overview
Thefeaturecanbedividedinto4basicblocks:
1. Load Supervision and Exchange
Ifthefeatureisswitchedon(actInterFreqLBparametersettotrue)eachcell
measuresandcalculatesconstantlytheloadforloadtypesGBRDLandnon-GBRDL.If
onetypeoftheloadexceedsthehighloadthreshold,thecellenterstheactiveinterfrequencyloadbalancing(iF-LB)state.Iftheactualloadofallloadtypesbecomeslower
thantargetloadthresholds,thecellleavesagaintheactiveiF-LBstate.
Actualloadsituation(availablecapacity(AC)perloadtype)isexchangedbetweenall
cellsoftheeNBwithaperiodicityofiFLBLoadExchangePeriod.Ifacellisbarred,it
reportsallAC=0.Thismeansallincomingloadbalancinghandoversinacellare
rejected.Outgoingloadbalancinghandoverswillnotbebarred.
Thenon-GBRloadperTTIiscalculatedbasicallyasfollows:
LoadnonGBRdl = min
(t)

NomNumPrbNonGbr * max(0.01;avActDLnonBearerWeightSum)
avAvailPrbDLNonGbr

;1 * 100%

Themin()andmax()functionsservetodealwithborderlinecases.Withoutthese
functionsandfordatasampledforasingleTTI,thisformulabasicallyreads:
LoadnonGBr(TTI)=nomNumPrbNonGbr*sum(weightsofactivenon-GBRbearers)/
numOfPrbsAvailableToNonGbr
where:

Issue:01J

ThenumOfPrbsAvailableToNonGbrisobtained,perTTI,from:

DN09185979

149

Descriptionsofradioresourcemanagementand
telecomfeatures

150

thenumberofPRBsinthesystem,dependingonthesystembandwidth(50
PRBsfora10MHzsystem)
minusthenumberofPRBsusedforSIB,broadcast,pagingandsoon
minusthenumberofPRBsusedforHARQretransmissions(irrespectiveof
whateverserviceclassortypetheinitialtransmissionbelongsto)
minusthenumberofPRBsthatwereallocatedtoGBRtraffic.Ifdataisinthe
buffersbuttheUEisnotavailable(DRXsleep,measurementgap)

Thesum(weightsofactivenon-GBRbearers)term,inthefollowingshortenedto
sumOfWeightsaddsup,pereachTTI,theweightsofnon-GBRbearersthathave
data(forinitialtransmissions)intheirbuffers.Thismeans:

LTERL40,FeatureDescriptionsandInstructions

Anon-GBRbearerdoesnotcontributetothenon-GBRloadfigureifitis
establishedbuthasnodatainitsbuffer.Inthatcasethebearerissaidtobe
inactive.Italsodoesnotcontributetothenon-GBRloadfigure,afterthefirst
transmissionofapacket(whichdoescontributetotheloadfigure),furtherHARQ
retransmissionsarerequiredforcorrecttransmission.HARQretransmissionsdo
notcount.
Anon-GBRbearercontributestothereportingofnon-GBRloadtoasmall
degreeifithasfewoccurrencesofincomingdata(andthereforeappearsin
candidateset2(CS2)onlyrarely),anditsbufferisemptiedfast.Therefore,the
bearersweightcontributestothesumofweightsonlyrarely,perhapsonlyonce
pereachoccurrenceofincomingdataifthedataistransferredrightatthefirst
attempt(orwithHARQretransmissionsthereof).
CS2isaselectionofUEswhichismadebythepacketschedulerineachTTI.
ForfurtherdetailsseetheFAD:PacketScheduler.
Anon-GBRbearercontributestothereportingofahighnon-GBRload,ifitis
presentinCS2moreoften.Thismeansthateitherthereisaconstantingressof
dataforthisbearer,orthisbearer'sbufferisnotemptied.ThishappensiftheUE
isdroppedfromCS2,oronlyother,higherprioritizedbearersofthisUEwere
served.AnentrythatwasdroppedfromCS2inoneTTIwillbepresentina
subsequentTTIagainbecausethereasonforenteringCS2stillexists.
Therefore,thebearer'sweightisaddedtothesumOfWeightsmoreoften,andin
consequence,theaverageloadreadingincreases.NotethatpresenceofaUEin
CS2isnotaconditionforconsideringitsbearers.
Furthermore,anon-GBRbearercontributestothereportingofahighnon-GBR
loadifonlyfewresourcesareleftovertonon-GBRtraffic.Iftheschedulerruns
outofresources,serviceswithlowerprioritycannotbeserved,otherCS2entries
(orotherbearersofthesameUE)takeprecedenceandmoreandmoreUEswith
bearerswithlowerweightsaredroppedfromCS2.
Andanon-GBRbearercontributesalsotothereportingofahighnon-GBRload,ifdataisinthebuffersbuttheUEisnotavailable(DRXsleep,measurement
gap).

Thenon-GBRloadisinsomewayameasureoftheoverallloadinthecell,because
theGBRloadalsoentersintothenon-GBRloadfigurebymeansofthenumberof
PRBsthatareleftovertononGBRtraffic,afterHARQ,systemservicesandGBR
bearershavebeenserved.So,itispossibletoget100%non-GBRloadbyhaving
many/high-weighingbearersactiveand/orbyleavingonlyafewPRBsforanynonzerovalueofsumOfWeights
NonGbrLoadversusThroughput
Thecell'snonGBRloadvalueisindependentoftheactualthroughputachievedbya
nonGBRbearer:iftheeNBisabletoquicklyemptythebuffersofwhatevervolumeof
dataissuppliedfromtheremoteendoftheconnection,thebearer'sweightonly

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofradioresourcemanagementand
telecomfeatures

rarelyentersintotheloadcalculation.Conversely,ifthebearercarriesjustasmall
trafficvolumebuttheeNBcannotemptyitsbuffer,thebearer'sweightwilladdtothe
loadinahighernumberofTTIs.Thiscanalsobeinterpretedbyseeingthe
sumOfWeights(ofbearerswaitingtogetserviced)asameasureofthedemand(for
nonGBRtraffic),whilethenumberofPRBsavailablefornonGBRtrafficrepresents
thesupply(ofnonGBRtrafficresources),whichfinallyallowstheinterpretationload=
(scalingfactornomNumPrb)*demand/suppliedResourcesthatisadoptedfornonGBRtraffic.
Thebearersschedulingweights(parameterscheduleWeight forQCI5,QCI6,
...QCI9)seeinthefeaturedescriptionLTE9:ServiceDifferentiation.Operatorscan
configurescheduleWeightsfortheexistingbearersandalsocanaddnewweightsfor
operator-definedQCIclasses.Changingtheseweightsalsochangesthe
sumOfWeightsandthereforechangestheloadthatmustbereachedbeforeload
balancingstarts.

TheloadNonGBRcanreach100%atmaximum,thenthecellwillrejectfurtherincoming
loadhandoversandACbecomes0.
TheGBRloadcomponentiscalculatedfromtheaveragednumbersof

PRBsallocatedtoGBRtraffic
PRBsavailableforGBRtraffic(afterSIB,HARQ,etc.):

loadGbrDl=avPrbGbr/avAvailPrbGbr.
2. Candidate UE Selection
Ifthefeatureisswitchedon(actInterFreqLBparametersettotrue),foreachUE
thatmakesanidle-to-activetransitionatimerisstarted(iFLBBearCheckTimer).The
timerstartswhenS1APsendsbackInitialContextSetupResponse.Whenthetimer
expires,theowncellsloadandtheloadofthepotentialtargetcellsischecked.Ifown
cellisinactiveiF-LBstateandatleastonepotentialtargetcellhasallloadtypesAC>0,
theUEmightbehandedovertothebesttargetcellif:

TheUEhasnoQCI1bearer(ifIFLBBearCheckTimer=specialvalue:NotUsed(=
31),theQCI1bearercheckisomitted.
TheUEsupportsotherfrequencylayerandA4reporting.
Nointer-frequency/inter-RATmobilityHOmeasurementsareongoingforthisUE.

Ifallconditionsaremet,theUEmeasurestheradioconditionsofthetargetcells.
3. Measurement Solicitation

Issue:01J

TheUEisreconfiguredtodoA4measurements(inclusivemeasurementgaps;
Smeasure=0)anddeliveronereport.
Thisconfigurationandthefollowingactionsaretimersupervised
(reportTimerIFLBA4).
Thereportispost-processedinthesensethatforthereportedtargetcellsRSRP
(referencesymbolreceivedpower)andRSRQ(referencesignalreceivedquality)are
checkedifminimumrequirementsaremet.
Onlypotentialtargetcellsareconsidered.
OnlytargetcellswithallAC>0(availablecapacity)areconsidered.
Iftherearemorethanonecellsleftinthetargetcelllist,theyareorderedaccording
theirAC(availablecapacity).

DN09185979

151

Descriptionsofradioresourcemanagementand
telecomfeatures

LTERL40,FeatureDescriptionsandInstructions

IfnoA4reportisreceivedorthereportedcellsarenotusable,theUEisrereconfiguredtothemeasurementconfigurationbeforetheiF-LBattemptassoonas
thesupervisiontimer(reportTimerIFLBA4)expires.
IftheUEstartsinter-frequency/inter-RATmobilityHOmeasurements,theUEisrereconfiguredtothemeasurementconfigurationbeforetheiF-LBattempt.

4. If-LB Execution
Ifallconditionsarefulfilled,aregularHOtothebesttargetcellisexecuted.

3.19.4 System impact


Interdependencies between features
ThefeatureLTE55:Inter-frequencyhandoverisaprerequisiteforthisfeature.
ThefeatureLTE490:Subscriberprofilebasedmobilityisappliedontheloadbalancing
targetfrequencycarriersasalreadysupportedforthenormalinter-frequencyHOtargets.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Duetobetterresourceutilizationthesystemcapacityisenhanced.

3.19.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table83:Newparameterslistsparametersintroducedwiththisfeature.

152

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table83

Descriptionsofradioresourcemanagementand
telecomfeatures

Newparameters

Full name

Abbreviated
name

Managed
object

InterFreqloadbal
thresholdforRSRP
targetfilter

thresholdRsrpIFL
BFilter

LNHOIF

InterFreqloadbal
thresholdforRSRQ
targetfilter

thresholdRsrqIFL
BFilter

LNHOIF

Activationofinter
frequencyload
balancing(iFLB)

actInterFreqLB

LNBTS

InterFreqloadbalload
exchangeperiodicity

iFLBLoadExchang LNBTS
ePeriod

Structure

InterFreqloadbal
reportTimerIFLBA LNBTS
supervisiontimerforA4 4
event
InterFreqloadbalload
thresholds

Issue:01J

iFLBLoadThreshol LNCEL
ds

InterFreqloadbalQCI1 iFLBBearCheckTi
Bearerchecktimer
mer

LNCEL

iFLBLoadThresholds

InterFreqloadbalGBR iFLBHighLoadGB
highloadDL
RDL

LNCEL

iFLBLoadThresholds

InterFreqloadbalnonGBRhighloadDL

iFLBHighLoadNon LNCEL
GBRDL

iFLBLoadThresholds

Inter-frequencyload
balancingPDCCHhigh
load

iFLBHighLoadPdc LNCEL
ch

iFLBLoadThresholds

InterFreqLoadBal
RetryTimer

iFLBRetryTimer

iFLBLoadThresholds

LNCEL

Loadfilteringcoefficient lbLoadFilCoeff

LNCEL

Intra-andinter-freq.
loadbal.commonload
settings

loadSettings

LNCEL

Cellcapacityclass
value

cellCapClass

LNCEL

DN09185979

loadSettings

153

Descriptionsofradioresourcemanagementand
telecomfeatures

Table83

LTERL40,FeatureDescriptionsandInstructions

Newparameters(Cont.)

Full name

Abbreviated
name

Managed
object

Structure

Modeforcalculatingthe mlbEicicOperMod
CACinloadbal.and
e
eICIC

LNCEL

loadSettings

Nominalnumberof
nomNumPrbNon
PRBsforloadbalancing Gbr

LNCEL

loadSettings

DLGBRresourcetarget targetLoadGbrDl
load

LNCEL

loadSettings

DLnon-GBRresource
targetload

targetLoadNonGb LNCEL
rDl

loadSettings

PDCCHtargetload

targetLoadPdcch

LNCEL

loadSettings

UplinkCACsource
selection

ulCacSelection

LNCEL

loadSettings

StaticCACforuplink

ulStaticCac

LNCEL

loadSettings

Table84:Modifiedparameterslistsparametersmodifiedbythisfeature.
Table84

Modifiedparameters

Full name

Abbreviated name

EnableinterFrequencyhandover

actIfHo

Managed object
LNBTS

3.19.6 Sales information


Table85

154

Salesinformation

BSW/ASW

License control in network element

License control attributes

ASW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsoftransportandtransmissionfeatures

4 Descriptions of transport and transmission


features
4.1 LTE612: Synchronization Hub
Introduction to the feature
WiththisfeaturetheeNBwithvalidsyncinputsignalcanprovidefrequency
synchronizationtoanothereNB(aswellasto2GBTSand3GNodeBinheterogeneous
networks).Thenetworkelementsthatreceivesynchronizationviasynchronizationhub
canbeeithercollocatedorconnectedinachain.
Theoutputsyncsignalisprovidedforsynchronizationofthenextequipmentinthe
synchronizationchain.Thereferenceclocksynchronizingtheoutputclockisprovidedby
syncreferenceinputsignal(alsousedbytheeNBasasystemclockrecovery).
Dependingonthereleasedifferentsyncsourcesareavailable.SeeTable87:Recovery
ofsynchronizationoutputclock.

4.1.1 Benefits
Collocatedorchainedbasestationscanrelyonthesynchronizationcapabilitiesofthe
eNB.Separatesynchronizationsourcesatthenetworkelementsarenolongerneeded.
Thisfeaturecanbeusedtosynchronizenetworkelements,inLTE,WCDMAaswellas
inothernetworktechnologies.
Thistranslatestosignficantcostsavings,sincethenumberofGPSreceiversrequiredat
eachsitecanbereducedtojustone.

4.1.2 Requirements
Software requirements
Table86:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table86

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

Issue:01J

DN09185979

155

Descriptionsoftransportandtransmissionfeatures

LTERL40,FeatureDescriptionsandInstructions

4.1.3 Functional description


TheeNBusestheselectedsyncsourcetokeepthefrequencyaccuracyofitsair
interfacewithinthespecifiedbounds.OvenControlledQuartzOscillator(OXCO)
generatestheeNBsystemclock,whichissynchronizedwiththeactivesyncreference
signal.ThefeatureSynchronizationHubgeneratessynchronizationoutputsforother
eNB(NodeBorBTSinheterogeneousnetworks).
System clock recovery
SystemclockrecoveryfortheeNBispossiblefromthefollowingsources:

PDHinterface
SynchE
TimingoverPacket1588-2008
GlobalPositioningSystem(GPS)/PulsePerSecond(PPS)externalreferenceclock

Output clock recovery


TheeNBrecoverstheoutputclockfromavarietyofsources,dependingontheactive
synchronizationusedfortheeNBsystemclockrecovery,seeTable87:Recoveryof
synchronizationoutputclock.
Table87

Recoveryofsynchronizationoutputclock

Active sync source for the eNB system


clock

Sync output interface

PDH signal synchronized to

2.048MHz signal synchronized to

PDH

PDHinput

PDHinput

2.048MHz

2.048input

2.048input

SyncE

EEC

EEC*

TimingoverPacketIEEE1588-2008

eNBOXCO

eNBOXCO

GPS/1PPS

1ppsinput

1ppsinput

None(hold-overmode)

eNBOXCO

eNBOXCO

*IncasetransportmoduleisnotinusetheoutputsignalissynchronizedtoeNBOXCO

Synchronization accuracy
InpracticethenumberofchainedeNBsdependsontheinputsignalqualityatthefirst
eNB.Amaximumof20Flexisystemmodulescanbeusedifthecompensationof
propagationdelayhasbeencorrectlyconfiguredineachofthechainedFlexisystem
modules.
InSyncEnetworks,SyncE-filteredEthernetEquipmentClock(EEC)ismorereliablethan
ToPandfulfillsMaximumTimeIntervalError(MTIE)limitforE1(G.823)andT1(G.824).
ThereforeSyncEnetworksuseEECtosynchronizePDHand2.048MHzinterfaces.

156

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsoftransportandtransmissionfeatures

SynchronizingPDHand2.048MHzoutputswitheNBOCXOguaranteesthatpotential
disturbancescausedforexamplebyToP(likeextensivewander)arefiltered
appropriately.However,outputclockisnolongertraceabletoPrimaryReferenceClock
(PRC)insuchcase.
Hold-over mode
IfeNBlosesallsyncsources,itswitchestohold-overmode.ThentheeNBOXCOkeeps
runningwiththelastknowncontrolvalueandthesyncoutputbecomessquelchable.
Inholdovermodethe2.048MHzoutputsignalcanbesquelchedadslongasthe
ext2M048ClkOutOnflagissettofalse.Otherwise,the1ppsoutputsignalisprovided
alsoduringholdoverperiods.

4.1.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeatureimpactsalltheexternaltransportinterfacesandsynchronizationoutputs.
Impact on network and network element management tools
Thisfeatureimpactsnetworkmanagementandnetworkelementmanagementtoolsas
follows:

Separatesynchronizationsourcesatthenetworkelementsarenolongerneeded.
ThesynchronizationcapabilitiesarealignedbetweenWCDMAandLTE.

Impact on system performance and capacity


Thisfeaturehasnoimpactonsystemperformanceorcapacity.

4.1.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table88:Newparameterslistsparametersintroducedwiththisfeature.

Issue:01J

DN09185979

157

Descriptionsoftransportandtransmissionfeatures

Table88

LTERL40,FeatureDescriptionsandInstructions

Newparameters

Full name

Abbreviated name

Managed object

Enablessynchronizationhubfeature

syncPropagationEnabled

BTSSCL

External1ppsclockouton

ext1ppsClkOutOn

BTSSCL

External2M048clockouton

ext2M048ClkOutOn

BTSSCL

Table89:Modifiedparameterslistsparametersmodifiedbythisfeature.
Table89

Modifiedparameters

Full name

Abbreviated name

Managed object

BTSnetworksynchronizationmode

btsSyncMode

BTSSCL

GPSconnectedtosystemmodule

gpsInUse

BTSSCL

GPScontrolinterfaceblockedforcolocatedBTS

gpsCtrlBlockForCoLocatedBts BTSSCL

TotalGPSantennalinedelay

gpsTotalAntennaLineDelay

BTSSCL

4.1.6 Sales information


Table90

Salesinformation

BSW/ASW

License control in
network element

License control attributes

ASW

4.1.7 Abbreviations
EEC-EthernetEquipmentClock
GPS-GlobalPositionSystem
OCXO-Oven-ControlledCrystalOscillator
MTIE-MaximumTimeIntervalError
OXCO-OvenControlledQuartzOscillator
PDH-PlesiochronousDigitalHierarchy
PPS-PulsePerSecond

158

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsoftransportandtransmissionfeatures

PRC-PrimaryReferenceClock
SyncE-SynchronousEthernet
ToP-TimingoverPacket

4.2 LTE628: FTIF Transport PDH / Ethernet


4.2.1 Description of LTE628: FTIF Transport PDH/Ethernet
Introduction to the feature
FTIFisanoptionalTransportSub-moduleforFlexiMultiradio10BTSSystemModule
(FSMF).ItprovideseightE1/T1/JT1andtwoGigabitEthernetinterfaces.

4.2.1.1

Benefits
FTIFprovidessupportforthefollowing:
SynchronizationfromE1/T1interface
eNBtransportchainingwithoptical(2xSFP)orelectricalGEconnection
SynchronizationHub(see:LTE612:Synchronizationhub)functionbasedon
SynchronousEthernetinputoroutput

4.2.1.2

Requirements
Software requirements
Table91:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

Table91

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10SystemModuleFSMF.

4.2.1.3

Functional description
OptionalOutdoorTransportSub-ModuleFTIFextendscapabilitiesofOutdoorFlexi
Multiradio10SystemModuleFSMFby:

Issue:01J

2xComboPortssupportingfollowingcombinations:

DN09185979

159

Descriptionsoftransportandtransmissionfeatures

LTERL40,FeatureDescriptionsandInstructions

2x100/1000Base-Tor
2xoptionalopticalSFPor
1x100/1000Base-Tand1xoptionalopticalSFP

FlexiMultiradio10SystemModulewithFTIFsupportsQoSawareEthernet
Switchingacrossupto3interfaces
8xE1/T1/JT1(twistedpair)on4xRJ48C-styleports;coaxialconnectivitycanbe
providedviabaluns

FTIFisrequired:
FlexiMultiradio10SystemModuleintegratedTransportandFTIFbuildasinglelogical
Transportnode.
Each"RJ48C-Style"portoffers2xE1/T1/JT1interfaceswhicharebothaccessiblevia
oneFTCYcable.OtherE1/T1/JT1cablesaresupported,theyprovideonePDHinterface
perRJ48Cport(interfaces1,2,3,and4).
Figure16

FTIFTransportsub-modulefrontpanelview-physicallayerview

ComboPort2

ComboPort1

EIF4 EIF3 EIF2 EIF1

IF4/8 IF3/7 IF2/6 IF1/5

2x ComboPorts,
each operatingas:
-100/1000Base-T or
-optical SFP

4x "RJ48C-style" port,


each provides 2x E1/T1/JT1

Figure17

FSM(FSMr3)

FTIFinterfaces-logicallayerview
RP3-01/
EIFSharedPort

FTIF

ComboPort

ComboPort

(whenusedasEIF)

FSMEIF1

SingleEIFPort
Nodependency

FSMEIF2

FTIFEIF1

FTIFEIF3

OnlyoneEIFPortcanbeused

FTIFEIF2

FTIFEIF4

OnlyoneEIFPortcanbeused

EIF1/EIF3andEIF2/EIF4arepairedasonecomboport.

160

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsoftransportandtransmissionfeatures

TheusageofEIF1andEIF3aswellasEIF2andEIF4ismutuallyexclusive.
TheusageofEIF1/EIF3onthisFTIFandEIF2onFSMFismutuallyexclusive.
ThesupportedopticalSFPs1000Base-BX/LX/SX/ZXarenotpartoftheFTIF
delivery.

Whenusingtheoptionaltransmissionsub-module(FTIF)thefollowingnumberof
interfaces(providedbybothSystemModuleandFTIF)ispossible:

4.2.1.4

3xGEelectrical
2xGEelectrical+1xGEoptical
1xGEelectrical+2xGEoptical
2xGEoptical

System impacts
Interdependencies between features
LTE628:FTIFTransportPDH/EthernetisneededwhenbothSynchronousEthernetas
aninputandLTE612:Synchronizationhubareused.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceandcapacity.

4.2.1.5

LTE628: FTIF Transport PDH/Ethernet management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsandcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

Issue:01J

DN09185979

161

Descriptionsoftransportandtransmissionfeatures

4.2.1.6

Sales information
Table92

162

LTERL40,FeatureDescriptionsandInstructions

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5 Descriptions of operability features


5.1 LTE162: Cell Trace with IMSI
Introduction to the feature
Withthisfeature,theexistingcelltracedatareportscanbemappedwiththe IMSI/IMEI
numbersofUEslocatedinthetracedcell.ThisfeatureextendsthescopeoftheLTE433:
CellTracefeature.ThecurrentLTE433:CellTracefunctionalityremainsunchanged.

5.1.1 Benefit
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:
theexistingcelltracerecordscanbemappedwithsubscribersIMSI/IMEInumber,
whichmakesthetracingfunctionmoreaccurate
thetraceddataassiststhetroubleshootingandnetworkoptimizationprocess

5.1.2 Requirements
Software requirements
Table93:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table93

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

Plannedforlater
releases

Plannedforlater
releases

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.1.3 Functional description


Withthisfeature,theIMSI/IMEIinformationiscorrelatedwiththecelltracecontent.The
mechanismworksasfollows:

Issue:01J

DN09185979

163

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

1. TheeNBsendstheTraceRecordingSessionReference,theTraceReference,and
theTraceCollectionEntityaddresstotheMMEviatheS1connection.
2. WhentheMMEreceivesthisnewS1signalingmessage,it:

checkstheIMSIandIMEIofacertaincallfromitsdatabase
sendstheIMSIandIMEInumberstogetherwiththeTraceRecordingSession
ReferenceandTraceReferencetothetracecollectionentity

3. ThetracecollectionentityhandlesthisinformationandassignstheIMSI/IMEI
numbertoeachtracerecordaccordingly

Note: Thefunctionalitycanbeusedinmulti-vendornetworks,becauseitsupports3rd
partyMMEandTCE.

5.1.4 System impact


Interdependencies between features
ThisfeatureextendsthefunctionalityofLTE433:CellTracefeature.
Impact on interfaces
TheeNBsendsthetracesessiondetailstowardsMMEviaS1signalingmessage.
Impact on network and network element management tools
Thetracedataispresentedinthetracecollectionentity.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.1.5 LTE162: Cell Trace with IMSI management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

164

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.1.6 Sales information


Table94

BSW/ASW

Salesinformation

License control in network element

ASWNetAct NetAct

License control attributes


-

5.2 LTE524: Certificate Management for iOMS


Introduction to the feature
TheiOMScertificatemanagementfeatureprovidestheautomatichandlingoftheprivate
andpublickeyaswellasdigitalcertificatesinX.509v3format.Thekeysandcertificates
areusedformutualauthenticationbetweeniOMSandothernetworkelementsasapart
ofsecureconnectionestablishment.
ThisfeatureoffersautomaticoperatorcertificateandoperatorCAcertificate(trust
anchor)initialenrollmenttoaniOMS.

5.2.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
TheLTE524:CertificateManagementforiOMSfeatureprovidescentralizedkeyand
certificateinitialenrollmentfortheoperatorsnetwork.Thisoffersoperatingexpenditure
savingsbyusingautomatedcertificatemanagementandsecurityenhancementdueto
mutualauthenticationoftheremotepeersbeforeestablishmentofanysecure
connection.

5.2.2 Requirements
Software requirements
Table95:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

RL40

Issue:01J

Flexi Multiradio 10
BTS

iOMS

OMS4.0

DN09185979

165

Descriptionsofoperabilityfeatures

Table95

LTERL40,FeatureDescriptionsandInstructions

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.2.3 Functional description


Functional overview
TheLTE524:CertificateManagementforiOMSfeatureprovidesautomaticinitial
enrollmentofprivateandpublickeysaswellasdigitalcertificatesinX.509v3format.The
keysandcertificatesareusedformutualauthenticationbetweenpeernetworkelements
inTLShandshakeprocedures.Certificatemanagementcanbeusedforinitial
enrollmentsofoperatorcertificatesifpublickeyinfrastructure(PKI)isusedinthe
customernetwork.

Note: ThisfeaturerepresentstheiOMSpartofcertificatemanagement.Formore
informationoncertificatemanagementontheeNBside,see
LTE665:LTECertificateManagementfeaturedescription.
Supported certificates
TheiOMSsupportsX.509v3certificatestypesinthefollowingtwoformats:

PEM,usedfortransferringcertificatesmanually
DER,usedfortransferringcertificatesovertheCMPprotocol

TheoperatorcertificateisusedtoauthenticatetheiOMSagainstthepeereNBfor
HTTPSandsecureBTSO&MconnectionsoragainsttheNetActforHTTPS.The
operatorcertificateforiOMSisobtainedeither:

automatically,fromremoteoperatorsCertificationAuthority(CA)serverwithCMP
protocolduringinitialenrollment

or

manually,bycertificatefile(PEMformat)injectionsasapartoftheiOMSsoftware
configuration

TheiOMSauthenticatesitselfagainsttheoperatorPKIforinitialkeysigningusingPresharedkeyandReferencenumberwhichareconfiguredbytheoperator.IfthePresharedkeyandReferencenumberauthenticationmethodisnotpossible,thelocal
certificateenrollmentmustbeused.
Remote operator certificate enrollment with CMP protocol
CertificatemanagementbetweentheiOMSandtheoperatorspublickeyinfrastructure
(PKI)isbasedonCMPv2protocol.

166

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

AnewlydeployediOMSinthecustomernetworkisprovidedwiththeIPaddressandthe
portnumberoftheoperator'sCertificationAuthority(CA)server.TheCAserveris
responsibleforvalidatingnewoperatorcertificatesrequests,signingnewoperator
certificates,anddeliveringitbacktotherequestornetworkelement.Theconfigurationof
CMPrelatedparametersforiOMScanbedoneeithermanually,usingprovidedAPIand
CLIcommands,orforsomeofthemusingmassconfigurationproceduretriggeredfrom
NetAct.
ThefollowingparameterscanbeconfiguredeitherusingiOMSCLIormassconfiguration
procedure:

Pre-sharedkey(iniOMSLDAP:fsCertManPSK)
RefNum(iniOMSLDAP:fsCertManRefNum)
CAserverIPaddress(iniOMSLDAP:fsCertManCAIP)
CAserverport(iniOMSLDAP:fsCertManCAPort)
CAserversubjectname(iniOMSLDAP:fsCertManCACertSubjectName)

ThefollowingparameterscanbeconfiguredonlyusingiOMSCLI:

Serverpath(iniOMSLDAP:fsCertManServerPath)
Endentitysubjectname(iniOMSLDAP:fsCertManEndEntitySubjectName)
Protocolversion(iniOMSLDAP:fsCertManOptCompatibility)

Formoreinformationoncertificateandcertificaterelatedparametersconfigurationinthe
iOMS,seeAdministeringandSecurityinLTEiOMS.
Figure18

Signalingflowofinitialoperatorcertificateenrollment.
Operator's
CAroot

Configure
PKIrelated
parameters

Nokia
CAroot

iOMS

Certification
Authority

Generatekeypair
SigncertrequestwithprivateRSAkey

CMP:InitializationRequest
Verifyauthentication
Verifysignature
SigniOMSoperator'scertificate
Operator's
CAroot

iOMS

CMP:InitializationResponse
ValidateiOMSoperator'scertificate

CMP:Acknowledgements

Issue:01J

DN09185979

167

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

BeforeaniOMSconnectstotheCAserver,itgeneratesanewRSAkeypair.Theprivate
keyisstoredlocallyintheiOMSandisprotectedbythefilesystempermissions.The
correspondingpublickeypartissenttotheCAforsigning.Asapartofproof-ofpossessionprocedure,thecertificaterequestissignedbyiOMSwithitsprivatekeyand
sentviaCertificateManagementProtocol.TheCMPmessageisintegrityprotectedby
theiOMSusingthePre-sharedkey.ThePre-sharedkeyandtheReferencenumberare
partoftheiOMSconfiguration.

Note: PSKandReferencenumberareusuallycreatedbytheCAanddeliveredin
advancetothepersonnelresponsiblefortheiOMSconfiguration.
IfiOMSauthenticationissuccessful,theCAverifiestheiOMSpossessionofprivatekey
(POP)andifsuccessful,theCAsignsthepublickey,createsanewoperatorcertificate,
andsendstheoperatorcertificatebacktotheiOMS.WithintheCMPinitialization
proceduretheiOMSreceivesalsotheCAcertificate.TheiOMSvalidatesandstores
receivedcertificates.OncetheiOMSreceivesitsoperatorcertificate,itisableto
establishsecureconnections.
Thetrustanchorisdeliveredinthesimilarmannertooperatorcertificates.TheiOMS
receivesoperatorCAcertificate:

automaticallyviatheCMPprotocolexchangeprocedureforpublickeypartsigning
request
ormanuallyviatheiOMSCLI(filesinPEMformat)

Local certificate enrollment


IftheoperatorrunsnoonlinePKIinfrastructure,thelocalcertificateenrollmentisused.
Theoperatorcertificatesandtrustanchorsarethenintroducedbyamanualprocedure
intothesecurekeystorageoftheiOMS.TheiOMSprovidesAPIandCLIcommandsfor
manualinjectionandupdateofoperatorcertificatesandtrustanchors.

Note: Theoperatorneedstogenerateaprivateandapublickeyoff-linetogetthe
publickeysignedbytheoperator'sCA.ThePEMfilecontainingtheoperatorcertificates
isthenloadedintotheiOMS.
Manual certificate/key update
CertificateupdateisdonemanuallybeforetheiOMSoperatorcertificate'soroperatorCA
certificateslifetimeisgoingtobeexpired.Toupdatecertificates/keyintheiOMS,the
responsiblepersonneltriggersinitialenrollmentprocedureusingiOMSCLIorNetAct.
Theoperator-configuredPre-sharedkey/Referencenumbervaluesareusedto
authenticatetheiOMSagainsttheCA.
ExpiredornolongerneededcertificatescanberemovedfromiOMScertificatepool
usingiOMSCLIorNetAct.
Formoreinformationoncertificatemanagementandcertificate-relatedparameters
handlingintheLTEiOMS,seeCommandLineInterfaceToolsandManagementScripts
inLTEiOMSreferencedocumentation.

5.2.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.

168

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Impact on interfaces
Thisfeatureimpactsalltheinterfaces/protocolsthatusecertificatesforsecure
connectionestablishment.
Impact on network and network element management tools
ThisfeaturesimplifiesthecertificatemanagementoftheiOMSandreducesthe
managingpersonneleffort.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.2.5 Certificate Management for iOMS management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Table96:Relatedexistingalarmslistsexistingalarmsrelatedtothisfeature.
Table96

Relatedexistingalarms

Alarm ID

Alarm name

71052

OMSFILETRANSFERCONNECTIONCOULDNOTBEOPENEDThis
alarmisraisedwhentheservercertificatevalidationfailsoniOMSforsecure
filetransfer(HTTPS)connectionattempt.

71058

NEO&MCONNECTIONFAILUREThisalarmisraisedwhentheclient
certificatevalidationfailsoniOMSforsecureBTSO&Mconnectionattempt.

71124

CMPCERTRETRIEVALFAILUREThisalarmisraisedwhenthereis
connectivityproblemwiththeCAortheiOMSfailstovalidateitsown
certificatesrelatedtoCMPinitializationorkeyupdatesequence.

71125

CERTIFICATEEXPIRINGThisalarmisraised,whenitsownoperator
certificateorrootCAcertificateisabouttoexpire.

71123

CERTIFICATEREVOKEDThisalarmisraisediftheoperatorcertificate
signedwithCAcertificatecouldnotbevalidated.

71122

CRLUPDATEFAILUREThisalarmisraisedifiOMScannotdownloador
validatethedownloadCRLfromtheserver.

Measurements and counters


Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table97:Newparameterslistsparametersintroducedwiththisfeature.

Issue:01J

DN09185979

169

Descriptionsofoperabilityfeatures

Table97

LTERL40,FeatureDescriptionsandInstructions

Newparameters

Full name
Endentitysubjectname
Serverpath
Protocolversion
CAserverIPaddressandport
CR/LDAPserverIPaddressandport
PSK/Refnum/CAsubjectname
Timeforcertificateexpirywarning
Timeforcertificateexpiryalarm
TimeforperiodicdownloadofCRL
Timeforoperatorcertificateupdatesequenceinadvance
TimeforoperatorCAcertificateupdateinadvance

5.2.6 Sales information


Table98

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.3 LTE593: Security for Ethernet Ports on FCT/FSM3


Introduction to the feature
ThepurposeoftheLTE593:SecurityonEthernetPortsonFCT/FSM3featureisto
separatethesensitiveandnon-sensitivetrafficbymeansofapropervirtualLAN(VLAN)
configuration.

5.3.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits

170

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

ThisfeatureincreasesthesecurityofthedatasentintheinternaleNBnetwork.

5.3.2 Requirements
Software requirements
Table99:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

RL40

Table99

UE

Flexi Multiradio 10
BTS

iOMS

LBTS4.0

Softwarerequirements

NetAct

MME

SAE GW

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10BTS(FSM-r3)hardware.

5.3.3 Functional description


ThethefollowinglogicaltraffictypesareswitchedbytheEthernetswitchdeviceinside
FlexiMultiradio10BTS(FSM-r3):

SubscriberpayloadandanykindofcontrolandmanagementtrafficbetweenUE,
eNBandcorenodesaccording3GPP
Thistypeofdataissensitiveandmustbeproperlyprotected.
internalEthernettraffic,whichisexchangedbetweenmodulesinsideeNB
Thistypeofdataisalsosensitiveandmustbeproperlyprotected.
externalEthernettrafficto/fromLocalManagementPort(LMP)
Thistypeofdataisassumedtobenon-sensitive.

BecauseofFlexiMultiradio10BTS(FSM-r3)architecturalconceptalltraffictypesshare
thesameEthernetswitch.TosecuretheinternalEthernettraffic,thefollowingsecurity
requirementsapply:

ThesensitiveinternalEthernettrafficisseparatedfromexternalEthernettrafficby
meansofVLANseparation.
InterceptinginternalEthernettrafficonexternalportsisprevented.
ReroutingofinternalsensitiveEthernettrafficviaexternalportstowardsexternal
equipmentandthewaybackisprevented.

TheVLANseparationsupportcanbeconfiguredlocallyorfromaremotelocationby
userwithproperrights.Forsecurityhardening,thelocalhostCPUisalwaysinvolvedin
theconfigurationprocess.
Feature configuration

Issue:01J

DN09185979

171

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

TheLTE593:SecurityforEthernetPortsonFCT/FSM3featurecanbeconfiguredtobe
enabledordisabledeitherfromNetActorbytheBTSSiteManager.Thedefault
configurationisenable.

Whenthefeatureisenabled:

Externaltraffic(non-sensitivedata)isseparatedfrominternaltraffic(sensitive
data)viaVLANtagging.
BTSSiteManager(BTS SM)trafficisallowedfromexternalEthernetports.
EthernettrafficfromanexternalEthernetporttryingtoaccessinternalservicesis
discarded.
InternalconnectionsandservicescannotbeaccessedbyanylocalEthernetport.

Whenthefeatureisdisabled:

VLANtagisnotsupported,therearenoseparationofsensitiveandnon-sensitive
data.

Deactivating the feature


Deactivatingthefeatureisusuallynotneeded.
Iftheoperatorchoosestodeactivatethefeaturemanually,itispossibletodoitusing
eitherNetActorBTSSiteManager.Todisableorre-enableLTE593:Securityfor
EthernetPortsonFCT/FSM3featureusingBTSSiteManager,modifytheeNB
configurationplan.Enabling/disablingthefeaturedoesnotrequireeNBrestart.
Allthefeature-relatedsettingsarefoundintheRadio network configurationpage.
SwitchtoRadio network configurationpageandconfiguretheActivate Ethernet
securityoptioninMRBTS-1 Propertiessection.

5.3.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.3.5 LTE593: Security for Ethernet Ports on FCT/FSM3


management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeFlexiMultiradioBTSLTECommissioning,RNWandTransmissionParametersexcel
inNOLS.
Alarms

172

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table100:Relatedexistingparameterslistsparametersintroducedwiththisfeature.
Table100

Relatedexistingparameters

Full name

Abbreviated name

Activateethernetsecurity

actEthernetSec

Managed object
MRBTS

5.3.6 Sales information


Table101

Salesinformation

BSW/ASW

License control in network


element

License control attributes

BSW

5.4 LTE622: Local Link Layer Security


Introduction to the feature
TheFlexiMultiradio10BTS(FSM-r3)usesSerialRapidI/O(sRIO)portsto
communicatewithothermodules.TheLTE622:LocalLinkLayerSecurityfeature
providesauthenticationandencryptionforsRIObusbetweenFlexi10BTSSystem
ModuleandFlexi10ExtensionModuleswhenconnectedviasRIO.

5.4.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
EnhancedriskmanagementisachievedbecauseofimprovedeNBsoftwareand
hardwaresecurity.

5.4.2 Requirements
Software requirements
Table102:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

Issue:01J

DN09185979

173

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

System release

Flexi Multiradio BTS

RL40

Table102

UE

Flexi Multiradio 10
BTS

iOMS

LBTS4.0

Softwarerequirements

NetAct

MME

SAE GW

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10BTShardware.

5.4.3 Functional description


InFlexiMultiradio10BTS(FSM-r3)hardwarearchitecture,outdoormodulesprovide
SerialRapidI/Oports(sRIO)onthefrontpanel,e.g.toconnecttheextensionboards,for
exampleFBBAmodule,tothesystemmodule.IndoorsystemmodulesprovidesRIO
interfaceonthebackplaneforthesamepurpose.Toprotecttheseinterfaces,module
authenticationandlinklayerencryptionisprovided.
Local Link Layer Security (LLsec) setup procedure
BeforeanewmoduleisconnectedviasRIOporttoanalreadyoperatingflexisystem
module,thesRIOportsareopen.Oncethenewmoduleisconnected,adiscovery
processstartsforthesRIOaddressallocation/assignmentandmodulemutual
authentication,includingthekey-agreement,isperformed.Ifthemodulesare
authenticatedsuccessfully,theconfidentialityprotectionisenabledandcommunication
betweenmodulesstarts.Theconfidentialityprotectionisperformedonthelinklayer.
Incasetheconnectionislost(duetocableunplug)analarmisraisedandthewhole
setupprocedureappliestore-establishtheconnection.

Note: TheLTE622:LocalLinkLayerSecurityprovidesprotectiononlyforSerialRapid
I/Oports.
ThelinklayersecurityisallocatedbetweensRIOtransportlayerandthesRIOphysical
layer.ThesRIOtransportlayeraddstherelevantheaderinformationtothepayload.The
payloadandthesRIOtransportheaderareconfidentiallyprotected.

174

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure19

Descriptionsofoperabilityfeatures

Inter-secureenvironmentcommunication

FSMF

FBBA

Application

sRIOPHY

sRIOTransport
Layer

Control

LinkLayer
Security

O&M,Control

sRIOTransport
Layer

Application

LinkLayer
Security
sRIOPHY
sRIOswitch

sRIOswitch

opticalsRIO
electricalsRIO

transmissionlinewith
AES-128ciphering

InRL25TD,thefeatureprovidesecuritybetweenFlexiSystemModule(FSMF)andan
extensionboardFBBA.
ThelinklayeralgorithmisAES128-CTRcompliantto3GPPforair-linkencryption.The
AESalgorithmishardware-implementedinsidethesRIOswitch.ItisusedonlyforFlexi
Multiradio10BTSinternaltransportsecuritypurposes(inter-secureenvironment
communication).

5.4.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
OntheinterfaceswhichusesRIO,LTE622:LocalLinkLayerSecurityprovidesmutual
authentication,keyagreementandencryptionbetweenBTS10modules.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

Issue:01J

DN09185979

175

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.4.5 LTE622: Local Link Layer Security management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Table103:Relatedexistingalarmslistsexistingalarmsrelatedtothisfeature.
Table103

Relatedexistingalarms

Alarm ID

Alarm name

7650

BASESTATIONFAULTY

7651

BASESTATIONOPERATIONDEGRADED
The above alarms are raised, if the below fault occurs:

Noconnectiontounit(10)

Measurements and counters


Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.4.6 Sales information


Table104

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.5 LTE623: Crypto Agent


Introduction to the feature
TheCryptoAgentisasoftware-basedsolutionthatprovidessupportforsecurekeyand
securefilestorage.

5.5.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits

176

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Riskmanagementforsecretsisenhanced.Thesecretsareprotectedbypersonalsecure
environment(PSE)andcryptographicservices.

5.5.2 Requirements
Software requirements
Table105:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

RL40

Table105

UE

Flexi Multiradio 10
BTS

iOMS

LBTS4.0

Softwarerequirements

NetAct

MME

SAE GW

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10BTShardware.

5.5.3 Functional description


Apersonalsecureenvironment(PSE)withintheeNBmodulestakescareaboutthe
securestorageofsecretslikeprivatekeysandsensitivefiles.Itprovidesservicesonthe
encapsulatedexecutionofsensitivetaskslikekeycreation,hashsigningserviceand
dataen/decryption.Suchapersonalsecureenvironmentcaneitherberealizedbya
software-basedorhardware-basedsolution.TheCryptoAgentprovidesthesoftwarebasedsolution.
TheCryptoAgenthidesallsecretinformation.Therefore,nosecretinformation(for
exampleprivatekeys)isstoredunencryptedintheeNB.Privatekeysneverleavethe
CryptoAgentinunencryptedformandallprivatekeyoperationsareperformedwithinthe
CryptoAgent.

Issue:01J

DN09185979

177

Descriptionsofoperabilityfeatures

Figure20

LTERL40,FeatureDescriptionsandInstructions

SecurestoragesupportbyCryptoAgent

FlexiMultiradioSystemModule
Applications
FileSystem

UNIXsocket

CryptoAgent

keydatabase

encryptedfiles
Fortheapplication,theunderlyingsecurestoragemechanismistransparent.
TheinformationthatneedstobeprotectedisencryptedwiththeStorageRootKeyand
thenstoredinapersonalsecureenvironment.Theencrypteddatacanonlybedecrypted
bytheCryptoAgentwiththerelatedStorageRootKey.Becauseofthat,anytransitfrom
onesecurekey/filestoragetoanotherrequiresfirstunbindingallsecretsthatarestored
inPSE.Afterwards,thetransitoftheinformationtotheothersecurekey/filestorageis
possible.Beforethesecretsaresecurelystored,theymustbefirstboundwithanew
personalenvironmentandaStorageRootKeyrelatedtoit.
TheCryptoAgentprovidesalsoasecurefilestorageservicewherethefilecontentis
de/encryptedwithinthepersonalsecureenvironment,cipheredandthenstoredwithin
thefilesystem.TheCryptoAgentprovidesseamlessintegrationintotheOpenSSL
frameworkviaapluggableengine.Itguaranteesthatthesecretsarenotcorruptedifan
applicationoroperatingsystemsoftwareismodified.

5.5.4 System impact


Interdependencies between features
ThefeatureslistedbelowuseCryptoAgentforsecureprivatekeysstorage:

178

LTE150:LTEOAMTransportLayerSecurity(TLS)Support
LTE622:LocalLinkLayerSecurity
LTE665:LTECertificateManagementandLTE685:InfrastructuresforCertification
Authority(CA)andRegistrationAuthority(RA)
LTE689:LTEIPsecSupport

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

LTE940:SWVerificationAgent

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.5.5 LTE623: Crypto Agent management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.5.6 Sales information


Table106

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.6 LTE646: SW Monitoring Extension with PM


Counters
Introduction to the feature
Thisfeatureextendsthecontentofthesoftwaremonitoringreport.
ThesoftwaremonitoringmoduleRL20enablesmonitoringofConfigurationManagement
(CM)-basedoptionalsoftwarefeatures.InadditiontotheCM-basedSWmonitoring,
PerformanceMonitoring(PM)monitoringisintroducedstartingfromRL40.

Issue:01J

DN09185979

179

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Withthisfeatureitispossibletoincludeinthesoftwaremonitoringreportadditional
informationaboutthededicatedLTEPMcountersthatareimportanttocalculatethe
softwarepriceforcustomeronausagebasis.
CMbasedSWmonitoringoffersthekeepingtrackofconfiguredfunctionalities,whereas
PMbasedmonitoringreallymonitorsusedfunctionality.

5.6.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
SoftwareMonitoringmoduleprovidesacompletepictureofthenetworksetupand
networkusage.

5.6.2 Requirements
Software requirements
Table107:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table107

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.6.3 Functional description


5.6.3.1

Functional overview
Inadditiontothereportgeneratedonbasisofconfigurationdata,nowalsodedicated
performancemanagement(PM)countersareincludedintothesoftwaremonitoring
report,forexamplethePMcounterforcountingtheactiveusers.
Everyhourthecountersvalueisstoredinadailyreport.IfeNodeBsreporting
granularityislessthan1h(e.g.15)thenSWAMtakesthemaximumvalueofvalues
providedwithinthathour.Monthlyorquarterlyreportsshowforeachdaythemaximum
value.Forinvoicingthemaximumvalueofallthedaysistaken.SWAMhasconfiguration
parameterstoenablemonitoringaccordingtocommercialagreements.

180

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.6.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.6.5 LTE646: SW Monitoring Extension with PM Counters


management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table108:Newcounterslistscountersintroducedwiththisfeature.
Table108

Newcounters

Counter ID
M8018C1

Counter name
ActiveUEpereNBmax

Measurement
8018-LTEeNBLoad(WBTS)

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.6.6 Sales information


Thisfeatureisabasicsoftwarefeature.
Table109

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

181

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.7
5.7.1 LTE771: Optimization of Intra-LTE Neighbor Relations
Introduction to the feature
TheNetActOptimizersupervisesallregisteredcellrelationsbetweentheneighboring
LTEcellsiftheyarestillvalidandreliablecandidatestobeahandoverdestination.
Whentheoutcomeresultsisaninefficientneighborrelation,theaccordingcellrelation
mightbeblacklistedforhandover.
Theoptimizerneighborcelloptimizationisbasedonstatisticallyreliabledataderived
fromthemeasurementscollectedbyterminalsandeNBduringtheirnormaloperation.
In-linewithacentralizedSONfunction,itworksinamidtolongtermschedule.
TheNetActkeepsanupdatedviewofthenetworkconfiguration.NetActOptimizer
evaluatesthePMdatafortheidentifiedneighborrelationsandproposesblacklistingif
required.
TheNetActOptimizerforwardstheproposedconfigurationinaplanfiletoNetAct
Configurator.

5.7.1.1

Benefits
End-user benefits
TheLTE771:OptimizationofIntra-LTENeighborRelationsfeatureincreasesthegradeof
servicefortheenduserbymaintainingwellperformingandrobusthandover
relationships(mobilityprocedures).
Operator benefits
Theoperatorcanreduceoperatingexpenses(OPEX)duetothereducedworkloadin
managingneighborrelationships.

5.7.1.2

Requirements
Software requirements
Table110:SoftwarerequirementsforRL40liststhesoftwarerequiredfortheLTE771:
OptimizationofIntra-LTENeighborRelationsfeature.
Table110

Release

SoftwarerequirementsforRL40

System
release

eNodeB

MME

SAE GW

UE

NetAct

RL40

LBTS3.0

OSS5.3
CD3

Hardware requirements
Thisfeaturerequiresthefollowinghardware:

182

LTESystemModule

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

5.7.1.3

Descriptionsofoperabilityfeatures

Functional description
Functional overview
TheLTE771:OptimizationofIntra-LTENeighborRelationsispartoftheoverallANR
(3GPP36.300:AutomaticNeighbourRelation)functionality.LTEneighborcellswillbe
discoveredandaddedbyANRfeaturesormanualinputbytheoperator.
TheneighboreNBandcellconfigurationisconfiguredorexchanged,viatheX2set-up
procedure,inabi-directionalmode,sobothpeerscanbetheinitiator.Whilethecell
neighborrelationitselfisfirstofallauni-directionallinkagefromthesourcecelltothe
targetcell.TheeNBwillestablishcellneighborrelationsbasedonUEevents.The
LTE771:OptimizationofIntra-LTENeighborRelationsfeaturefocusesoncellneighbor
relationsinthefollowingway:

TheNetActOptimizersupervisesallcurrentcellrelationsbetweenneighboringLTE
cellsiftheyarestillvalidandreliablecandidatestobeahandoverdestination.When
thePMcountersshowaninefficientneighborrelation,theaccordingcellrelation
mightbeblacklistedforhandover.
TheNetActOptimizerusesFlexiBTSconfigurationinformationandperformance
counters(intra-frequencyandinter-frequencyhandovers)inordertoperformthe
analysisofthetask.Theevaluationmightresultinnoactionorblacklistingofa
neighborcellrelation.

Thefollowingusecasesaresupported:

Neighborcellrelationsthathavebeencreatedbytheoperator(networkplanning)or
havebeencreatedbySON-mechanismslikeANR(automaticneighborrelation)and
thathaveaninsufficienthandoverperformance(weakhandoversuccessratio;
thresholdisoperatorconfigured)mightbeblacklistedbyanoptimizationmechanism
or,optionally,manuallybyanoperator.
Neighborcellrelationsthathavebeencreatedbytheoperatororhavebeencreated
bySON-mechanismslikeANRthathadbeenblacklisted,canbeenabledagainby
theoperator(forexample,ifanoperatorwantstore-evaluatetheperformanceofa
formerlyblacklistedneighborrelationduetochangedenvironment/topology).
Neighborscellrelationsthathavebeencreatedbytheoperatororhavebeencreated
bySON-mechanismslikeANRcanbemarkedbyanoperatorinawaysothatthey
areexcludedfromoptimization.
Note: Whenneighborcellisblacklisted,nooutgoinghandovertothetargetcellis
allowed,neitherviaX2norviaS1-interface.

Possible results of optimization mechanism:

Noaction:Theanalyzedrelationshowedsuspiciousnotsuspect
Blacklisting:Agivenrelationwasidentifiedasunreliable/weakperforming.The
NetActsuggestsanewconfigurationplanfilewithupdatedentriesforappropriate
Telecom/RRMblacklists.

Whilescheduledexecution,thechangesproposedbyoptimizationalgorithmscanbe
takenoverautomatically(withoutanyoperatorinteraction)orafterconfirmationbythe
operator.OneorbothisconfiguredintheLTE771:OptimizationofIntra-LTENeighbor
RelationsprofileattheNetAct.WhenoperatedfromtheOptimizerGUI,theusermakes
thedecisionbeforesavingtheproposedchangestoaplan.

Issue:01J

DN09185979

183

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Figure21:LTE771:OptimizationofIntra-LTENeighborRelationsgivesanoverviewof
thefeature.
Figure21

LTE771:OptimizationofIntra-LTENeighborRelations
Optimizer
PM

Configurator
CM

Monitor

NoHO

5.7.1.3.1

RAN system level scope


ThecentralizedSONfeatureLTE771:OptimizationofIntra-LTENeighborRelations
operatesonexistingNRtointra-LTEneighborcells.Thosecanbepre-configured,learnt
fromANRfunctions,orgeneratedfromoff-linetools.ThePMdataadministrationis
expectedtorunforthewholeNetActclusteroreventhewholenetwork.ThePMdataare
checkedforbeingrepresentative,sothatenoughHOattemptsareconsidered.Asthere
arealotofNRsfoundbyANRfunctions,someofthoseareoftenusedforHOothers
less.TheprerequisiteforfeatureisthatNRPMcountersbeavailableonweekly
granularityperiodforthelastweeksatleast.EachNRwithatleasttherequiredHO
numberwillbecheckedtoensurethattheirHOsuccessrateisbetterthenthedefined
threshold.
TheoperatorcontrolstheLTE771:OptimizationofIntra-LTENeighborRelationsfeature
withanetwork/clusterprofilesetting.Thisincludestheconfigurationofthescheduled
workflowaswellasthethresholdsfortheSONfunctionitself.
TheLTE771:optimizationofIntra-LTENeighborRelationsfeaturesfocusesonlongterm
supervisionoftheHOperformance.ThistaskrequireskeepingandaggregationofPM
dataforalongerperiodoftimeattheNetAct.ThefeatureblacklistsbadperformingNRs
ateNB.ThefeaturedoesnotremoveNR.TheeNBinterpretsthistoblacklistthose
neighborcellsinthemeasurementrequestandHOdecision.

184

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

TheoperatorcantriggertheLTE771:OptimizationofIntra-LTENeighborRelations
featuremanually,inwhichcasetheprofilesettingwillbedoneinteractively.Theprofile
forautomaticexecutionisnotchangedbythisoperation.Theoperatorcanrequestsetof
cellsoreNBsoptimizationoreNBs.
IfnoorinsufficientNRPMcountersareavailableforaNR,itistreatedastheexit
criterionfordecidingonindividualNR'sperformance.
TheblacklistingimprovestheKPIshort-term,but,foreachblacklistedneighborrelation,
theoperatorshouldidentifytherootcause.ThefollowingsituationscanleadtoabadHO
performanceinadditiontoamissingMROandgeneralthresholdmis-configuration:

5.7.1.3.2

PCI-confusiononcelllevel:foronereportedPCI,thereareseveralUEsdifferentCGI
visible;thisisaclassicalPCIcollision.TheeNBtakesonePCI/CGIassociationand
willnotrecoverfromthissituation.TheSONfunctionPCImanagementresolves
suchsituations.
PCI-confusiononeNBlevel:ThereareforonereportedPCIindifferent(mainly
distributed)cells,severalUEswilldifferentCGIvisible.Thisisa3GPP-compliantPCI
allocation,buttheeNBwilltakeonePCI/CGIassociationandwillnotrecoverfrom
thissituation,ifUE-basedANRisdisabled.IfUE-basedANRandPCIre-validation,
introducedwiththeLTE1685:NeighborRelationRobustnessfeatureisenabled,then
theeNBwillautonomouslyselectthecorrectPCI/CGIassociation.Anotheroptionis
toruntheLTE468:PCIManagementfeatureasthisSONfunctionalsorecoversfrom
suchasituation.
PRACH-collision:iftheHOfailsasaresultofabadRACHperformance,amanual
executionofLTE581:PRACHManagementfeatureisrequiredtorecoverfromthis
situation.
PRACH-rangeconfiguration:iftheHOfailsasresultofawrongRACHformatforthe
actualdistancefromtheUEtowardsthetargetcell,amanualexecutionofthe
LTE581:PRACHManagementwithabiggerISD(InterCellDistance)isrequiredto
recoverfromthissituation.

Use case ANR optimization


Thisusecasedescribestheoptimizationoftheintra-LTENRs.Theoperatordoes
configureascheduledjobattheNetActthatanalyzestheLTEcellswithrespecttotheir
intra-LTEneighborshipperformance.
Preconditions
Theoperatorhassetthewantedoperatorpolicyvaluesforoptimizationofintra-LTENR
optimization.
TheoperatorhasenabledthescheduledjobattheNetAct.
TheKPIdatafortheNRareavailable.
Description
ThefollowingstepsaresupportedbytheNetAct:
1. TriggeredbySONschedulerorfromusermanuallyviaWFEUI.WFEdoesstartthe
scheduledworkflow.
2. TheNetActstartsforallcellstheperformanceevaluationofitsNR.
3. TheNetActcreatesthenewplanoftheproposedblacklistedNR.

Issue:01J

DN09185979

185

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

4. TheNetActprovidestheoperatorthefeedbackontheprocedure,accordingtothe
levelofthedetailsselectedinthepolicyvalues.
5. Incaseofexecutionwithoutbreakpoint,theNetActdownlowadsandactivatesthe
planfilestoeacheNB.
6. Incaseofexecutionwithbreakpoint,theNetActConfiguratorSONSchedulerexits
atthisbreakpoint.Theoperatorcanedittheplananddecideonthefurthersteps.
Post conditions
InthenetworktheNRsthatarepoorlyperformingwillbeblacklisted.

5.7.1.3.3

Use case scheduled workflow for LTE771: Optimization of Intra-LTE


Neighbor Relations
ThisworkflowdescribestheHOperformanceoptimizationofintra-LTENRs.The
operatorconfiguresascheduledjobattheNetActthatanalyzesalltheeNBsorLTEcells
withrespecttotheirintra-LTEneighborshipperformance.TheeNBsortheLTEcellswill
bethewholenetworkortheactualNetActcluster.Theoperatorcannotdirectlyconfigure
thescopeofLTEcells.
Theoperatorcanruntheprocessautonomouslyorrequestbreak-points.Inautonomous
mode,alltheresultingblacklistingofbadlyperformingNRsareconfiguredwithone
commonplanfiletogetherforalltheimpactedeNB-cell-NRs.
Preconditions
TheLTEcellsandeNBsexistandareunderthemanagementoftheNetAct.The
operatorhassetthewantedNetActpolicyvaluesforoptimizationofintra-LTENR
optimization.
TheoperatorhasenabledthescheduledjobatNetAct.
Description
ThefollowingstepsaresupportedbytheNetAct:
1. TheNetActstartstheworkflowaccordingtotheconfiguredweek-dayandday-time.
2. TheNetActcollectsalleNBsandtheircellsinthecurrentnetwork,basedontheir
actualconfiguration.Itisignored,iftheeNBoritscellarelockedinresetorother
states.
3. TheNetActstartsforthegivenlistofcells,foreachcelltheperformanceevaluation
ofitsNR.
4. Thisstepisrepeatedforthewholelistofcells.TheNetActupdatestheSONreport
ofoneeNBorcell.TheNetActinformstheoperatorabouttheprogressofthe
proceduretoruninbackground.
5. TheNetActcreatesthenewplanoftheproposedblacklistedNR.
6. Incaseofautomaticexecution,thismeanswithoutactivebreakpoint,theNetAct
downloadsandactivatestheplanfilestoeacheNB.
ASONreportisgeneratedandnotifiedtotheoperator.
7. Confirmedexecution,theNetActstopsatthisbreak-point.Theoperatorcanaccess
thenewplanoftheproposedblacklistedNR(s).Theoperatorcanedittheplanand
decideonthefurthersteps,eithertowithdrawtheplanfileortoimplementit.ASON
reportisgeneratedandnotifiedtotheoperatororstoredatwell-definedlocation.
Post-conditions

186

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

InthenetworktheNRthatperformbadlywillbeblacklisted.

5.7.1.3.4

Use case manual triggered workflow for LTE771: Optimization of Intra-LTE


Neighbor Relations
ThisusecasedescribesthemanualtriggeredHOperformanceanalysisofIntra-LTE
NRs.TheoperatorselectsasetofLTEcells.Theoperatorstartsfortheselectedsetof
cellstheanalysisoftheirintra-LTEneighborshipperformance.
Preconditions
TheLTEcellsandeNBsexistandareundermanagementofNetAct.
Theoperatorhasselectedasetofcells,otherwisetheLTE771:OptimizationofIntra-LTE
NeighborRelationsoptionisnotsupported.
Description
ThefollowingstepsaresupportedbyNetAct:
1. Theoperatorcanmodifythepolicyvaluesforoptimizationofintra-LTENR.
2. TheNetActcollectsalleNBsandtheircellsintheselectedscope,basedontheir
currentconfiguration.Itisignored,iftheeNBoritcellarelocked,inresetorother
states.
3. TheNetActstartsforthegivenlistofcellsforeachcelltheperformanceevaluationof
itsNR.
4. Thisstepisrepeatedforthewholelistofcells.NetActupdatestheSONreportofone
eNBorcell.
TheNetActinformstheoperatorabouttheprogressoftheprocedure.
5. TheNetActcreatesthenewplanoftheproposedblacklistedNR.ASONreportis
generatedandwillbeaccessiblebytheoperator.
TheoperatorcanaccessthenewplanoftheproposedblacklistedNR.Theoperator
canedittheplananddecideonthefurthersteps,eithertowithdrawtheplanfileorto
implementit.Theprocedureexecutionreportwillnotconsiderthosemanual
changes.NetActprovidesSONcontextinformation(LTE1019:SONReports)forCM
HistorysupportoftheSONreports.
Result
IntheselectedsetofcellstheNRsthatperformbadlywillbeblacklisted.

5.7.1.3.5

Use Case for the operator to manually clear the blacklist


ThisusecasedescribesthestepsbyoperatortolistalltheactualblacklistedNRsandto
clearforindividualNRtheblacklisting.
Preconditions
NetActcontrolstheLTEnetwork.
Description
ThefollowingstepsaresupportedbyNetAct:
1. NetActlistsallLNRELinstancesthathaveforHO-allowedthevalueForbiddenand
NR-controlthevalueAutomatic.
2. NetActshowsforthefoundLNRELinstancestheparameterHO-allowedandNRcontrolinatable.

Issue:01J

DN09185979

187

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

3. TheoperatorcaneditforeachNRtheparametersHO-allowed.
4. OperatorcansavethetheproposedchangestotheNRparametersintoaplan.
5. Theoperatorcanedittheplananddecideonthefurthersteps,eithertowithdrawthe
planfileortoimplementit.
Result
ForthedesiredsetofNeighborRelations(LNREL),theNRblacklistingisremoved.

5.7.1.3.6

SON modus
ThefunctionalityrequiredfromLTE771:OptimizationofIntra-LTENeighborRelationsis
oftheself-optimizationtype.Theproceduresoptimizetheneighborshiprelationsbased
onperformancedata.
TheoperatorcanexecutethefunctionofLTE771:OptimizationofIntra-LTENeighbor
Relationsmanuallytriggered,too.
Theoperatorcaninfluencetheneighborshipoptimizationalgorithmwithpoliciestoadapt
theresulttowardshisdesire.Themaincontrolisthenetwork-widethresholdofnot
acceptableHOperformance.
Theproceduresaredesignedtoworkautomaticallybasedonpolicysettingsforallcells
andtheirNRonnetworkorNetActscope.BydefaultLTE771:OptimizationofIntra-LTE
NeighborRelationsconsidersallNR.Theoperatorcanswitchtomanualmodeforeach
NR.ThenthisNRisnotconsideredbyLTE771:OptimizationofIntra-LTENeighbor
Relationsanymore.
ThefollowingNetActbasedpoliciesareapplicableatnetworklevel:

featureactivationflagatNetAct
minimumnumberofHOattemptsperday[#/day,{0..10000}default:10]
requiredsuccessratioforHO[%,{0..99.9}default:50,0]

ThefollowingeNBbasedpoliciesareapplicableatNRlevel:

5.7.1.3.7

NR-controlperNR{automatic,manual}defaultautomatic
HO-allowedperNR{allowed,forbidden,S1only}defaultallowed

Reporting
Theoperatorcaninvestigatetheoutputoftheautomatedprocessandoptionallyverify
theproposedchanges,orinvestigatetheappliedchanges.
TheoperatorisinformedabouttheprogressoftheLTE771:OptimizationofIntra-LTE
NeighborRelationsfunctionforeachcelloreNB.Thefollowingreportsareshown:

188

totalanddonenumberofcellsoreNBs
numberofcheckedNR
blacklistedNR
ignoredNR

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

AftertheexecutionofLTE771:OptimizationofIntra-LTENeighborRelations,the
operatorcanhavealookontheproposedneighborshiprelationsblacklisting.The
operatorcaneditthelistsinprinciple.Iftheoperatorwantsacertaindeviationwith
respecttotheANRoptimizationresult,thishastobechangedattheNRcharacteristic
setting,forexampletosetthisNRaswhitelisted.
AnychangesbythefeatureLTE507:InterRATneighborrelationOptimization(LTE,
UTRAN,GERAN)willbemarkedwithaSONcontextlable.ThisallowstogenerateSON
Reports(LTE1019:SONReports)fromCMHistorycontents.Theoperatorcanretrieve
anychangesdonebyLTE507:InterRATneighborrelationOptimization(LTE,UTRAN,
GERAN).

5.7.1.3.8

Operator interaction outside of LTE771: Optimization of Intra-LTE Neighbor


Relations
TheMIBofthenetworkismodifiedbytheautomatedLTE771:OptimizationofIntra-LTE
NeighborRelationsprocedures,nevertheless,theoperatorhimselfcanalsoaccessthe
MIBdirectlyviaNetAct.ThereisanNR-controlparametertoavoidaccesscollisions.If
theoperatorchangestomanualcontrol,thenLTE771:OptimizationofIntra-LTE
NeighborRelationsproceduresignorethisNR.Thenmanualchangestothecurrent
neighborshiprelationsareconsideredbytheautomatedprocedures..
Theoperatorvaluesettingof:

HO-allowedforbiddenandNR-controlmanual->blacklistingofNR.
HO-allowedallowedandNR-controlmanual->whitelistingofNR.

TheoperatorcanselectforHO-allowedthevalueS1only.WithrespecttoLTE771:
OptimizationofIntra-LTENeighborRelationstheHO-allowedvaluesAllowedand
onlyS1aretreatedequally.LTE771:OptimizationofIntra-LTENeighborRelationsmight
changeittoforbidden.TheoperatorcanchangethesevaluesmanuallytoAllowedor
onlyS1.

5.7.1.4

System impact
Interdependencies between features

Issue:01J

LTE651:PerformanceMonitoringThefeatureprovidesbasiccounterstoverifybasic
systemfunctionalityandperformance.Supportforbasicnetworkoptimizationfor
coverageandperformance.Internallyprovidedperformancecounterscanbe
complementedbyexternaltracingtoolsanddrivetestdata
LTE724:LTEAutomaticNeighborCellConfigurationTheestablishmentofneighbors
isbasedontheinformationwhichispreparedinapre-planning.Onlyasubsetof
informationtostandardconfigurationisrequired.Forallneighborcellsonlythe
Node-IDandtheIPaddressoftheneighborLTEeNBhostingtheexpectedneighbor
cellsneedtobeconfiguredbyofflinepre-planning.Allotherconfigurationinformation
forcellsofneighborLTEeNBsareautomaticallyderivedandupdatedviatheX2
interface.

DN09185979

189

Descriptionsofoperabilityfeatures

Note: Operatorhint:
UptoRL20theneighboreNBsarefound,basedontheIPaddressconfiguredin
ADIPNO-adjEnbCPlaneIpAddress.WiththeupgradetoRL30theIPaddressare
movedintothepersistentobjectLNADJ.DuringupgradetheIPaddresshasthe
characteristicLNADJ-cPlaneIpAddrCtrl=oamControlled.As
LTE771:OptimizationofIntra-LTENeighborRelationsisbasedontheLNREL-eCGIto
identifytherelatedLNADJinstancewiththesameeCGI,werecommendtoenable
LTE782:ANR-Intra-LTE,Intra-frequency-FullyUE-basedandchangeallIPaddress
characteristicstoenbControlled.ThisensuresthattheLNREL-eCGIisalways
correctlyassignedtotherelatedLNADJ-global-eNB-ID.SothatthecorrectPCIvalues
areblacklisted.

190

LTE797:PMCounterHandoverThePMCounterHandoverfeatureprovidesmore
detailedinsightintohandoverperformance.
LTE492:ANRIfanunknownphysicalcellID(PCI)isdetectedbytheFlexiMultiradio
BTS,thecorrespondingC-planeIP-connectivityinformation(IPaddress)ofthe
neighborsiteisresolvedandtheX2signalingconnectionissetupinorderto
exchangeneighborcellinformation;alternativelytheX2interfaceisopenedfor
controllayerapplications.
Note: Operatorhint:InRL20theneighboreNBsarefound,andtheIPaddressis
configuredatADIPNO-adjEnbCPlaneIpAddress.WiththeupgradetoRL30,theIP
addressismovedintothepersistentobjectLNADJ.DuringupgradetheIPaddresshas
thecharacteristicLNADJ-cPlaneIpAddrCtrl="oamControlled".As
LTE771:OptimizationofIntra-LTENeighborRelationsisbasedontheLNREL-eCGIto
identifytherelatedLNADJinstancewiththesameeCGI,werecommendtoenable
LTE492andchangeallIPaddresscharacteristicstoenbControlled.Thisensures
thattheLNREL-eCGIisalwayscorrectlyassignedtotherelatedLNADJ-global-eNB-ID.
SothatthecorrectPCIvaluesareblacklisted.InadditionforLTE492:ANRitis
mandatorytohaveanup-to-datePCI/IPaddresstableincaseof
LTE468:PCIManagement-PCIchanges.

LTERL40,FeatureDescriptionsandInstructions

LTE782:ANR-Intra-LTE,Intra-frequency-FullyUE-basedThisfeaturecoversIntraLTE,Intra-frequencyautomatedneighborrelationconfiguration(ANR).Incasean
unknownphysical-layercellID(PCI)isdetectedandreportedbyaUEtotheFlexi
MultiradioBTS,thecorrespondingEUTRANCellGlobalID(ECGI)isderivedwiththe
helpoftheUE-measurements.TheFlexiMultiradioBTSresolvesthecorresponding
publicIPaddressofthenewfoundneighborFlexiMultiradioBTS,andestablishes
theX2connectiontoexchangeneighborcellinformation;alternatively,openstheX2
interfaceforcontrollayerapplications.
Note: Operatorhint:AsLTE771:OptimizationofIntra-LTENeighborRelationsis
basedontheLNREL-eCGItoidentifytherelatedLNADJinstancewiththesameeCGI,
werecommendtoenableLTE782andchangeallIPaddresscharacteristicsto
enbControlled.ThisensuresthattheLNREL-eCGIisalwayscorrectlyassignedto
therelatedLNADJ-global-eNB-ID.SothatthecorrectPCIvaluesareblacklisted.
OperationofLTE782:ANR-Intra-LTE,Intra-frequency-FullyUE-basedrequiresMME
supportforIPaddressresolutionbasedonglobal-eNB-ID.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

LTE53:IntraandIntereNBHandoverwithX2TheFlexiMultiradioBTSsupports
intra-frequencyintra-LTEhandoverviaX2.Boththeintra-eNBhandoverandthe
inter-eNBhandoverscenarioareincluded.DownlinkdataforwardingoverX2is
appliedforlosslessdatapathswitching.
LTE54:Intra-LTEHandoverviaS1ThefollowingS1basedintra-LTEhandover
scenariosaresupportedbytheFlexiMultiradioBTS:

inter-eNB,intra-MMEandintra-S-GW
inter-eNB,inter-MMEandintra-S-GW
inter-eNB,inter-MMEandinter-S-GW

LTE55:Inter-frequencyHandoverThefollowinginter-frequencyhandoverscenarios
aresupportedbytheFlexiMultiradioBTS:

Descriptionsofoperabilityfeatures

intra-eNB,inter-frequencyband
intra-eNB,intra-frequencybandwithdifferentcenterfrequency
inter-eNB,inter-frequencybandviaX2
inter-eNB,intra-frequencybandwithdifferentcenterfrequencyviaX2
inter-eNB,inter-frequencybandviaS1(ifenabled)
inter-eNB,intra-frequencybandwithdifferentcenterfrequencyviaS1(ifenabled)

LTE1019:SONReports
ThisfeaturedefinesSONfeaturelabels,thatareautomaticallyaddedascontext
informationforeachchangedonebyaSONfunctioninthenetworkconfiguration.In
theCMHistorytoolitispossilbetogenerateSONReportsshowingthechanges
donebyLTE771:OptimizationofIntra-LTENeighborRelations.
LTE1222:ANRAutoConfigurationandScheduling
ThisfeatureisasummaryofthescheduledactivationusecasesshiftedfromRL30
featurestoRL40features.

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.7.1.5

LTE771:Optimization of neighbor relations management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Table111:Newcounterslistscountersintroducedwiththisfeature.

Issue:01J

DN09185979

191

Descriptionsofoperabilityfeatures

Table111

LTERL40,FeatureDescriptionsandInstructions

Newcounters

Counter ID

Counter name

Measurement

M8015C1

IntraeNBHOattemptsperneighbourcell

HOattempts

M8015C8
(S1/X2)

NumberofIntereNBHandoverattempts
perneighbourcellrelationship

HOattempts

M8015C2

IntraeNBHOsuccessesperneighbourcell

successfulHO

M8015C9
(S1/X2)

NumberofsuccessfulIntereNBHandover
completionsperneighbourcellrelationship

successfulHO

Key performance indicators


Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table112:Newparameterslistsparametersintroducedwiththisfeature.
Table112

Newparameters

Full name

5.7.1.6

nrControl

LNREL

handoverAllowed

handoverAllowed

LNREL

Sales information
Salesinformation

BSW/ASW

SW component

License control in
network element

License control
attributes

ASWNetAct

NetAct

Abbreviations
Table114

Abbreviations

Abbreviations

192

Managed object

NeighborRelationControl

Table113

5.7.1.7

Abbreviated name

Description

ANR

AutomatedNeighborRelation

COC

CellOutageCompensation

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table114

Descriptionsofoperabilityfeatures

Abbreviations(Cont.)

Abbreviations

Description

inter-RAT

InterRadioAccessTechnology

MOC

ManagedObjectClass

MRO

MobilityRobustnessOptimization

TLA

TransportLayerAddress

NbEnb

NeighboreNB

NbCell

NeighborCell

NR

NeighborRelation

NRT

NeighborRelationTable

NI

NeighborInformation

RAT

RadioAccessTechnology

5.8 LTE877: Adjustable Performance Upload


Introduction to the feature
Thisfeatureallowstheoperatortoconfiguretheintervalofperformancedataupload
fromFlexiMultiradioBTStoNetAct.InRL30andearlierreleases,theuploadinterval
wasfixedto60minutes.

5.8.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:

adjustmentofperformancedataavailabilityaccordingtooperatorneeds
controlofdatatransferloaddistributioninthenetwork

5.8.2 Requirements
Software requirements
Table115:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

Issue:01J

DN09185979

193

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table115

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.8.3 Functional description


TheintervalofperformancedatauploadperFlexiMultiradioBTScanbeconfiguredto:

15minutes
30minutes
60minutes

TheintervalperiodissetduringtheactivationofPerformanceMeasurement(PM)planin
NetActandBTSSiteManager.Theperiodisconfiguredwithanew
reportingIntervalPmparameter.IfthenewfileuploadintervaldefinedinPMplan
islongerthanthecurrentinterval,thenewvalueisscheduledwhencurrentupload
intervalends.Ifthenewfileuploadintervalisshorterthanthecurrentinterval,thenew
valueisscheduledforthenearesttriggeringpointofthenewPMplan.
TheeNBperformsautomaticuploadoftheresultPMfilestowardsNetActaccordingto
definedschedulerightaftertheresultPMfilecreation.

5.8.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Theuploadintervalisconfiguredwithanewparameterthatispartofthesystem
configurationfile.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

194

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.8.5 LTE877: Adjustable Performance Upload management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table116:Newparameterslistsparametersintroducedwiththisfeature.
Table116

Newparameters

Full name
LTEPerformanceMeasurementData
ReportingInterval

Abbreviated name
reportingIntervalPm

Managed object
PMCADM

5.8.6 Sales information


Table117

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.9 LTE940: SW Verification Agent


Introduction to the feature
TheFlexiMultiradio10BTSprovidesasecuredboot-upandtheLTE940:SW
VerificationAgentfeatureverifiestheintegrityoftheeNBsoftwarebeforeitisrun.

5.9.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeatureofferssignificantlyenhancedriskmanagement.Onlyintegrity-verifiedcode
isacceptedforexecution.

Issue:01J

DN09185979

195

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.9.2 Requirements
Software requirements
Table118:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40MP

LBTS4.0

Table118

iOMS

Softwarerequirements

UE

NetAct

MME

SAE GW

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10BTSwithA.1xxorA.Mxxhardwareversion.

5.9.3 Functional description


Securebootenforcestheverificationandexecutionofintegrity-verifiedsoftwareina
predefinedsequentialorder.Thesoftwarethatverifiestheintegrityofthenextexecutable
softwareiscalledSoftwareVerificationAgent.SoftwareVerificationAgentsensurethat
nomaliciouscodeisinserted.
eNB boot-up phase
AttheeNBboot-upphase,theSoftwareVerificationAgentexaminesthesoftwareinthe
followingorder:
1. bootloader
2. operatingsystem
3. applicationsoftware
Eachpartofthesoftwareisintegrity-verifiedbeforeexecutingandgoingtothenextstep.
TheeNBbehaviorincaseofverificationerrordependsonthesoftwaretheeNBis
runningon:

196

eNBrunsSWwithhardsecuritydisabled
Ifanysoftwareintegritycheckfails,theeNBregisterstheeventinthesystemlogbut
theboot-upprocesscontinues.
eNBrunsSWwithhardsecurityenabled
Iftheintegrityverificationoftheprimarybootloaderfails,thealternativecopyofthe
software(passivebootloader)isintegrity-verifiedandifsuccessful,theboot-up
processcontinues.Iftheverificationoftheprimaryandpassivebootloaderfails,the
boot-upprocesscannotcontinue.Atthisphase,theeNBisnotaccessibleyetby
BTSSiteManagerandthereforemustbesentbacktothefactoryforrepair.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Iftheverificationofthebootloadersoftwaresucceeded,buttheintegritycheckofthe
operatingsystemfailed,theeNBcontinuestheboot-upprocessuntilIntegratedto
RANstate.Becauseofintegrityverificationfailure,theeNBisnotoperationalbut
thisstateallowsforeNBrestorationbynewsoftwareinstallationusingBTSSite
Manager.
FailedsoftwareintegrityverificationraisestheValidation of signed file failed fault
intheeNB.

Tip: RefertoReleaseDocumentationincludedtosoftwarereleasetoknowifthe
softwarepackagehashardsecurityenabledordisabled.
Feature activation and configuration
Thisfeaturedoesnotrequireactivationanditisswitchedonbydefault.However,before
installingasoftwarepackagewithhardsecurityenabledforthefirsttime,makesurethe
eNBisrunningsoftwarethatsignsnewsoftware(atleastRL40P8MPversion).For
detailedprocedure,seeReleaseDeliveryUpgradeInstructionsinRelease
Documentationincludedtoeachsoftwarepackage.

NOTICE:NotfollowingtheupgradingproceduredescribedinReleaseDocumentation
mightcausetheeNBtostopworkingandinsomecasestheneedtosendtheeNBto
thefactoryforrepair.

5.9.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.9.5 LTE940: SW Verification Agent management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Table119:Relatedexistingalarmslistsexistingalarmsrelatedtothisfeature.

Issue:01J

DN09185979

197

Descriptionsofoperabilityfeatures

Table119

LTERL40,FeatureDescriptionsandInstructions

Relatedexistingalarms

Alarm ID

Alarm name

7651

BASESTATIONOPERATIONDEGRADED*

7654

CELLOPERATIONDEGRADED*

7655

CELLNOTIFICATION*

AbovealarmsarecausedbythefollowingBTSfault: BTS SW download or activation failed


(faultids:29,30)
7650

BASESTATIONFAULTY
ThealarmiscausedbythefollowingBTSfault: Validation of signed file
failed (faultid:4145))

Measurements and counters


Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature

5.9.6 Sales information


Table120

Salesinformation

BSW/ASW

License control in network


element

License control attributes

BSW

5.10 LTE953: MDT (Minimization of Drive Test)


Introduction to the feature
Thisfeatureisintroducedasanalternativeforexpensivedrivetestsperformedduring
networkdeploymentandoptimization.Thesolutionfocusesoncoverageoptimizationin
theintra-frequencyLTEnetwork.

5.10.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits

198

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Thisfeaturebenefitstheoperatorasfollows:
asimplemethodtoanalyzethenetworkbehaviorinacertainareaforcoverage
optimizationpurposes
automatedcollectionoftracedatatogetherwiththeUEmeasurementsinformof
preconfiguredprofiles
OPEXandCAPEXsavingsasaresultofreducingresourcesneededtoevaluatethe
serviceandnetworkperformance(reductionofexpensivedrivetests)

5.10.2 Requirements
Software requirements
Table121:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table121

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.10.3 Functional description


ThefeatureoffersapredefinedsetofMDTprofilesavailableattheNetActTraceViewer
application.Theprofilesweredesignedtocoverthefollowingusecases:

detectionofcoverageproblemsintheneighborcell
detectionofcoverageproblemsinthetracedcell
monitoringthecoveragequalityofthetracedcell

Onepredefinedprofilecoversbothdetectionusecases.Thesecondprofilecoversthe
monitoringusecase.Foreachusecase,thereisasetofRRC,S1AP,andX2AP
protocolmessagesthatneedtobecollectedforfurtheranalysis.Thesolutionisbased
ondatathatiscollectedusingthefollowingfeatures:

LTE433:CellTrace
LTE644:Configurablecelltracecontent
LTE570:PeriodicUEMeasurements

ByselectinganMDTprofile,thecorrespondingconfigurationofthetracefeature
(togetherwiththeadditionalfeatures)andtheUEmeasurementsisdonefortheselected
area.ThemonitoringusecaseisbasedonperiodicUEmeasurements.Some

Issue:01J

DN09185979

199

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

modificationstoLTE570:PeriodicUEMeasurementsfeatureconfigurationare
introduced(thereportAmountandreportIntervalparametervaluerangesare
extended)tocollecteithermoremeasurementsperUEwithalongerintervalorless
measurementswithashorterinterval.AstheUEmeasurementrequestsmightcause
quiteabigloadinthenetwork,itisnotrecommendedtoapplyitinthewholenetworkat
thesametime.ThecollecteddataisavailableintheNetActTraceViewerora3rdparty
protocolanalyzer.
TheLTE953:MDTfeatureisactivewhenthe actMDTCellTraceparametervalueis
settotrue.IftheactMDTCellTraceparametervalueissettofalseduringanactive
tracesession,alltheMDTtracesessionswillbestoppedandMTRACEobjectsarenot
deleted.Inthiscase,theTraceViewermightnotshowthecorrectstatusofthetrace
sessionthathasbeenstopped.Therefore,itisrecommendedtodeletefirsttheMTRACE
objectsbeforesettingtheactMDTCellTraceparametervaluetofalse.

Note: InRL40,thesameparameterenablestheLTE570:PeriodicUEMeasurements
feature.InRL30,thisfeaturehasaseparateenablingparameter
(actPeriodicIntraUeMeas).

5.10.4 System impact


Interdependencies between features
Thisfeatureisbasedonthefollowingfeatures:

LTE433:CellTrace
LTE459:TimingAdvanceEvaluation
LTE644:Configurablecelltracecontent
LTE162:CellTracewithIMSI
LTE570:PeriodicUEMeasurements

TheLTE953:MDTfeaturereplacesLTE570:PeriodicUEMeasurements,soifthe
LTE953isdeployedinthenetwork,theLTE570isnotavailable.Theactivationof
periodicUEmeasurementsisdonetogetherwiththeactivationofcelltracewiththeMDT
profile.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
TheMDTprofilescanbeselectedusingtheNetActTraceViewerapplication.Theuser
selectstheprofileduringthetracesessioncreation.Theprofileincludes:

theselectionofprotocolmessagestobetraced
theconfigurationofperiodicintra-frequencyUEmeasurements(inthemonitoring
usecase)

Impact on system performance and capacity


Theimpactonsystemperformanceandcapacityiscomparabletotheimpactcausedby
LTE570:PeriodicUEMeasurementsandLTE433:CellTrace.

200

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.10.5 LTE953: MDT (Minimization of Drive Test) management


data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table122:Newparameterslistsparametersintroducedwiththisfeature.
Table122

Newparameters

Full name

Abbreviated name

ActivateMDTcelltrace

actMDTCellTrace

Managed object
LNBTS

Table123:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table123

Relatedexistingparameters

Full name

Abbreviated name

Managed object

PeriodicUEmeasurements(structure)

periodicUeMeas

LNCEL

Activatemeasurement

activateMeas

LNCEL

Measurementtype

measurementType

LNCEL

Reportamount

reportAmount

LNCEL

Reportinterval

reportInterval

LNCEL

Note: WiththeintroductionofLTE953:MDT,thereportAmountand
reportIntervalparametervaluerangesareextended.
ThepreviousenablingparameterforLTE570:PeriodicUE
Measurements(actPeriodicIntraUeMeas)isreplacedwithactMDTCellTrace
inRL40.

Issue:01J

DN09185979

201

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.10.6 Sales information


Table124

BSW/ASW

Salesinformation

License control in network element

ASWNetAct -

License control attributes


-

5.11 LTE1019: SON Reports


5.11.1 Description of LTE1019: SON Reports
Introduction to the feature
TheLTE1019:SONReportsfeatureprovidesareportmechanismfortheparameter
changesmadeinthenetwork,especiallywithafocusonautomaticchangesmadefor
configurationparameters.

5.11.1.1

Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Theoperatorgetsanoverviewofwhichparameterchangeshavebeenexecutedinthe
networkbywhich(SON)functionality.

5.11.1.2

Requirements
Software requirements
Table125:Softwarerequirementsliststhesoftwarerequiredforthisfeature.
Table125

Softwarerequirements

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

OMS

OMS4.0(RL40)

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

202

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

5.11.1.3

Descriptionsofoperabilityfeatures

Functional description
Functional overview
IntheLTEreleasesthesetofSONfeaturesexecutingautomaticparameterchangesis
increasing.
TheLTE1019:SONReportsfeatureprovidesareportmechanismfortheparameter
changesdoneinthenetwork,especiallywithfocustoautomaticchangesdonefor
configurationparameters.
TheNetActoriginatedSONfeatures,whichgenerateautomaticchangestoparameters
thatarekeptintheeNBCMdatabasecanmakeuseofthisfeatureandinclude
additionalinformationabouttheappliedchangetotheuser.
ThisreportingmechanismisnotlimitedtoSONfeaturesonly,butSONfeaturesarethe
onesusingitfirst.

5.11.1.3.1

Change origin report


Thechangeoriginreportprovidesthepossibilitiestoretrieveinformationfortheoperator
about:

whichfeaturehaschangedthevalueofaparameter
whichparametershavebeenchangedbywhichfeature
who(feature/operator)changedthatrelatedparameterandwhichchangehasbeen
done
whichchangeshavebeendoneinaspecifiedtimeframe

ThissolutionisappliedinthesamewayforNetActoriginatedSONfeaturesandaswell
applicabletootherfeaturesoutsideofSON.
Incaseofmanualoperator-drivenchangesfortheseparameters,thesechangesare
includedinthereportwiththeoperatorastheownerofthechange.
Dependingontheparameterchange,theoriginofthechangehastobegivenina
mannertoallowoperatorsunderstandingwhichfunctionalitychangedthevalue.Ifitis
notpossibletoassignadedicatedfeature,thenalsoakindofplaceholderisallowed
(whichatleaststillallowstodistinguishoperator/eNB-drivenchangesandcentral-driven
changes).
NetActprovidesthemeansfortheoperatortoaccessthischangeorigininformationand
togeneratereports.
Thefollowingfeaturesapplythechangeoriginreportmechanism:

Issue:01J

LTE539:CentralANR
LTE783:ANRInter-RATUTRAN
LTE784:ANRInter-RATGERAN
LTE510:SynchronizationofInter-RATNeighbors
LTE771:OptimizationofIntra-LTENeighborRelations
LTE581:PRACHManagement
LTE533:MobilityRobustness
LTE502:CellOutageTriggeredReset
LTE468:PCIManagement
LTE507:InterRATNeighborRelationOptimization(LTE,UTRAN,GERAN)

DN09185979

203

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

LTE962:RACHOptimization
LTE1367:AutomaticCellCombinationAssignmentforCarrierAggregation
LTE1808:AutomaticPUCCHCapacityOptimization
LTE1951:AutomaticConfigurationSupportforCAforMulti-carriereNBs
LTE2020:PRACHManagementOptimizationforHetNet

Configurable change history storage time


TheuserisabletoconfigurehowlongistheNetActCMhistorystored.Thetimeis
relatedtotheNetActcapacityanddetailsaredefinedinNetActdocumentation.

5.11.1.3.2

SON reporting mechanism


InFigure22:NetAct-originatedparameterchangetheorangelinedescribestheNetActoriginatedSONparameterchangewheretheOptimizersendstheSONfeature
informationinadditionwiththeplantotheConfigurator(containsCMplanprepare,CM
operations,CMmediator,CMeventhandler,RACAccessandCMhistoryUI).The
ConfiguratorpreparesandactivatestheplanintoeNB(s).Whentheplanisactivatedthe
eNB(s)sendstheconfigurationchangenotificationstotheNetActConfigurator.

Note: WiththeplanIDtheNetActisabletomapconfigurationchangesdoneintheeNB
toSONchanges(SONreport)activatedfromNetAct.
TheConfiguratorcorrelatestheSONfeatureinformationintochangedparameters.From
theCMhistorytheuserisabletoobtaintheinformationwhichSONfeaturehaschanged
theparameter(s).

204

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure22

Descriptionsofoperabilityfeatures

NetAct-originatedparameterchange
changepayload
Optimizer

changecontext
EM

CM
Plan
Prepare

ConfDB

eNB

CM
Operations

CM
Mediator

RAC
Access

CMEvent
Handler

ChlogDB

Correlator
CM
History
UI

SONReports
CMChangeHistory

5.11.1.3.3

Netact
Reporting
Suite

SONReports
CM+PMKPI

SON reporting content


NetAct originated SON features
arefeaturesthat:

NetActisresponsiblefortheparametersoptimization,decisionfortriggeringspecific
behaviorfortheoptimization/organizationofNEs
NetActhas/implementsdedicatedfunctions/algorithmsforthe
optimization/organizationpurpose
forexample:

Issue:01J

LTE539:CentralANR
NetActOptimizergeneratesadjacencyinformationandgeneratesparameter
configurationprovidingfortheautomaticcreationandestablishmentofneighbor
relationsbetweenFlexiMultiradioBTS.TheNetActmanagesthefeature
parameterchangeinformationintoNetActCMHistory.
LTE783:ANRInter-RATUTRAN
TheautomatedplanningofneighborrelationtoUTRANcellsisdoneonNMS
levelwiththehelpofNetActConfiguratorandOptimizer.Thisfeatureprepares
neighborrelationsforeachLTEcellintheoptimizationscopeandUTRAN
automaticallybasedoncurrentLTEandlegacyUTRANnetworkconfiguration
datawithanintelligentalgorithminOptimizertoidentifypossibleUTRAN
neighborcells.TheNetActmanagesthefeatureparameterchangeinformation
intoNetActCMHistory.

DN09185979

205

Descriptionsofoperabilityfeatures

206

LTERL40,FeatureDescriptionsandInstructions

LTE784:ANRInter-RATGERAN
TheautomatedplanningofneighborrelationtoGERANcellsisdoneonNMS
levelwiththehelpofNetActConfiguratorandOptimizer.Thisfeatureprepares
neighborrelationsforeachLTEcellintheoptimizationscopeandGERAN
automaticallybasedoncurrentLTEandlegacyGERANnetworkconfiguration
datawithanintelligentalgorithminOptimizertoidentifypossibleGERAN
neighborcells.TheNetActmanagesthefeatureparameterchangeinformation
intoNetActCMHistory.
LTE510:SynchronizationofInterRATNeighborsANRInter-RATGERAN
FeatureLTE783:ANRInter-RATUTRANandLTE784:ANRInter-RATGERAN
enableanoperatortoconfigureInter-RATneighborrelationswhennewLTE
eNBsareexisting/createdusingpre-planneddata(networkplanningand
configurationfiledownloadontoFlexiMultiradioBTS).TheestablishedInterRAT
neighborrelationsarealsoupdated/synchronizedautomatically.FeatureLTE510:
SynchronizationofInter-RATNeighborsaddsmechanismtoestablishnewInterRATneighborrelationsalsoincasenewUTRAN/GERANcellsarecreatedto
optimizationscopeofanexistingLTEcell.TheNetActmanagesthefeature
parameterchangeinformationintoNetActCMHistory.
LTE581:PRACHManagement
AnautomaticassignmentofPRACHsettingsisprovided.NetActOptimizer
derivesoutofinputparameterstheoutputparametersthatareusedinselected
eNB's.ThisprocessisembeddedintotheLTE720:AutoConfigurationframe
work.TheNetActmanagesthefeatureparameterchangeinformationintoNetAct
CMHistory.
LTE533:MobilityRobustness
Thisfeatureaimstoenableimprovementsofthesystemperformanceby
optimizingtheIntra-LTEradionetworkHO-configuration.Baseforevaluating
suboptimalHOperformancewillbetheexistingnewPMcounters,collectedby
theFlexiMultiradioBTSandreportedtoNetAct.NetActwillvisualizethePMcounters,indicateperformanceproblemsand,possibly,proposenewsettingsfor
theabovelistedparametersatspecificFlexiMultiradioBTS.Incaseof
parameterchangeNetActmanagesthefeatureparameterchangeinformation
intoNetActCMHistory.
LTE502:CellOutageTriggeredReset
Thedetectionmechanismoftheexistingfeature:CellOutageDetectionwillraise
dedicatedqualityofservicealarmforacellincaseithasbeendetectedas
"sleepycell".Basedonthisspecificalarmanactionwillbetriggered
automaticallytogetthecellbackintoservice.Incaseofparameterchange
(restartrequest)NetActmanagesthefeatureparameterchangeinformationinto
NetActCMHistory.
LTE468:PCIManagement
ThePhysicalCellIDassignmentisdoneautomaticallyandcollisiondetection
doesallowoperatortooptimizethenetworksettings.Automaticoptimizationis
supportedwithOptimizer.IncaseofparameterchangeNetActmanagesthe
featureparameterchangeinformationintoNetActCMHistory.
LTE771:OptimizationofIntra-LTENeighborRelations
NetActOptimizersupervisesallregisteredcellrelationsbetweenneighboring
LTEcellsiftheyarestillvalidandreliablecandidatestobeahandover
destination.Whentheoutcomeresultsinaninefficientneighborrelationthe
correspondingcellrelationmaybeblacklistedforhandover.Incaseofparameter
changeNetActmanagesthefeatureparameterchangeinformationintoNetAct
CMHistory.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

LTE507:InterRATneighborrelationOptimization(LTE,UTRAN,GERAN)
NetActOptimizersupervisesallregisteredInterRadioAccessTechnology(interRAT)neighborcellrelationsbetweenLTEcellsandnon-LTEcells.Their
performanceisgoodenoughsotheyareusedforahandover(HO)execution.
Whentheoutcomeresultsinaninefficientneighborrelation(NR),theindividual
mobilityproceduresofNRsmightbeblacklistedforanHO.
LTE962:RACHOptimization
TheLTE962:RACHOptimizationfeatureoffersanautomatedsolutionfor
optimizationofRACHparametersusedinLTEcells.Itidentifiesandresolves
conflictsandinconsistenciesarisingduetoincorrectconfigurationofRACH
parameters.TheNetActOptimizersupportstheRACHconflictandinconsistency
detectionandresolution.
LTE1367:AutomaticcellcombinationassignmentforCarrierAggregation
TheLTE1367:Automaticcellcombinationassignmentforcarrieraggregation
featureintroducesanautomaticalgorithmtodetectandconfigurecellpairsofa
certaineNBappropriateforacarrieraggregationfunctionality.Itcanbeused
duringplanningactivitiesintheNetActOptimizer.
LTE1808:AutomaticPUCCHCapacityOptimization
TheautomaticPhysicalUplinkControlChannel(PUCCH)capacityoptimizationis
aSONfeatureworkinginahybridmanner.Basedonperformancemanagement
dataandactualconfigurationinformation,aniSONmanagerdeterminesanew
optimizedPUCCHanddependentconfigurationchanges.Thesechangesmay
resultinconfigurationchangesthatareautomaticallydownloadedandactivated
ifrequested.
LTE1951:AutomaticConfigurationsupportforCAformulti-carriereNBs
TheLTE1951:AutomaticConfigurationsupportforCAformulti-carriereNBs
featureisaNetActSONsolutionofferinganautomaticassignmentofthecellsfor
theusageoftheLTE1562:Carrieraggregationformulti-carriereNBsfeature.
TheNetActOptimizerprovidesanalgorithmthatautomaticallydeterminesthe
cellsofoneeNBthatareappropriatefortheLTE1562:Carrieraggregationfor
multi-carriereNodeBandLTE2033:Additionalcarrieraggregationband
combinations-Ifeatures.Thealgorithmdetectsoverlappingcellsinexactlythe
samemannerasintheLTE1367:Automaticcellcombinationassignmentfor
CarrierAggregationfeature.
LTE2020:PRACHManagementOptimizationforHetNet
TheLTE2020:PRACHManagementOptimizationforHetNetfeatureisan
additiontoPRACHManagementalgorithms(LTE581:PRACHManagementand
LTE962:RACHOptimization)andthusthemainrulesandusecasesforthese
featuresstillremaininplace.

SON parameter change content in the eNB

Note: IncaseofaplanoriginatedSONchangeintheeNB,theeNBincludesthePlan
IDandthechangeoriginintheconfChangeOrigininformationintheCMevent.
ThePlanIdandthechangeOriginintheconfChangeOriginimprovestheusabilityofthe
changeorigininformationintheNetAct.TheSONhistoryfeatureinNetActisableto
correlateCCN'swithactivatedplanwhentheplanIDisincludedinCCN's.TheeNBfills
intheplanIDandchangeOriginintoCCN's.
TheNetActconfigurationmanagementisabletocorrelateplanIDtorelevantSON
featureincasethechangeismadebyNetActOptimizer.

Issue:01J

DN09185979

207

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Note: FortheLTE1019:SONReportsthedataarecoveredbythespecificfeature
impactedbythegenericfeatureitself.

LTE507:Inter-RATNeighborRelationOptimization
LTE1383:Cell-specificNeighborRelation/PCIHangling
LTE556:ANRIntra-LTEInter-frequencyUEBased
LTE1708:ExtendMaximumNumberofX2Links
LTE908:ANRInter-RATUTRAN-FullyUEBased
LTE1685:NeighborRelationRobustness
LTE1821:NeighborDetectionOptimizationforNetNet
LTE1822:PCIAssignmentOptimizationforHetNet
LTE1823:NeighborPrioritizationOptimizationforNetNet

Change origin information listed for all NetAct SON features


ThechangeorigininformationindicatedtotheoperatorislistedforallNetActSON
features:

5.11.1.4

LTE539:CentralANR
LTE783:ANRInter-RATUTRAN
LTE784:ANRInter-RATGERAN
LTE510:SynchronizationofInter-RATNeighbors
LTE771:OptimizationofIntra-LTENeighborRelations
LTE581:PRACHManagement
LTE533:MobilityRobustness
LTE502:CellOutageTriggeredReset
LTE468:PCIManagement
LTE492:ANR
LTE720:SONLTEBTSAutoConfiguration
LTE507:InterRATneighborrelationOptimization(LTE,UTRAN,GERAN)
LTE962:RACHOptimization
LTE1367:AutomaticcellcombinationassignmentforCarrierAggregation
LTE1808:AutomaticPUCCHCapacityOptimization
LTE1951:AutomaticConfigurationsupportforCAformulti-carriereNBs
LTE2020:PRACHManagementOptimizationforHetNet

System impact
Interdependencies between features
SONfeaturesmakinguseofchangeoriginreports.
Thefollowingfeaturesapplythechangeoriginreportmechanism:

208

LTE539:CentralANR
LTE783:ANRInter-RATUTRAN
LTE784:ANRInter-RATGERAN
LTE510:SynchronizationofInter-RATNeighbors
LTE771:OptimizationofIntra-LTENeighborRelations

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

LTE581:PRACHManagement
LTE533:MobilityRobustness
LTE502:CellOutageTriggeredReset
LTE468:PCIManagement
LTE507:InterRATneighborrelationOptimization(LTE,UTRAN,GERAN)
LTE962:RACHOptimization
LTE1367:AutomaticcellcombinationassignmentforCarrierAggregation
LTE1808:AutomaticPUCCHCapacityOptimization
LTE1951:AutomaticConfigurationsupportforCAformulti-carriereNBs
LTE2020:PRACHManagementOptimizationforHetNet

Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeatureimpactsnetworkmanagementandnetworkelementmanagementtoolsas
follows:

NWI3managedobjectextensionistakenintouseineNBandNetAct

Impact on system performance and capacity


Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.11.1.5

Management data
FortheLTE1019:SONReportsfeaturethedataarecoveredbythespecificfeature
impactedbythegenericfeatureitself.
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.11.1.6

Sales information
Table126

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

209

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.12 LTE1045: Full SON support for distributed sites


5.12.1 Description of LTE1045: Full SON Support for Distributed
Sites
Introduction to the feature
TheLTE1045:FullSONSupportforDistributedSitesfeatureintroducesdifferentiationof
informationatanantennasite'slocationfordistributedsitedeployments.
TheSONalgorithmscalculatingpossibleneighborsitesareadaptedtoconsiderthesite
locationinformationfromantenna.
MostoftheSONfeaturesarebasedin3sectorsitedeploymentwith:
commonsitelocationforallcells
handlingofallcellsofoneeNBcommonly
upto200mdistancebetweensystemmoduleandRFunit
outdoormacronetworkdeployment

5.12.1.1

Benefits
End-user benefits
TheLTE1045:FullSONSupportforDistributedSitesfeaturedoesnotaffecttheenduserexperience.
Operator benefits
ThedistributedsitesspecificsareconsideredinSONalgorithms,allowingafullfeature
support.

5.12.1.2

Requirements
Software requirements
Table127:SoftwarerequirementsliststhesoftwarerequiredfortheLTE1045:FullSON
SupportforDistributedSitesfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table127

OMS

OMS4.0(RL40)

Softwarerequirements

UE

NetAct

MME

SAE GW

notrelevant

OSS5.4CD2

notrelevant

notrelevant

Hardware requirements

210

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

TheLTE1045:FullSONSupportforDistributedSitesfeaturerequiresthefollowing
hardware:

5.12.1.3

FSMR2
FSMR3

Functional description
Functional overview
Thisfeatureincludestheintroductionofantennalocationinformationdifferentiationfor
distributedsitedeployments.

supportofRRH(remoteradiohead)configurations
supportofBTShotelconfigurations

TheSONalgorithmscalculatingpossibleneighborsitesareadaptedtoconsiderthesite
locationinfofromantenna.
ThefollowingSONfeaturesareenhancedbyLTE1045:FullSONsupportfordistributed
sitesfeature:

LTE468:PCImanagement
LTE539:CentralANR
LTE492:ANR
LTE581:PRACHmanagement
LTE783:ANRInterRATUTRAN
LTE784:ANRInterRATGERAN
LTE510:SynchronisationofInterRATneighbors
LTE1821:NeighborDetectionOptimizationforHetNet
LTE1822:PCIAssignmentOptimizationforHetNet
LTE1823:NeighborPrioritizationOptimizationforHetNet
LTE2020:PRACHManagementOptimizationforHetNet

tosupport:

geo-locationpercell
theinputofantennageo-locationdataisdonemanuallybytheoperator
checkfordistributedsitedeploymentviatheLNBTS -parameter

actDistributedSite = <true, false>


TheapproachisalsoapplicableforRFchainingwithseparatecells.

Note: DistributedGERANandUTRANsitesareoutofscopeofthisfeature.The
correctprovisionofGERANandUTRANcellgeo-locationdataisabasicrequirement
fortheLTE783:ANRInterRATUTRAN/LTE784:ANRInterRATGERANfeature.
User scenarios
ThefollowinguserscenariosarepartofthisfeatureandaresupportedbybasicNetAct
functionality.ForthosefeaturesnoadditionalSWrequirementsarerequired:

Issue:01J

DN09185979

211

Descriptionsofoperabilityfeatures

5.12.1.3.1

LTERL40,FeatureDescriptionsandInstructions

Settingofsitegeo-locations(minimumrequirementforSONfeatures)Thenetwork
operatorwantstostoreatNetActthesitegeo-locationsbeforetheLTEeNBare
installedorduringtheoperationofaneNB.Hewantstoenterthegeo-locations
manuallyorimportviatoolatItf-N.HewantstoidentifyaneNBwithitsglobaleNB
ID,sitenameorcellname.
FindingofdistributedRRHconfigurationswithantennageo-locationsandmissing
geo-locationdata.Thenetworkoperatorwantstolistcellsforthosenoantennageolocationisavailable.Hewantstosee,forwhatcellssomedataisstillmissing.Those
eNBswithasitegeo-locationthatisequaltotheantennageo-locationaremarked
accordingly.
Findingofantennageo-locationswithdistributedantennageo-locations.Thenetwork
operatorwantstolistcellswithdifferentantennageo-locationthanthesitegeolocation.Hewantstoseethedistancebetweensiteandantenna,toverifyquicklythe
correctsettingataneNB.
Re-executionofSONfeatureswithupdatedantennageo-locations.Thenetwork
operatorwantstohaveupdatedparametersettingsforthoseSONfeaturesthatare
beforeexecutedonsitegeo-locations,andarelateronexecutedwiththenewlyset
ofantennageo-locations.Inadditionanyupdateofgeo-locationdata(corrected
values)isconsideredforthenextexecutionofaSONfunction.

NetAct Optimizer
ForsupportofdistributedRRHandBTShotelconfigurationtheserviceareaofacellcan
beupto20km(LTE614:DistributedSite)awayfromtheBTSlocation.Theservicearea
isdefinedratherbythelocationoftheantennathantheBTShardware.Totakethe
differenceinlocationintotheaccount,theNetActcellsupportstheusageofantenna
coordinateinformationinthecentralizedSONsolutionswhereapplicable.
Iftheantennacoordinateismissing,NetActusesthesitecoordinateinformationinstead.
Ifalsothesitecoordinationismissing,therelatedobjectisexcludedfromSON
algorithms,theprocessabortsandtheuserisinformed.Fordistributedsitesthe
antenna/cellgeo-locationdataaremandatory.Ifthosearenotavailable,theeNBplanfile
isnotconsistentandthedownloadisnotallowedbyNetAct.TheSONfunctionrunning
inauto-configurationorscheduledmodeaborts.
ForPRACHandPCImanagement,theNetActrequiresgeo-locationdatafordistributed
siteconfigurations.Ifthosearemissing,theSONfunctionisstoppedandtheoperatoris
informed.TheNetActidentifiesadistributedsiteconfigurationbythevalueofLNBTS
actDistributedSiteparametertobesettotrue.
TheNetActsupportstheusageoftheantennacoordinateinformationfor:

212

LTE468:PCIManagement
TheNetActOptimizerconsiderstheantennacoordinateswhenoptimizingthePCI
reusedistance.Consistencycheckfunction.
LTE539:CentralANR
TheNetActOptimizerconsidersantennacoordinateswhencreatingthelistof
preconfiguredneighboringeNBs(LNAJDLs).
LTE492:ANR
TheNetActOptimizerconsidersantennacoordinateswhenbuildingthePCI-RF-IP
addressmappingtableentriesfromwithinthesearchdistancebasedontheranking
(priorityfunction).
LTE720:SONLTEBTSAutoConfiguration

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Issue:01J

Descriptionsofoperabilityfeatures

TheNetActOptimizerincludesinformationintothefeedbackmessages,where
antennacoordinatesweremissing,thefallbacktositecoordinateshashappened
andwherecoordinateinformationintotalismissing.Fordistributedsitesthe
antenna/cellgeo-locationdataaremandatory.IfthosearenotavailabletheeNBplan
fileisnotconsistentanddownloadisnotallowedbytheNetAct.
LTE581:PRACHManagement
TheNetActOptimizerconsidersantennacoordinateswhendeterminingthePRACH
configurationreusedistance.
Consistencycheckfunction.
LTE783:ANRInterRATUTRAN
TheNetActOptimizerconsidersantennacoordinatesinrankingtheneighborrelation
candidates(priorityfunction)anddefiningthesearchdistance.
LTE784:ANRInterRATGERAN
TheLTE1045:FullSONSupportforDistributedSitesfeatureusesLTEsiteand/or
LTEantennageo-locations,insteadofcurrentlythesitegeo-locationonly.The
GERANgeo-locationsareprovidedassitelocations.TheLTEfeaturemakesuseof
GERANcell/antennageo-locationsasinput.
LTE510:SynchronizationofInterRATNeighbors
TheNetActOptimizerconsidersantennacoordinateswhenautomaticallydefining
theLTEscopeforwhichsynchronizationisexecuted.
Inallmanual,interactiveexecutionofrelevantabovefeaturecomponents,theNetAct
Optimizerinformstheuserup-frontaboutmissingcoordinateinformation.Theuser
canthendecidetofixthemissinginformationortocontinuewithfallbackorskipping
theobjectswithmissinginformation(excludefromSONoperation).Fordistributed
sitestheantenna/cellgeo-locationdataaremandatory.Ifthosearenotavailable,the
eNBplanfileisnotconsistentanddownloadisnotallowedbytheNetAct.
Note: TheLTE614:DistributedSitesfeaturerequiresacorrectupgradeinRL40.Here
theantenna/cellgeo-locationdatawillbemandatoryandneedtobecorrectly
referencedbythecellobject.ASONfunctionbasedongeo-locations(as
LTE539:CentralANR,LTE468:PCIManagement,LTE492:ANR,
LTE510:SynchronisationofInterRATNeighbors,LTE783:ANRInterRATUTRAN,
LTE784:ANRInterRATGERAN)checksalotof(potential)neighbors;thereforenotonly
thedefinedscopeofcellneedtohaveconsistentdata,butalsotheothercells.In
numerouscasesNetActscansthroughallcells.ForexamplethePCIvaluesofannew
eNB'scellscanonlybecorrectlyassigned,ifallpotentialneighborscanbeidentifiedby
theirantennageo-locationtoobtainthelistofusedPCIvaluesintheneighborhood.
Note: TheeNB-basedANRfeaturesLTE492:ANRandLTE782:ANRFullyUEbased
arebasedonthebasicmobilityhandlingoftheeNB.Themobilitymanagementrequires
uniquePCIvaluesforallneighborcellsofoneeNB.Thisisfordistributedsite
deploymentsnotconsideredinstandard3GPPcompliantPCImanagement.TheANR
functionwillfindinonecellaPCI/CGI.DistributedcellsmighthaveotherPCI/CGI
assignments.ItdependsonthefirstUEreportingthePCIinonecell,andthereforethis
PCI/CGIassumptionsmightbewrong.TheLTE468:PCIManagementfeatureknows
thiseNBbehaviorandassignsPCIuniqueoneNBlevelaswell.

DN09185979

213

Descriptionsofoperabilityfeatures

5.12.1.3.2

LTERL40,FeatureDescriptionsandInstructions

Note: TheLTE1195:FHCCFlexi850RepeaterInterfaceUnit(RIU)orsimilar
LTE1106:FHCBFlexiRRH2TX850LowPowerforOpticalRepeaterInterfaceand
LTE1337:FHECFlexiRRH2TX1800LowPowerfeaturesrepresentrepeaterunitsthat
areusuallyinstalledwithinthesamecovarageareaasthemacrocell.Therefore,the
LTE1045:FullSONSupportforDistributedSitesfeaturehastocheckonlyforthe
macrocell.Asrepeatersupportsadedicatedmode,wherearepeaterisconfiguredlike
anormalcellwithupto20kmdistance,theoperatorneedstoconfigurethecorrect
antennageo-locationdataatNetAct.The
LTE1045:FullSONSupportforDistributedSitesfeaturedoesnotcheckconsistencyof
suchspecialdeployments,asthoseareoften3rdpartyproducts.
Note: ForRepeaterconfigurations(the
LTE1195:FHCCFlexi850RepeaterInterfaceUnit(RIU)feature)workingindedicated
repeatermode,theoperatorhastocareforthecorrectantennageo-locationdata
setting.Therepeaterconfigurationsarenotconsideredinthedeploymentcompatibility
check(asfortheLTE614:DistributedSite).

NetAct use case


ThisusecasedescribesthepreparationphasefortheinstallationofaneweNBwith
distributedcellconfiguration.TheoperatordoesselectoneormoreeNBstobeautoconfiguredwithinthenextplannednetworkroll-outphase.
Preconditions
TheeNBplanfileiscontainingthetransportandtheequipmentconfiguration.The
plannedradioconfigurationwithoutanySONfeaturegeneratedcontentisavailableand
therequiredcellsandPLMNconfigurationisinplace.Noantenna/cellcoordinatesare
provided,butthesitecoordinatesareavailableatNetActfromplanningdata.The
plannedsitehaveadistributedcellconfiguration.
Description
ThefollowingstepsaresupportedbyNetAct:
1. TheoperatorstartsatNetActConfiguratortheSONworkflowforthisplannedeNB.
2. Theoperatoractivatesthefeaturedistributesiteconfiguration(theLTE614:
DistributedSite)forthissite.
3. NetActcheckstheavailabilityofcell/antennageo-locationdata.NetActinformsthe
operatoraboutthemissingdataandblocksthedownloadoftheeNBplanfile.NetAct
doesnotallowtheexecutionofSONfunctionsforthiseNB.
4. Theoperatorconfiguresallrequiredcell/antennageo-locationdata.
5. NetActcheckstheavailabilityofcell/antennageo-locationdata.NetActallowsthe
activationofSONfunctionsforthiseNB.
6. TheoperatorcancontinuetheexecutionofSONfunctionsforthiseNB.
Post conditions
Fordistributedsitesthecell/antennageo-locationareavailableandallSONfunctionin
theauto-configurationsuitecanoperateasdefined.

5.12.1.4

System impact
Interdependencies between features

214

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

ThefollowingSONfeaturesconsiderthenewlocationinformation:

Issue:01J

LTE614:DistributedSite
TheDistributedSiteSolutionisaLTEBTSsitewherethedistancebetweenthe
SystemModuleandRFModuleorRRHcanbeupto20km.Thesinglemodeoptical
cablesandsinglemodeopticaltransceivers(SFP)needtobeusedtoconnectthe
SystemModuletotheRFModuleorRRH.
LTE977:RFChaining
RFunitscanbechainedinDistributedLTEBTSconfigurationstosupportextended
andoptimizedcoverageandcapacity.InfeederlessLTEBTSconfigurationsthe
lengthofopticalcablescanbeminimized.UptotwoRFUnits(onecellRRHorRF
Modulewith2TXMIMO)perchainandupto3chainshencemaximum6RFunits
andLTEcellsperoneSystemModule(FSME).
LTE973:FlexiRFModule4TX2500FZOB
OnecellFlexiRFModuleisabletosupport4-branchbeamforming.Itenableseasy
installationoutdoorsclosetoantennasthusmaximizingBTSsitecapacityand
coverageforonesector.ThedistancebetweentheRFmoduleandtheSystem
moduleupto200m(MultimodeSFP)andupto40km(SinglemodeSFP)is
supportedbythehardware.
LTE468:PCIManagement
Thisfeatureusessiteand/orantennageo-location.Today,theeNBcallprocessing,
doesconsiderallconfiguredPCIvalueoneNBlevel,todecideonunknownPCI
valuesforANRfeatures.Theassumptionis,thatthelearningofonecellcanbe
reusedfortheothercells.Fordistributedcells,itisbettertohaveonlytheowncell's
relationshipsconsideredforPCIcollisionorconfusiondetectionandsendingthe
eNBalarm.OnNetActlevelthereusedistanceisbasedtodayonthesitelocation,
butwhentheantennalocationsareprovidedthoseareused,thisispreparedfor
LTE1045:FullSONSupportforDistributedSites.
LTE539:CentralANR
Thisfeatureusessiteand/orantennageo-locations,insteadofcurrentlythesitegeolocationonly.ThebestcelloftheneighborwilldefinetheeNBneighborship.
LTE492:ANR
Thisfeatureusessiteand/orantennageo-locations,insteadofcurrentlythesitegeolocationonly.Becauseofthere-useoftheLTE539:CentralANRalgorithm,alsohere
aneNBaspectisconsidered,asthebestcelloftheneighborwilladdalsoallother
cellsimmediately.Possiblywithdistributedcelllocationsonlytherelevantcellsneed
tobeadded.
LTE720:SONLTEBTSAutoConfiguration
ThisfeatureexpectscomplianteNBplanfiletobedownloadedandactivated.A
missinggeo-locationdoesleadtosub-optimalconfigurationofLTE468:PCI
ManagementandLTE581:PRACHManagementparameter.Therefore,LTE1045:
FullSONSupportforDistributedSiteshasimpactonLTE720:AutoConfigurationto
aborttheauto-configurationandtogivefeedbacktotheoperatoraboutthis
incompliantsituation
LTE581:PRACHManagement
Thisfeatureusessiteand/orantennageo-locations,insteadofcurrentlythesitegeolocationonly.Thisfeaturedoesworkoncelllevelyet.Assoonasthecelldataare
givenfordistributeddeployments,thenintrinsicallythealgorithmworkscorrectly.
LTE783:ANRInterRATUTRAN
ThisfeatureusesLTEsiteand/orLTEantennageo-locations,insteadofcurrentlythe
sitegeo-locationonly.TheUTRANgeo-locationsareprovidedassitelocations.The
LTEfeatureusesUTRANcell/antennageo-locationsasinput.

DN09185979

215

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

LTE784:ANRInterRATGERAN
ThisfeatureusesLTEsiteand/orLTEantennageo-locations,insteadofcurrentlythe
sitegeo-locationonly.TheGERANgeo-locationsareprovidedassitelocations.The
LTEfeaturemakesuseofGERANcell/antennageo-locationsasinput.
LTE510:SynchronisationofInterRATneighbors
ThisfeatureusesLTEsiteand/orLTEantennageo-locations,insteadofcurrentlythe
sitegeo-locationonly.TheUTRAN/GERANgeo-locationsareprovidedassite
locations.TheLTEfeaturemakesuseofUTRAN/GERANcell/antennageo-locations
asinput.

TheapproachisalsoapplicableforRFchainingwithseparatecells.
Thefeaturehasnoinfluenceonthefollowingfeatures:

LTE154:SONLTEBTSAutoConnectivity
LTE663:GPSLocationandTimeRetrieval
LTE1019:SONReports

Theauto-connectionfeaturessupportsitegeo-locationmappingtothepreparedeNB
planfileatNetAct.Theydontsupportantennageo-locationconfiguration.Thesettingof
theantennageo-locationdataisnotgeneratingaSONReport(LTE1019:SONReports,
assettingofthosedataismanualconfiguration.
Impact on interfaces
TheLTE1045:FullSONSupportforDistributedSitesfeaturehasnoimpacton
interfaces.
TheLTE1045:FullSONSupportforDistributedSitesfeaturehasnoimpactonnetwork
managementornetworkelementmanagementtools.
Impact on system performance and capacity
TheLTE1045:FullSONSupportforDistributedSitesfeaturehasnoimpactonsystem
performanceorcapacity.

5.12.1.5

Management data
FortheLTE1045:FullSONSupportforDistributedSitesfeaturethedataarecoveredby
thespecificfeatureimpactedbythegenericfeatureitself.
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

216

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

5.12.1.6

Descriptionsofoperabilityfeatures

Sales information
Table128

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.12 Variable Definitions

5.13 LTE1078: System Upgrade with Backward


Compatibility
Introduction to the feature
ThisfeatureenablesthesmoothupgradefrommajorreleaseRL30toreleaseRL40in
theoverallnetwork.

5.13.1 Benefits
Operator benefits
Thisfeaturebenefitstheoperatorinsmoothremoteupgradepathfrommajorrelease
RL30toreleaseRL40.

5.13.2 Requirements
Software requirements
Table129:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table129

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2plusPCD

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.
ThisfeaturedoesnotincludetheupgradeofFlexiSystemModuleFSME/FSMDto
FSMF.

Issue:01J

DN09185979

217

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.13.3 Functional description


Functional overview
ThesystemupgradeisperformedinatopdownapproachstartingwithNetActfollowed
byOMSandfollowedbyaneNBSWupgradeasshownintheFigure23:Topdown
upgradeapproach.Serviceoutagesareminimizedbyusingavailableresiliencyfeatures
andhardwareredundancyasfaraspossible.Itisnotpossibletotakethewholesystem
outofservicetointroducethenewSWrelease.
Asaconsequenceofthisapproach,NetActsupportsatleasttwoOMSreleasesandtwo
eNBreleases(LBTS4.0,LBTS3.0).OMSofSWreleaseRL40supportstwoeNB
releases(LBTS4.0,LBTS3.0).AlsomixedeNBandOMSconfigurationsaresupported
byOMSandNetAct.

Note: ItispossiblealsotoperformsystemupgradefromRL30toRL40MP1directly.
Figure23

Topdownupgradeapproach

NetAct
releasen
Step1
NetAct
releasen

Step2

topdown

OMS(1)
releasen

OMS(2)
releasen-1

Step3

eNB(1)
OMS(1)
releasen
releasen

OMS(1)
eNB(2)
releasen-1
releasen

OMS(1)
eNB(3)
releasen
releasen-1

eNB4)
releasen-1

Upgrade path

NetActupgrade

OSS5.3MP1->OSS5.3MP2->OSS5.4CD2plusPCD
OSS5.3MP1->OSS5.4CD1->OSS5.4CD2plusPCD

FormoreinformationonNetActupgradeseeDescriptionoftheCommissioning
andUpgradeProcedure,availableinNOLSatthefollowingpath.
ProductInformation->ProductFinder->OperationsSupportSystems->Network
andServiceManagement->NetAct(OSS5):Documentation->NetAct,Rel.OSS5.4
CDSet2PriorityCD,OperatingDocumentation,issue01
OMSupgrade
LTE OMS 3.0 -> LTE OMS 4.0
eNBupgrade
SW upgrade LBTS3.0 -> LBTS4.0

The following functionality is supported with the upgrade from RL30 to RL40:

218

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

1. SupportedRL30SWversionsforonestepupgradetowardsRL40arelistedinthe
RL40ReleaseDocumentation.
2. Alloperatorconfigureddataismaintainedinthesystem.Configurationdatais
convertedintoanewformat.Thisimpliesthatthedatafromthepreviousreleasecan
bereusedaftertheupgrade.Nomanualinterventionisrequired.
Thisdataincludes:
a) allconfigurationdataoftheFlexiMultiradioBTS
b) adaptationsdonebyoperatorfordifferent(graphical)presentationsinBTSSMor
NetAct(forexampletopleveluserinterface:topologyview)
TheeNBdatamigrationisperformedautomaticallybytheeNBduringthe
startupphaseofthenewSW.Themigrationoperationincludes:
a) copyingconfigurationdatafromreleaseLBTS3.0
b) checkingdatacompatibility
c) preparingdataforthenewSWrelease,likeconversionofparameterstothenew
formatand/orprovisionofdefaultsforparametersorparametervaluewhere
necessary
ThedatamigrationincludesallconfigurabledatalikeeNB,TRSandRNW
configurationdata.OMSisrequiredtoprovideconversionforinternalOMS
configurationdatalikeLDAPparameters(includinguseraccounts)and
autoconnectiondata.
Noconversionfortopologyandalarmsisneeded,becausethisdataisregainedfrom
eNBafterrestart.
WhiletheeNBdataconversionloggingisenabled,thedataconversionexceptions
canbeanalyzedfromthelogfile.Thisispossibleevenifdataconversioncaused
fallback.Logfileiskeptresetsafe.DifferentlogfilesareinuseforTransportand
BTS/RNWdataconversionlogging.
3. Systemdataisstoredbeforesystemupgrade.Thedataisavailableafterupgrade.
Thisdataincludes:
a) usersecurity,forexampleuseraccounts/passwords,logfiles
b) networksecurity,forexamplecertificates,keys
Nomanualactivitiestoreconfigureorreloadsystemrelateddataisnecessary.
4. BTSSMispreparedtohandlebotheNBreleases,atleastasco-existingversionsof
BTSSMwithreleaseRL40.
5. Thedowntimeofanetworkentityduringthesystemupgradeisreducedtothe
activationofthenewsoftware.Theswitchtothenewrelease(activationofthe
software)isperformedonoperatorrequestfromNetActorBTSSM.
6. Incaseofanupgradefailureanautomaticfallbacktotheoriginalreleasetakes
place.TheautomaticfallbackavoidsasituationwhereaneNBiscompletelyoutof
serviceandservicepersonnelisneededonsiteforrepairaction.Inadditionthe
fallbackcanbeinitiatedonoperatorcommandfromNetActorBTSSM.
Automatic fallback
TheeNBperformsautomaticfallbacktoformerSWversionandformerconfiguration
dataincaseofcriticalSWexceptions.Nomanualinteractionisnecessary.
Criticalexceptionsareforexample:

Issue:01J

SWdoesnotstartup(restartloop),thelimitisthreerestartsinashortperiodoftime
dataconversionexceptions-atleastcriticalones

DN09185979

219

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Whilesomeabnormalexeptionoccuresserviceinterruptionmustbeminimized.When
eNBdoesnotstartupwithnewSWversionitisnotpossibletoentermanualcommands
(likemanualfallback).Toavoidneedforon-siterepairtheautomaticfallbackisprovided.
ItisimportanttofallbacktoformerSWaswellasDB,tocoverexceptionscausedby
faultydataalso.
DuringSWfallbacknologfilesarelost.Thosedataisstoredforerroranalysispurpose.
Manual fallback
WhileSWupgradeisnotfinished,itispossibletotriggertheeNBfallbacktoformerSW
releaseandconfigurationremotely.
ManualfallbackispossibleaslongasconnectiontoeNBisestablished.

5.13.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.13.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Table130:Relatedexistingalarmslistsexistingalarmsrelatedtothisfeature.
Table130

Relatedexistingalarms

Alarm ID
7651

Alarm name

BASE STATION OPERATION DEGRADED

Measurements and counters


Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

220

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.13.6 Sales information


Table131

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.14 Description of LTE1201: LTE iOMS HW, HP Blade


Gen8
Introduction to the feature
ThisfeatureintroducesnewHWforLTEiOMStoreplaceHPProLiantBL460cG6innew
deliverieswithHPProLiantBL460cGen8.

5.14.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:

Itlowerssitecosts.
OMSsarelocatedattheNetActsite,whichminimizesthemaintenancecostsand
savesspace.

5.14.2 Requirements
Software requirements
Table132:Softwarerequirementsliststhesoftwarerequiredforthisfeature.
Table132

Release

Softwarerequirements

System release eNode B

NetAct

MME

SAE GW

RL40

Hardware requirements
ThisfeaturerequirestheHPBladeBL460cGen8.

5.14.3 Functional description


Functional overview
WiththisfeatureOMSHWcanbereplacedwiththenewHPBL460cBladeGen8.The
newHWallowsreachingnewefficiencyvaluesotherwiseunavailable.

Issue:01J

DN09185979

221

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

5.14.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on commands
Therearenocommandsrelatedtothisfeature.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
ThenewHWincreasescomputingpowercomparingtotheBL460cG6.

5.14.5 LTE1201: LTE iOMS HW, HP Blade Gen8 management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.14.6 Sales information


Table133

222

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

5.15 LTE1222: Inter-RAT Auto Setup and Scheduled


Optimization
5.15.1 LTE1222: SON Automation Modes
Introduction to the feature
WiththeLTE1222:SONAutomationModesfeaturetheinter-RATneighbor-related
featuresandoptimizationofintra-LTEareexecutedinanautomaticmanner.
ThefeatureLTE1222:SONAutomationModesitselfisabasicfeatureadding
functionalityfortheexistingcentralizedSONfeatures.TheinteractionwithLTE1019:
SONReportsandLTE1045:SupportofDistributedSitesisdescribedatthespecific
features.
Theexecutionofthefeaturesinscheduledmodeduringauto-configurationarecontrolled
withpreferencesettings,genericallyapplicableforeveryexecutionofthework-flow.
Detailsareexplainedatthespecificfeatures.

5.15.1.1

Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:
Theoperatorcanexecuteinter-RATneighborrelationrelatedfeaturesandoptimization
ofIntra-LTEinanautomatedway.

5.15.1.2

Requirements
Software requirements
Table134:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table134

OMS

OMS4.0(RL40)

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

Issue:01J

DN09185979

223

Descriptionsofoperabilityfeatures

5.15.1.3

LTERL40,FeatureDescriptionsandInstructions

Functional description
Functional overview
TheLTE1222:SONAutomationModesitselfisabasicfeatureaddingfunctionalityfor
theexistingcentralizedSONfeatures.TheinteractionwiththeLTE1019:SONReport
andtheLTE1045:SupportofDistributedSitesfeaturesisdescribedinthespecific
featuredescription.
Theexecutionofthefeaturesinscheduledmodeduringauto-configurationarecontrolled
withpreferencesettings,genericallyapplicableforeveryexecutionofthework-flow.
Detailsareexplainedwiththespecificfeatures.
ThefollowingSONfeatureswillbesupportedinOptimizerinanautomatedmanner:
1. Theauto-configurationcanincludetheautomaticexecutionof:

LTE783:ANRInterRATUTRAN
LTE784:ANRInterRATGERAN

Theexecutiondependsontheoperatorsettingsforauto-configuration.Additionally
thefeaturescanbestartedmanuallyasbefore.
2. Timescheduledexecutionof:

LTE510:SynchronizationofInterRATNeighborRelations
LTE533:MobilityRobustness
LTE771:OptimizationofIntra-LTENeighborRelations

Theoperatorcandefinetimescheduleswhenthementionedfeaturesareexecuted.
Additionallythefeaturescanbestartedmanuallyasbefore.

Note: TheLTE1222:SONAutomationModesfeatureishandledasabasicfeature
addingadditionalfunctionalitytotheexistingfeaturesfor:
LTE533:MobilityRobustness
LTE771:OptimizationofIntra-LTENeighborRelations
LTE510:SynchronizationofInterRATNeighbors
LTE783:ANRInterRATUTRAN
LTE784:ANRInterRATGERAN
Therefore,therearenospecificSONReports,CMparameterorPMcountersorother
preparationfortheLTE1222:SONAutomationModesfeatureitself.

5.15.1.3.1

LTE533: Mobility Robustness


ThefeatureMROisexecutableinatimescheduledmanner.ThescopeofcellsoreNBs
isthewholenetworkrespectivelythescopeofNetAct.
TheoperatordefinesthetimescheduleswhenthefeatureMROhastobeexecuted.
AdditionallythefeatureMROcanbestartedmanuallyasbefore.
NetActsupportspreferencesettingstokeepthenetworkprofilefortheworkflow-based
executionofMRO:
Preferencesettings:

224

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Executionoftheworkflow(enabled,disabled)
Schedulerconfiguration(day-of-week,time,...)
stoppoint(none,active)
MROthresholdsandweights
Networkfreezemode(none,directneighbors,allneighbors,...)

TheoperatorsettingofthenetworkprofiledataduringtheinteractiveactivationofMRO
doesnotchangethepreferencesettingfortheautomatedexecutionofMRO.
TheoperatorcantriggertheexecutionoftheautomatedMROworkflowmanuallyor
aborttherunningworkflow.
Theoperatorcanactivateastoppoint.Ifthisfunctionisactivated,thentheautomated
MROwork-flowstopsbeforethenewplanfileisdownloadedandactivated.Theoperator
cancontrolthefurtherstepsmanually.

5.15.1.3.2

LTE783: ANR for InterRAT UTRAN


Thenewfunctionality:
newneighborsgenerationduringLTEautoconfiguration
enrichestheexistingoptionalfeatureLTE783:ANRforInterRATUTRAN.
TheLTE783profilesettingsareconfiguredaspreferencesettingsandareavailablefor
eachautomatedexecutionoftheLTE783work-flowduringauto-configuration.The
interactiveenteredprofilesettings,duringmanualexecutionofLTE783,areindependent
ofthepreferencesettings.
ForeachautomatedgenerationofUTRANneighborshiprelationsthesepreference
settingsareapplied.
ForLTE783thereisnospecificbreak-point.TheoperatorcanactivatetheLTE720
break-pointtostopthework-flowandallowtheoperatortohavealookontheresultsof
thewholeauto-configurationworkflow.
NetActdoesallowmodificationsoftheresultsofthealgorithm,beforethenewdelta
configurationisdownloadedandactivated.
ThefeatureLTE720:SONLTEBTSAutoConfigurationisrequiredtorunLTE783:ANR
forInterRATUTRANatauto-configurationtime.
New neighbors generation during LTE auto-configuration
ThefeatureLTE783:ANRforInterRATUTRANprovidesforanewinstalledeNB,during
theexecutionofthefeatureLTE720:SONLTEBTSAutoConfiguration,themost
suitableinter-RATUTRANneighborshiprelations.TheLTE783procedureconsidersthe
actualinter-RATNRUTRANprofile.TheNetActConfiguratorkeepsanactualknowledgeoftheinter-RATcellconfigurationdata.
Support at NetAct Optimizer
NetActOptimizersupportsthefeatureLTE783duringauto-configuration.
NetActOptimizerchecksthestatusoftheLTE783activation.Ifthefeatureisactivated,
thenthefeatureLTE783isexecutedforallthecellsofallneweNBs.

Issue:01J

DN09185979

225

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

NetActOptimizersupportsthemanagementofpolicyvaluesforInterRATUTRANcell
selectionaspreferencesettings.ForeachexecutionoftheLTE783work-flow,these
preferencesettingsareapplicable.Profilesetting,withdifferentvalues,duringinteractive
executionofthefeatureLTE783donotchangethepreferencesettings.
NetActsupportsthefollowingpolicysettingsaspreferencesettings:

black-andwhite-listingsofNRtoUTRANcellsperLTEcell
minimum/maximumnumberofneighborUTRANcellsperLTEcell
neighborshipassignment(LTEtoUTRAN)

Support at NetAct Configurator


NetActConfiguratorstartsfortheneweNBstheLTE720auto-configurationprocess.The
LTE720work-flowiscoveringthefeatureLTE783:ANRforinterRATUTRANtoo.
Use case: LTE783 new UTRAN neighbors generation during LTE autoconfiguration
ThisproceduredescribestheestablishmentofNRforinter-RATUTRANcells.The
operatorcanruntheprocessautonomousordefinetheLTE720breakpointin-linewith
theLTE720management.Theautomaticinter-RATconfigurationoftheeNBisbasedon
LTE783forthegivencellsofthenew/plannedeNB.Withintheautoconfiguration
processLTE783doesnotsupportabreakpointitself.
Preconditions
inter-RATcellgeo-locationinformationisavailable.TheownLTEcellsforthe
new/plannedeNBareassignedintheLTE720process.Theoperatorhassetthewanted
NetActpolicyvaluesforinter-RATcellselectionaspreferencesettings.Allfeaturesare
activated.
Description
ThefollowingstepsaresupportedbyNetAct:
1. TheLTE720processstartstheauto-configurationprocess,thatincludesthe"ANR
forInter-RATUTRAN"algorithm.
2. BasedontheinformationgeneratedbyNetActOptimizer,NetActupdatestheeNB
configurationplan.AttheLTE720breakpointtheoperatorcanmodifythefoundNR.
3. NetActConfiguratorcompletestheconfigurationplanfortheimpactedeNBsand
does,withintheLTE720process,downloadandactivatethedeltaplanfile
Post conditions
TheLTEcellsareconfiguredwithneighborinter-RATUTRANcellsforsupportofHOand
othermobilityproceduresfromLTEtointer-RATUTRANviaS1interfaceandUEidle
modemobility.

5.15.1.3.3

LTE784: ANR for InterRAT GERAN


Thenewfunctionality:
newneighborsgenerationduringLTEautoconfiguration
enrichestheexistingoptionalfeatureLTE784:ANRforInterRATGERAN.

226

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

TheLTE784profilesettingsareconfiguredaspreferencesettingsandareavailablefor
eachautomatedexecutionoftheLTE784work-flowduringauto-configuration.The
interactiveenteredprofilesettings,duringmanualexecutionofLTE784,areindependent
ofthepreferencesettings.
ForeachautomatedgenerationofGERANneighborsrelationsthesepreferencesettings
areapplied.
ForLTE784thereisnospecificbreak-point.TheoperatorcanactivatetheLTE720
break-pointtostopthework-flowandallowtheoperatortohavealookontheresultsof
thewholeauto-configurationwork-flow.
NetActdoesallowmodificationsoftheresultsofthealgorithm,beforethenewdelta
configurationisdownloadedandactivated.
ThefeatureLTE720:SONLTEBTSAutoConfigurationisrequiredtorunLTE784:ANR
forInterRATGERANatauto-configurationtime.
New neighbors generation during LTE auto-configuration
ThefeatureLTE784:ANRforInterRATGERANprovidesforanewinstalledeNB,during
theexecutionofthefeatureLTE720:SONLTEBTSAutoConfiguration,themost
suitableinter-RATGERANneighborsrelations.TheLTE784procedureconsidersthe
actualinter-RATNRGERANprofile.TheNetActConfiguratorkeepsanactualknowledgeoftheinter-RATcellconfigurationdata.
Support at NetAct Optimizer
NetActOptimizersupportsthefeatureLTE784duringauto-configuration.
NetActOptimizerchecksthestatusoftheLTE784activation.Ifthefeatureisactivated,
thenthefeatureLTE784isexecutedforallthecellsofallneweNBs.
NetActOptimizersupportsthemanagementofpolicyvaluesforInterRATGERANcell
selectionaspreferencesettings.ForeachexecutionoftheLTE784work-flow,these
preferencesettingsareapplicable.Profilesetting,withdifferentvalues,duringinteractive
executionofthefeatureLTE784donotchangethepreferencesettings.
NetActsupportsthefollowingpolicysettingsaspreferencesettings:

black-andwhite-listingsofNRtoGERANcellsperLTEcell
minimum/maximumnumberofneighborGERANcellsperLTEcell
neighborsassignment(LTEtoGERAN)

Support at NetAct Configurator


NetActConfiguratorstartsfortheneweNBstheLTE720auto-configurationprocess.The
LTE720work-flowiscoveringthefeatureLTE784:ANRforinterRATGERANtoo.
Use case: LTE784 new GERAN neighbors generation during LTE autoconfiguration
Thisproceduredescribestheestablishmentofneighborsrelationsforinter-RATGERAN
cells.TheoperatorcanruntheprocessautonomousordefinetheLTE720breakpointinlinewiththeLTE720management.Theautomaticinter-RATconfigurationoftheeNBis
basedonLTE784forthegivencellsofthenew/plannedeNB.Withintheauto
configurationprocessLTE784doesnotsupportabreakpointitself.
Preconditions

Issue:01J

DN09185979

227

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

inter-RATcellgeo-locationinformationisavailable.TheownLTEcellsforthe
new/plannedeNBareassignedintheLTE720process.Theoperatorhassetthewanted
NetActpolicyvaluesforinter-RATcellselectionaspreferencesettings.Allfeaturesare
activated.
Description
ThefollowingstepsaresupportedbyNetAct:
1. TheLTE720processstartstheauto-configurationprocess,thatincludesthe"ANR
forInter-RATGERAN"algorithm.
2. BasedontheinformationgeneratedbyNetActOptimizer,NetActupdatestheeNB
configurationplan.AttheLTE720breakpointtheoperatorcanmodifythefoundNR.
3. NetActConfiguratorcompletestheconfigurationplanfortheimpactedeNBsand
does,withintheLTE720process,downloadandactivatethedeltaplanfile
Post conditions
TheLTEcellsareconfiguredwithneighborinter-RATGERANcellsforsupportofHO
andothermobilityproceduresfromLTEtointer-RATGERANviaS1interfaceandUE
idlemodemobility.

5.15.1.3.4

LTE510: Synchronization of Inter-RAT neighbors


ThefeatureLTE510doesautomaticallykeepinter-RATneighborrelationsup-to-datein
caseofinter-RATcelladditions.Theintrinsicalgorithmtoidentifyneighborsisbasedon
LTE783andLTE784functionality.Similarasanoperatordefinesmanuallythescopeof
eNBsorLTEcells,thefeatureLTE510identifiesautomaticallythoseeNBandLTEcells
thatneedupdateoftheirneighborsrelation.
TherearetwoadditionalusecasestobeconsideredbyLTE510:

Scheduledworkflowexecutionbyworkflowengineforneighborshipreconfiguration
fromLTEviewpoint
Manuallytriggeredworkflowexecutionbyworkflowengineforneighborship
reconfigurationfromLTEviewpoint.

Toavoidping-pongeffectsbetweenLTE510ontheonehandandexecutionofthe
LTE783andLTE784feature,thesameLTE783andLTE784policyvaluesforthe
selectionofinter-RATneighborshiprelationareapplied.Inadditionthesameblack-and
white-listingsareused.ThereforethedesignofLTE510doesaimtoreusetheexisting
LTE783andLTE784functionalityandpolicysetting.TheLTE510featureisdesignedto
beresponsibletoidentifythoseeNBandLTEcellsthatneedtoupdatetheirinter-RAT
neighborrelation.Thisapproachdefinesaclearscopeofthefeatureactivationforeach
oftheindividualfeaturesLTE510,LTE783andLTE784.
Scheduled neighborship reconfiguration
Periodicallyormanuallytriggered,Optimizer

228

findsnewinter-RATcells.
findsaffectedLTEcells.
startsLTE783and/orLTE784forthoseLTEcells.
NetActOptimizerstoresthenewidentifiedinter-RATNRandexchangestheplanto
configurator.
Ifnobreak-pointissetNetActConfiguratorproceedswiththeprovisioning.

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Ifabreak-pointisset,thework-flowexistsandtheusercanverifytheresultsand
proceedwiththeprovisioningmanually

TheNetActkeepstheoperatorinformedabouttheprogressandoutcomeofthe
scheduledjob.
Support at NetAct Optimizer
NetActOptimizerdoessupporttheidentificationoftheLTEcellsthatareimpactedbycell
additionsintheinter-RATnetworks,basedontheirgeo-locationsandthedirectionofthe
antennamainlobe.TheidentificationofimpactedLTEcellsconsidersthesameLTE783
andLTE784geo-locationcriteria.NetActOptimizerdoesrunthefeaturesLTE783and
LTE784forupdateoftheLTEnetworkforthoseeNBorLTEcells.
Thefollowingpolicyissupported:
SchedulerexecutioncontrolforthestartoffeatureLTE510

Disabled(featureLTE510isdisabled)
Enabled(manualtrigger)

Optionsforschedulerperiodicity:

Dailyatcertaintime
Weeklyatcertainday/time
Bi-weeklyatcertainday/time
Optionalmonthlyatcertainday/time

Theconfigurationplancontainingthenewinter-RATNRisforwardedtoNetAct
Configurator.NetActOptimizergeneratesoneconfigurationplanforallactivatedRATs.
Use case: Scheduled neighborship reconfiguration
ThisproceduredescribesthemanagementofNRsforInter-RATUTRANand/orGERAN.
TheoperatordoesoptionallyconfigureascheduledjobatNetActthatdoesupdatethe
configurationoftheimpactedeNBsorLTEcellswithrespecttointer-RATcelladditions.
Theoperatorcanscheduletoruntheprocessautonomouslywithorwithoutabreak
pointforverifications.
Theoperatorcantriggerexecutionofthisproceduremanually.
Preconditions
inter-RATcellgeo-locationinformationisavailable.Theoperatorhassetthewanted
operatorpolicyvaluesforinter-RATcellselection.Allfeaturesareactivated.
NetActConfiguratorkeepsalleNBorLTEcellsup-to-date.
TheoperatorhasenabledthescheduledjobatNetAct.
Description
ThefollowingstepsaresupportedbyNetAct:
1. Optimizeridentifiesallnewinsertedinter-RATcells(inter-RATcellsthatdonothave
yetincomingLTEneighborrelations).

Issue:01J

DN09185979

229

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

2. Thescheduledprocessstartsthe"ANRforInter-RATUTRANalgorithmforthelistof
eNBorLTEcellsthatneedUTRANNRupdate.Thescheduledprocessstartsthe
ANRforInter-RATGERANalgorithmforthelistofeNBorLTEcellsthatneed
GERANNRupdate.TheorderortheRATsisarbitrary.
3. BasedontheinformationgeneratedbyNetActOptimizer,NetActOptimizerhasto
updatetheexistingeNBplanfile.AttheLTE510breakpointtheoperatorcanstill
modifythefoundNR.
4. TheNetActConfiguratorhastocompletetheconfigurationplanfilefortheimpacted
eNBsanddownloadsandactivatesthedeltaplanfiles.
Post conditions
TheLTEcellsareconfiguredwithNRtonewlyaddedneighborUTRANand/orGERAN
cellsforsupportofHOandothermobilityproceduresfromLTEtoUTRANviaS1
interfaceandtobroadcasttotheUEforidlemodemobility.

5.15.1.3.5

LTE771: Optimization of Intra-LTE neighbor relations


Support at NetAct Optimizer
Ifthefeatureisdisabled,noLTE771optionstoautomaticallytriggerLTE771functionality
areprovidedtotheoperator.Ifthefeatureisactivated,LTE771functionalityisprovided.
IfLTE771isnewlyactivated,theprofilesettingstartswithdefaultvalues.
NetActOptimizersupportstheactivationoftheLTE771functionasascheduledworkflowthatisexecutedautomaticallybasedonprofilesettings.
Scheduled LTE771 execution
NetActOptimizersupportswithinapre-setprofilethescheduledexecutionofLTE771
relatedworkflowbytheworkflowenginewithinthescopeofallNetActcontrolledLTE
cells.Theprofilesupportsthefollowingsettings:

featureactivation/deactivation,thelicensemanagementfollowsthegeneralNetAct
approach
schedulertimecontrol(start/stop,periodicstarttime/day/week/month)
LTE771controlsparameter(#ofHOattemptperday,requiredHOsuccessratio,
thresholdforblack-listedNRpercelltonotifytotheoperator)
Executioncontrol(break-point).
Executionreportgeneration(levelofdetails).

NetActstartsperiodically,upontheprofile,theanalysisoftheNRperformancebasedon
thelatestgeneratedKPIdata.NetActOptimizersupportsaperiodicallyretriggeredSON
functionthatoperateswithoutfurtheroperatoractivity.
NetActOptimizerconsiderstheoperatordecisiontoexcludecertainNRfrombeing
changedbyLTE771.NetActOptimizergeneratesanLTE771executionreporttoinform
theoperatoronlineoroff-lineabouttheperformanceorproblemsoftheSONfunction.
TheexecutionreportshowstheresultoftheoperatorcontrolledNRtoo.NetAct
OptimizerforwardsthenewlyfoundNRthatneedtobeblacklistedtowardsNetAct
Configuratortoimplementthisintheactualnetwork.
Manual LTE771 workflow execution:
Thestartofthescheduledworkflowcanbetriggeredmanuallyaswell.
Support at NetAct Configurator

230

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

NetActConfiguratororOptimizeroptionallystopsandterminatesthework-flowatthe
definedbreak-point,toallowtheoperatortoverifyandmodifythegeneratedplanfile
beforeimplementinginthenetwork.
Use case for ANR Optimization
ThisusecasedescribestheoptimizationofIntra-LTENRs.Theoperatordoesconfigure
ascheduledjobatNetActthatanalysesLTEcellswithrespecttotheirintra-LTE
neighborshipperformance.
Preconditions
Theoperatorhassetthewantedoperatorpolicyvaluesforoptimizationofintra-LTENR
optimization.
TheoperatorhasenabledthescheduledjobatNetAct.
TheKPIdatafortheNRareavailable.
Description
ThefollowingstepsaresupportedbyNetAct:
1. TriggeredbySONschedulerorfromusermanuallyviaWFEUI,WFEdoesstartthe
scheduledworkflow.
2. NetActstartsforallcellstheperformanceevaluationofitsneighborshiprelation.
3. NetActcreatesthenewplanoftheproposedblacklistedneighborshiprelation.
4. NetActprovidestotheoperatorthefeedbackoftheprocedure,accordingtothelevel
ofdetailsselectedinthepolicyvalues.
5. Incaseofexecutionwithoutbreakpoint,NetActdownloadsandactivatestheplan
filestoeacheNB.
6. Incaseofexecutionwithbreakpoint,NetActConfiguratorSONSchedulerexitsat
thisbreakpoint.Theoperatorcanedittheplananddecideonthefurthersteps.
Post conditions
InthenetworktheNRthatarebadlyperformingwillbeblacklisted.

5.15.1.4

System impact
Interdependencies between features
Theinterdependenciesbetweenthechangesofthisfeatureandotherfeaturesare
describedinthefeaturedescriptions:
LTE533:MobilityRobustness
LTE771:OptimizationofIntra-LTEneighborrelations
LTE510:SynchronizationofInterRATNeighbors
LTE783:ANRInterRATUTRAN
LTE784:ANRInterRATGERAN
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools

Issue:01J

DN09185979

231

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.15.1.5

Management data
FortheLTE1222:SONAutomationModesfeaturethedataarecoveredbythespecific
featureimpactedbythegenericfeatureitself.
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.15.1.6

Sales information
Table135

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.15 Variable Definitions

5.16 LTE1340: Trace-based Real Time Monitoring


Introduction to the feature
ThisfeatureoffersarealtimenetworkmonitoringsolutionbasedontheFlexiMultiradio
BTStraceinterface.ThecollectedtracedataissenttotheLayer3DataCollector
(L3DC)thattransfersthedatatoTrafficaforvisualization.

5.16.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits

232

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Thisfeaturebenefitstheoperatorasfollows:
itoffersanefficientmethodofmonitoringasignificantnumberofFlexiMultiradio
BTSsinrealtime
realtimemonitoringallowstheoperatortoquicklyreacttopotentialnetwork
problemswhich,asaresult,bringsOPEXsavings

5.16.2 Requirements
Software requirements
Table136:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS Flexi Multiradio 10 BTS

RL40

LBTS4.0

Table136

LBTS4.0

OMS
OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
TheLayer3DataCollectorisastandalonenetworkelement(NE)basedontheHP
DL380Gen7server.

5.16.3 Functional description


Real time monitoring solution overview
ThisfeatureallowstheoperatortovisualizerealtimemonitoringdatainTraffica.The
dataiscollectedfromtheFlexiMultiradioBTSusingtheexistingcelltraceinterface.The
L3DCnetworkelementisintroducedtogatherdatafrommultipleBTSs.OneL3DCNEis
abletohandleupto200FlexiMultiradioBTSs.OneTrafficainstanceisabletohandle
upto10L3DCs.
OncethedataiscreatedintheFlexiMultiradioBTS,itissenttoL3DC.Thetime
betweentracerecordgenerationintheBTSanditsavailabilityintheL3DCshouldbe
lessthan20seconds.TheL3DCconvertstheL3messagestoTraffica-compatible
format.Onrequest,theTrafficaretrievesthesereportsfromL3DCtodisplaystatistics
aboutthemonitoredcell.Thereportsconsistofbearerandmobilitymanagement-related
information(C-planeevents).
BasicconfigurationandsoftwaremanagementtasksforL3DCcanbeperformedlocally
viaanon-siteterminal.
Thewholeend-to-endfunctionalityispresentedonFigure24:Trace-basedrealtime
monitoringarchitecture.

Issue:01J

DN09185979

233

Descriptionsofoperabilityfeatures

Figure24

LTERL40,FeatureDescriptionsandInstructions

Trace-basedrealtimemonitoringarchitecture
NetAct
FM

L3DCO&M

Celltrace
interface

FlexiMultiradioBTS

Reports

Security
Gateway
(optional)

L3DataCollector

Traffica

L3DCO&M

BTSO&M

Localterminal

TraceViewer

Cell trace configuration


ThecelltraceconfigurationisdoneusingtheTraceViewerapplication.TheL3DCneeds
tobeselectedastheTraceCollectionEntityduringthecelltraceconfiguration(the
L3DCsIPaddressputasthe tceIpAddressparametervalue).
L3DC fault management
IftheL3DCisfaultyortheconnectionbetweentheFlexiMultiradioBTSandtheL3DCis
notworking,respectivealarmsarereportedinNetAct.TheTrafficauserisnotifiedby
alarmiftheconnectiontowardsL3DCfails.
TheL3DCcanbeaddedtonetworktopologybasedontheexistingexternalobject
modelinginNetAct.Itisaddedtothedatabaseasanexternalelementtowhichalarms
canbemapped.

5.16.4 System impact


Interdependencies between features
LTE1340:Trace-basedRealTimeMonitoringrequirestheLTE433:Celltracefeature.
Impact on interfaces
TheexistingcelltraceinterfaceintroducedwiththeLTE433:Celltracefeatureisused
betweenFlexiMultiradioBTSandL3DC.
TheNE3SinterfaceisusedbetweenL3DCandNetAct(forconnectionsupervisionand
faultmanagement).TheL3DCusestheUDPmessagesforsendingeventreports
towardsTraffica.
Impact on network and network element management tools

234

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Descriptionsofoperabilityfeatures

Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.16.5 LTE1340: Trace-based Real Time Monitoring management


data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Thisinformationwillbeavailableinfurtherdeliveries.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenonewparametersrelatedtothisfeature.
Therearenomodifiedparametersrelatedtothisfeature.
Table137:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table137

Relatedexistingparameters

Full name

Abbreviated name

TraceCollectionEntityIPAddress

tceIpAddress

Managed object
MTRACE

5.16.6 Sales information


Table138

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

5.17 Description of LTE1457: Cell trace Configuration


via Configuration Management
Introduction to the feature

Issue:01J

DN09185979

235

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

TheLTE1457:CelltraceConfigurationviaConfigurationManagementfeatureallowsthe
operatortoconfigurethecelltraceusingNetActConfigurationManagement(CM)and
theBTSSiteManager.ThissolutionisanalternativetotheexistingmethodusingNetAct
TraceViewerapplication.

5.17.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thisfeaturebenefitstheoperatorasfollows:
repetitiveworkisreducedbysupportingplan-basedmassconfiguration
celltraceconfigurationisalsopossiblewith3rdpartymanagementsystem(using
availableCMnorthboundinterface)

5.17.2 Requirements
Software requirements
Table139:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

Table139

OMS

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CDset2

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

5.17.3 Functional description


Thisfeatureintroducesthepossibilitytoactivate/deactivateandconfigurecelltrace
usingNetActConfigurationManagementtoolset.Thepreviousmethodofconfiguration
usingNetActTraceViewerisstillsupported.However,itisrecommendedtouseeither
ConfigurationManagementorTraceViewer.
Activatingandconfiguringonecelltracemeans(inpractice):

creatinganMTRACEobjectunderaparticulareNB
settingtheobject-relatedparameters

Thehierarchyoftrace-relatedobjectsisshownonFigure25:Managedobjectsstructure.

236

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure25

Descriptionsofoperabilityfeatures

Managedobjectsstructure

LNBTS

CTRLTS
(TraceControl)

MTRACE
(CellTraceSession)

WiththisnewfeaturetheconfigurationcanbedonewiththestandardCMmechanism,
thatis:
1. Creating/updatingaconfigurationplanusingtheNetActCMEditorapplication.
Inthisstep,theMTRACEobjectsarecreatedandtherelevantparametervaluesare
defined.
2. ProvisioningandactivatingtheplanusingtheNetActCMOperationsManager
application.
ThecelltracescanalsobeconfiguredviathenorthboundinterfaceofNetAct
ConfigurationManagement.
Supportforadvancedtraceconfiguration(used,forexample,tosetupMDT)isstill
availableonlyintheTraceViewer.

5.17.4 System impact


Interdependencies between features
ThecelltracewasintroducedwiththeLTE433:CellTracefeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

5.17.5 LTE1457: Cell trace Configuration via Configuration


Management management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms

Issue:01J

DN09185979

237

Descriptionsofoperabilityfeatures

LTERL40,FeatureDescriptionsandInstructions

Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

5.17.6 Sales information


Table140

238

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6 Descriptions of BTS site solution features


6.1 LTE179: Dual Band with One System Module
Introduction to the feature
Withthisfeatureactive,DualBandanduptosixLTEcellswithoptional2TXMIMOFlexi
LTEBTSconfigurationsaresupportedwithoneSystemModule.

6.1.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
SmoothLTEevolutionondifferentRFbands.Morecapacityisavailablewhenoperator
uses3-sectorsattwoseparateRFbandsbyoneFlexiLTEBTS.

6.1.2 Requirements
Software requirements
Table141:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table141

OMS

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

Hardware requirements
Thisfeaturedoesnotrequireanyneworadditionalhardware.

6.1.3 Functional description


OneFlexiSystemModulesupportsuptosixcellsattwodifferentRFbands
simultaneouslywith3-sectorRFModulesorwithchainedRRHs/chainedRFModules
(whenusedasonesectorRRH).

Issue:01J

DN09185979

239

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Feature supported configurations

2x(1+1+1)2TX/2RXDualBandwithfour3-sectorRFModules,twopereachRF
band.
Figure26

240

DualBandconfigurationwithfourRFModules

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

2x(1+1+1)2TX/2RXDualBandwithsixonecellRRH(orRFMasonesector
RRH)
twoopticalchains,2RRHsperchain
twoRRHswithownlink

Figure27

DualBandconfigurationwithsixRRHs,fromwhichthreearechained

BandB
Sector 4

Sector2
ANT 2

RXOut2

RET

RXOut1

ANT 1

ANT 2

EAC

ANT 2

OPT IF1

OPT IF2

EAC

OPT IF1

LMP

ANT 2

OPT IF2

RET

RXOut1

ANT 1

ANT 2

OPT IF1

LMP

OPT IF2

RXOut2

EAC

EAC

CLASS1
LASERPRODUCTION

RET

RXOut1

OPT IF1

CLASS1
LASERPRODUCTION

RXOut1

ANT 1

ANT 1

OPT IF1

LMP

OPT IF2

Sector 5
ANT 1

ANT 2

OPT IF2

RXOut2

RET

RXOut1

ANT 1

ANT 2

ANT 1

LMP

RET

CLASS1
LASERPRODUCTION

ANT 2

ANT 1

RXOut2

ANT 2

Sector 3

ANT 2

EAC

ANT 1

CLASS1
LASERPRODUCTION

Sector 1
RXOut2

RXOut1

ANT 1

CLASS1
LASERPRODUCTION

ANT 2

RET

ANT 2

ANT 1

LMP

RXOut2

Sector 6

EAC

ANT 1

OPT IF1

LMP

OPT IF2

CLASS1
LASERPRODUCTION

Band A

Issue:01J

DN09185979

241

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

2x(1+1+1)2TX/2RXDualBandwithsixonecellRRH(orRFMasonesector
RRH)
threeRRHsperRFband
threeopticalchains,2RRHsperchain

Figure28

DualBandconfigurationwithsixRRHs,fromwhichtwoarechained

BandB
Sector 4

Sector2
ANT 2

RXOut2

RET

RXOut1

ANT 1

ANT 2

EAC

ANT 2

OPT IF1

OPT IF2

EAC

OPT IF1

LMP

ANT 2

OPT IF2

RET

RXOut1

ANT 1

ANT 2

OPT IF1

LMP

OPT IF2

RXOut2

EAC

EAC

CLASS1
LASERPRODUCTION

RET

RXOut1

OPT IF1

CLASS1
LASERPRODUCTION

RXOut1

ANT 1

ANT 1

OPT IF1

LMP

OPT IF2

Sector 5
ANT 1

ANT 2

OPT IF2

RXOut2

RET

RXOut1

ANT 1

ANT 2

ANT 1

LMP

RET

CLASS1
LASERPRODUCTION

ANT 2

ANT 1

RXOut2

ANT 2

Sector 3

ANT 2

EAC

ANT 1

CLASS1
LASERPRODUCTION

Sector 1
RXOut2

RXOut1

ANT 1

CLASS1
LASERPRODUCTION

ANT 2

RET

ANT 2

ANT 1

LMP

RXOut2

Sector 6

EAC

ANT 1

OPT IF1

LMP

OPT IF2

CLASS1
LASERPRODUCTION

Band A

242

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

2x(1+1)2TX/2RXDualBandwithfouronecellRRH(orRFMasonesectorRRH)

twoRRHsperRFband
twoopticalchains,2RRHsperchain

Figure29

DualBandconfigurationwithfourRRHs,fromwhichtwoarechained

BandB
Sector2

Sector2

ANT 2

RXOut2

RET

RXOut1

ANT 1

ANT 2

EAC

Sector 4

ANT 2

OPT IF1

OPT IF2

EAC

Sector1

RET

RXOut1

OPT IF1

LMP

Sector 3

OPT IF2

OPT IF1

OPT IF2

RXOut2

RET

RXOut1

ANT 1

ANT 2

ANT 1

LMP

ANT 1

Sector 3

ANT 2

ANT 1

ANT 2

EAC

RXOut1

CLASS1
LASERPRODUCTION

Sector1

RXOut2

RET

ANT 1

CLASS1
LASERPRODUCTION

ANT 2

RXOut2

ANT 2

ANT 1

LMP

Sector 4

EAC

ANT 1

OPT IF1

LMP

OPT IF2

CLASS1
LASERPRODUCTION

CLASS1
LASERPRODUCTION

Band A

OneSystemModulecansupportsixcellsupto10MHzbandwidth(with1TXorwith2TX
MIMO).
RFbandwidthsattwoRFbandsmustbethesameinfirstphase(thatis5MHzor10MHz
bandwidthonbothRFbands).
AllsupportedRFbandcombinationsandcellandRRHandRFMconfigurationsare
listedintheLTERLreleasedocumentation.
Formoredetailsontheconfigurations,seeCreatingLTEConfigurationsandFlexi
MultiradioandMultiradio10BTSLTESupportedConfigurations.

6.1.4 System impact


Interdependencies between features
LTE106:6cellsupportwithoneSystemModuleispre-requisitefeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools

Issue:01J

DN09185979

243

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturehasnoimpactonnetworkmanagementornetworkelementmanagement
tools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

6.1.5 LTE179: Dual Band with One System Module management


data
Forparameters,seeFlexiMultiradioBTSLTECommissioning,RNWandTransmission
ParametersexcelinNOLS.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table142:Newparameterslistsparametersintroducedwiththisfeature.
Table142

Newparameters

Full name

Abbreviated name

Activatesupportfordualbandoperation

actDualBand

Managed object
LNBTS

Table143:Relatedexistingparameterslistsexistingparametersrelatedtothisfeature.
Table143

Relatedexistingparameters

Full name

244

Abbreviated name

Managed object

Downlinkchannelbandwidth

dlChBw

LNCEL

Uplinkchannelbandwidth

ulChBw

LNCEL

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6.1.6 Sales information


Table144

Salesinformation

BSW/ASW

License control in network


element

License control attributes

ASW

6.2 LTE621: Multiradio System Module basic LTE


configurations
Introduction to the feature
ThisfeatureintroducesbasicLTEconfigurationswithFlexiMultiradioFSMFcoreSystem
Module.

6.2.1 Benefits
Operator benefits
OneFlexiMultiradioFSMFcoreSystemModule(1Uunitin3UModulecasing)can
replaceFSMDandFSMEthusleavingtwoextensionbasebandsub-modulecapacity
slotsspaceforLTEorMultiradio(forexampleforGSMorWCDMA)evolution.

6.2.2 Requirements
Software requirements
Table145:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

Table145

OMS

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

6.2.3 Functional description


Functional overview
ThefollowingLTEFDDcellconfigurationsaresupportedwithoneFlexiMultiradiocore
FSMFSystemModuleconfigurationwithoutbasebandextensionsub-modules:

Issue:01J

DN09185979

245

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

maximum3-cellconfigurationsfor15MHzor20MHzbandwidthwithallsupported
LTERFModulesandRRHs
maximum6-cellconfigurationsformaximum10MHzbandwidthwithallsupported
LTERFModulesandRRHs

FSMFSystemModulewillreplaceFSMEandFSMDSystemModulesforallRL40Site
configurations.
Allconfigurationsaresupportedwith1TXor2TXMIMOandwith2RX-paths.

6.2.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenfeatures.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.2.5 LTE621: Flexi 10BTS Basic Configurations management


data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.2.6 Sales information


Table146

246

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6.3 LTE763: FXFA Flexi 3-sector RF Module 1900


Introduction to the feature
TheFlexiMultiradioRadioFrequencyModuleFXFAisa3-branchmulticarrier,multistandardradiotransceivermodule.Themoduleconsistsofthreeindependentbranches,
capableoftransmittingandreceivingsignalsofmultipleradiotechnologiesconcurrently:

UptosixGSMcarrierswith400KHzminimumcarrierseparation
UptofourWCDMAcarrierswith4.6MHzminimumcarrierseparation
Multi-carrierLTEsignalwith1.4MHz,3MHz,5MHz,10MHz,15MHz,and20
MHzcarrierbandwidth
MultiRAToperationwithcombinationofGSM,WCDMA,andLTE

Eachbranchconsistsofatransmitter,tworeceiverchains,andfrontendsoftware
tunablefilters(STuF).FXFAisa3Uhighmodulewithanintegrated,replaceable3-fan
assemblyformodulecooling.
Figure30

IsometricviewofFXFARFModule

6.3.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
3-sectorFlexiMultiradioRFModule1900(FXFA)introducesindustryleadingRF
integrationlevelandthesmallestpowerconsumptioncombinedwithflexibleGSMWCDMA-LTEsiteevolution.

6.3.2 Requirements
Software requirements
Table147:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

Issue:01J

DN09185979

247

DescriptionsofBTSsitesolutionfeatures

Table147

LTERL40,FeatureDescriptionsandInstructions

Softwarerequirements

System release

eNode B

NetAct

MME

SAE GW

RL40

LBTS4.0

6.3.3 Functional description


Functional overview
FXFAFlexiMultiradioRFModulesupports3GPPBandII:

UL:1850-1910MHz,
DL:1930-1990MHz

In1900MHzbandoneFlexiMultiradioRFModulesupportsthefollowingWCDMA
configurations:
FlexiMultiradioRFModuleFXFAsupportsthefollowingLTEconfigurations:

1,1+1,or1+1+1atthemaximumof20MHzLTEbandwithand1TX/2RX
8,20,40,or60Wmodepersector(controlledbySWlicenses)
1sectorwiththemaximumof60+60W2TX/2RXMIMO
HWreadyfor1sectorwiththemaximumof60+60W2TX/4RXMIMO

Front panel view of the RF Module


Figure31

FXFAfrontpanelconnectorsandlabels
ANT 6
RX

TX/RX

RxO6

PWRIN

ANT 4
RX
ANT 3
RxO5
RxO4 TX/RX
RxO3

LED
Fan/TXOff
status
LEDModule
status

EAC

ANT 2
RX
ANT 1
RxO2 TX/RX
RxO1

OPT 2
OPT 3
OPT 1

Grounding
points

RF Module front panel descriptions

248

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table148

DescriptionsofBTSsitesolutionfeatures

FXFAfrontpanelconnectors,cabletypesandinterfaces

Label name Description


on module

Connector
type

Cable types and


Interface(s)

Signal
direction

Ant1Tx/Rx

RFsignalinterfaceto
antenna(TxandRx
main)

7/16(female)

Antennajumperor
feedercables

Toandfrom
themodule

Ant2Rx

RFsignalinterfaceto 7/16(female)
antenna(Rxdiversity)

Ant3Tx/Rx

RFsignalinterface
(TxandRxmain)

7/16(female)

Antennajumperor
feedercables

Ant4Rx

RFsignalinterface
(Rxdiversity)

7/16(female)

Antennajumperor
feedercables
Othermodulewhen
antennasharing
(co-siting)isused

Ant5Tx/Rx

RFsignalinterface
(TxandRxmain)

7/16(female)

Antennajumperor
feedercables

Ant6Rx

RFsignalinterface
(Rxdiversity)

7/16(female)

Issue:01J

Antennajumperor
feedercables
Othermodulewhen
antennasharing
(co-siting)isused

Antennajumperor
feedercables
Othermodulewhen
antennasharing
(co-siting)isused

Tothe
module

Toandfrom
themodule
Tothe
module

Toandfrom
themodule
Tothe
module

RxO1/ANT
1RxOut

Providesanexternal
BTSormodulewith
theRXsignalfrom
Ant1whenantenna
sharing(co-siting)is
used

QMA(female) ExternalBTSormodule

Fromthe
module

RxO2

Providesanexternal
QMA(female) ExternalBTSormodule
BTSormodulewith
theRXdiversitysignal
fromAnt2when
antennasharing(cositing)isused

Fromthe
module

RxO3/ANT
3RxOut

Providesanexternal
BTSormodulewith
theRXsignalfrom
Ant3whenantenna
sharing(co-siting)is
used

Fromthe
module

QMA(female) ExternalBTSormodule

DN09185979

249

DescriptionsofBTSsitesolutionfeatures

Table148

LTERL40,FeatureDescriptionsandInstructions

FXFAfrontpanelconnectors,cabletypesandinterfaces(Cont.)

Label name Description


on module

Connector
type

Cable types and


Interface(s)

Signal
direction

RxO4

Providesanexternal
QMA(female) ExternalBTSormodule
BTSormodulewith
theRXdiversitysignal
fromAnt4when
antennasharing(cositing)isused

Fromthe
module

RxO5/ANT
5RxOut

Providesanexternal
BTSormodulewith
theRXsignalfrom
Ant5whenantenna
sharing(co-siting)is
used

QMA(female) ExternalBTSormodule

Fromthe
module

RxO6

Providesanexternal
QMA(female) ExternalBTSormodule
BTSormodulewith
theRXdiversitysignal
fromAnt6when
antennasharing(cositing)isused

Fromthe
module

PWRIN

-48VDCinputpower
withfuseprotection

Multi-Beam
XL(female)

SystemModule

Tothe
module

OPT1

Controlinterfaceto
themodule(OBSAI
RP3-1)

DuplexLC
connector

SystemModuleorRF
Module

Toandfrom
themodule

OPT2

Controlinterfaceto
themodule(OBSAI
RP3-1)

DuplexLC
connector

SystemModuleorRF
Module

Toandfrom
themodule

OPT3

Controlinterfaceto
themodule(OBSAI
RP3-1)

DuplexLC
connector

SystemModuleorRF
Module

Toandfrom
themodule

EAC

Externalalarm
interface(fouralarm
inputs)

RJ45female
shielded

SystemModuleor
externalalarminterface

Toandfrom
themodule

RF Module dimensions and weight


Table149

FXFAdimensionsandweight

Property

Value

Width1)

447/492mm
(17.6/19.4in.)

250

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Table149

DescriptionsofBTSsitesolutionfeatures

FXFAdimensionsandweight(Cont.)

Property

Value

Height

133mm/3U
(5.2in.)

Depth2)

422/560mm
(16.6/22.1in.)

Weight

25kg
(55.1lbs)

1)Widthofthecasingwithoutfrontcovers/withfrontcovers
2)Depthofthecasingwithoutfrontcovers/withfrontcovers

6.3.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.3.5 Sales information


ThismodulehassamepowerandMulticarrierlicensesaspreviousmodules.Itrequires
abranchlicense.
Table150

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

6.4 LTE947: FSMF Flexi Multiradio 10 System Module


Introduction to the feature

Issue:01J

DN09185979

251

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

FlexiMultiradioBTSSystemModuleFSMFisahighlyintegrated3Uhighoutdoor
SystemModuleoftheFlexiMultiradioBTS.Ithoststhetelecomcontrol,system
operationandmaintenance,basebandapplication,transmission,andpowerdistribution
functionality.TheSystemModulecanbealsoequippedwithoptionalcapacityextension
sub-moduleswhichbringadditionalsignalprocessingpowerand/orallowthesystemto
supportdifferentradioaccesstechnology.Addingthecapacitysub-modulesinthefield
doesnotaffectongoingtraffic.
TheSystemModulecanalsoactasaSystemExtensionModuleoperatingina
basebandextensionmode.FlexiMultiradioBTSarchitecturesupportschainingupto
nineSystemModulesenablingtobuildveryhighcapacitysitesanddifferentredundancy
solutions.
FlexiMultiradioSystemModulehardwaresupportsthefollowingsoftwareoperating
modes:
GSM/EDGEmode
WCDMAmode
LTEinFDDandTDDmode

6.4.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
TheFSMFisasuccessoroftheFSMDandFSMESystemModulesprovidingenhanced
capacity,connectivityandexpansionpossibilitiesinthesameformfactor.FSMFisIP
ingressprotectedandoperatesatthetemperaturerangefrom-35to+55C.

6.4.2 Requirements
Software requirements
Table151:Softwarerequirementslistssoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

Table151

OMS

OMS4.0

Softwarerequirements

UE

NetAct

MME

SAE GW

OSS5.4CD2

6.4.3 Functional description


Functional overview

252

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

TheFlexiMultiradioBTSSystemModuleFSMFconsistsofa3Uhighcasing,whichcan
accommodateinadditiontothebasemodule,optionally

uptotwobasebandsub-modules(FBBA),
oneadditionaltransportsub-module(FTxx),
onepowerdistributionsub-module(FPFx).

ThefollowingfunctionsareintegratedintheFSMF:

ethernettransport,
clockandcontrolfunctions,
basebandprocessing,
fancontrol,
statusLEDs.

TableTable152:FlexiMultiradioSystemModuleFSMFpeakthroughputshowsthetotal
throughputofaFlexiMultiradioSystemModule,whichcanvarydependingonthe
combinationofthemodulesused.NotethatMIMOissupportedforbothHSPAandLTE.
Table152

FlexiMultiradioSystemModuleFSMFpeakthroughput

Capacity
GSM/EDGE

FSMF
72

[transceivers]
WCDMA

528

[channelelements]
HSDPA

756

[Mbps]
HSUPA

115

[Mbps]
LTEDL

450

[Mbps]
LTEUL

150

[Mbps]
LTEBW/cell

20

[MHz]
LTEcells

[cellcount]
MIMO(HSPA/LTE)

Issue:01J

yes

DN09185979

253

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

OneFSMFSystemModuleprovidesahardwarebasebandcapacityforuptothree20
MHzLTEcells.
Figure32:FrontpaneloftheSystemModule(FSMF)withoptionalsub-modulesFPFD,
FTIF,andtwoFBBAspresentsthefrontviewoftheFlexiMultiradioBTSSystemModule
FSMF.
Figure32

FrontpaneloftheSystemModule(FSMF)withoptionalsub-modules
FPFD,FTIF,andtwoFBBAs

Optionalpowerdistribution
sub-module
Optionalcapacityextension
sub-module

Optionaltransport
sub-module

SyncOut

DCOutput
BBEX1-2

DCInput
LMP

SRIO

EIF2/RF/EXT6

RF/EXT1-3

SyncIn
EAC
EIF1

Interfaces
TheFSMFprovidesthefollowinginterfaces:

ThreeopticalOBSAIRP3-01interfaceswithupto6GBit/sorCPRI
OneopticalinterfacewhichcanbeusedasOBSAIRP3-01interfacewithupto6
Gbit/s(orCPRI)oras1000Base-Xasnetworkinterface
Oneelectricalinterface100/1000Base-Tastransportbackhaulinterface
Oneelectricalinterface10/100Base-Taslocalmanagementinterface
OneSyncIninterface
OneSyncOutinterface
OneEAC(ExternalAlarmandControl)interface(6alarmsignals,6SW-controllable
signalsthatcanbeassignedtobeeitherAlarmorControlsignals).Theinterface
includesalsoaCANinterface.
OneSRIO(SerialRapidInput/Output)interfaceforanexternalbasebandextension,
forexampleadditionalSystemModule
Twobasebandextensioninterfacesforoptionalsub-modules
One-48VDCinputandone-48VDCoutput

Moreinformation,seeFlexiMultiradio10BTS,MultiradioSystemModuleDescription.

254

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6.4.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Newinterfacesavailable.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.4.5 LTE947:Flexi Multimode System Module FSMF


management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.4.6 Sales information


Table153

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

6.5 LTE949: FPFD Flexi Power Distribution Sub-module


Introduction to the feature
TheFPFDisahighlyintegratedoptionalpowerdistributionsub-modulefortheFlexi
Multiradio10BTSSystemModule.

Issue:01J

DN09185979

255

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.5.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
OutdoorPowerdistributionunitwithfusesisintegratedintothe3UhighSystemModule
casing.TheFPFDisinstalledintotheFlexiMultiradioSystemModuleandrequires
thereforenodedicatedpowerdistributionunitthusnoneedforadditionalspaceor
cabinet.

6.5.2 Requirements
Software requirements
Table154:Softwarerequirementslistssoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

Table154

OMS

Softwarerequirements

UE

NetAct

MME

SAE GW

Hardware requirements
ThisfeaturerequiresFlexiMultiradio10BTS.

6.5.3 Functional description


Functional overview
OptionalintegratedFPFDoutdoorsub-moduleisasizeoptimizedpowerdistributionunit
(PDU).ItislocatedatthetopleftoftheoutdoorFlexiMultiradioSystemModule.
Itcanbeusedforstackedconfigurationandfeederlessconfigurationthesamewayas
earlierFlexiintegratedPowerdistributionunits.InfeederlessconfigurationFPFDcanbe
usedwithoptionalOverVoltageProtectionunits(OVPwithFSECorFSES).
ItcanbeinstalledtogetherwithnewFlexiMultiradioSystemModuleinone3Ucasing.
FPFDPowerdistributionsub-moduleprovidesfourexternal-48VDCoutletsforFlexi
Modules(RFModule,RRH,orexternalSystemModule)oranystandard48VDCdevice
atsiteandoneinternalDCoutputtoSystemModuleitself.
TheFPFDhasintegratedbasicOverVoltageProtectiononinput(OVPTypeapproval
levelwith+/-1kV(L-L)8/20sand+/-2kV(L-N)8/20s),EMCfilteringandreverse
polarityprotection.Itprotectstheconnectedunitsagainstshortcircuit,overcurrent(fixed
trippoints),andhighvoltagetransients.

256

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure33

DescriptionsofBTSsitesolutionfeatures

FPFDsub-module

Interfaces
TheFPFDprovidesthefollowingexternalinterfaces:

One-48VDCinput
Fourexternal-48VDCoutputs
OneinternalDCoutputtotheSystemModule
Controlpanelwiththefollowingelements:

oneLEDforeachoutput(RF1,RF2,RF3,EXT,SYS)
SELECTandSETbuttonstocontroltheirstatus

CommunicationwithFlexiMultiradioSystemModuleisdoneviaserialinterface.
Formoreinformation,see:

InstallingFlexiMultiradio10BTSPowerDistributionSub-Module(FPFD)inInstalling
FlexiMultiradio10BTSforStack,Wall,andPoleConfigurations.
ConnectingFlexiMultiradio10BTSPowerDistributionSub-Module(FPFD)cabling
inCablingFlexiMultiradio10BTS.

6.5.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Newinterfacesavailable.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity

Issue:01J

DN09185979

257

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Newconfigurationsareavailable.

6.5.5 LTE949: Flexi power distribution sub-module FPFD


management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.5.6 Sales information


Table155

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

6.6 LTE950: FPFC Flexi Power Distribution Module


Introduction to the feature
TheoptionalFPFCisastand-alone19inchrackwidepowerdistributionmoduleforFlexi
MultiradioBTSconfigurations.

6.6.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Thegeneral-purposeFPFCcanbeflexiblyusedatlargeroutdoorandindoorFlexiBTS
sites,oruponatower,togetherwithRadioModulesorRRHs.Itprovidessix-48VDC
outputswithimprovedOverVoltageProtection(OVP).

6.6.2 Requirements
Software requirements

258

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

Table156:Softwarerequirementslistssoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

Table156

OMS

Softwarerequirements

UE

NetAct

MME

SAE GW

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

6.6.3 Functional description


Functional overview
OptionalFPFCisastand-aloneoutdoorgeneralpurposePowerDistributionUnit(PDU)
withClassIIOverVoltageProtection,with15kAprotectionlevel.Externalovervoltage
protection(using,forinstance,unitsoftypeFSECorFSES)mightbeneededwithRF
partsifthePDUislocatedmorethantenmetersawayfromthepoweredunit.
FPFCisastand-aloneexternal19inchwide2Uhighoutdoormodule.Powerdistribution
moduleFPFCprovidessixoutletsforFlexiModules(RadioModules,RRHs,orSystem
Module),oranystandard-48VDCdeviceatsite.Itcanalsobeused,forexample,at
thetopoftheantennamasttodistributepowertoseveralRFModulesorRemoteRadio
Heads.IthasoneExternalalarmtoindicateOverVoltageProtection(OVP)device
condition.
Toprovidemorethansixoutputs,itispossibletochaintwoFPFCsusingthesameDC
powersource.

Issue:01J

DN09185979

259

DescriptionsofBTSsitesolutionfeatures

Figure34

LTERL40,FeatureDescriptionsandInstructions

FPFCmodule

FPFC

Inputconnector
IP boot

EACconnector

Inputconnector

On/OffBar

Outputconnector
IP boot

Interfaces
FPFCprovidesthefollowingexternalinterfaces:

oneDCinput
sixDCoutputs

CH1-2:maximumfixedoutput30A
CH3-6:maximumadjustableoutput4A/15A/30A

Additionally,eachoutputhasOn/Offbar.
oneEACconnector
EACconnector(RJ45)informsaboutanyabnormalsituation,forexample,whenthe
protectivecomponent(s)havebeendamaged.ItindicatesSPDalarmviatwoalarm
signals-NormalOpen(NO)andNormalClosed(NC):

NO
Alarmisactivewhentheconnectionisclosed.5Valarmdetectionlineispulled
downduringalarm:Active=0,Inactive=1.
NC
Alarmisactivewhentheconnectionisopen.5Valarmdetectionlineispulledup
duringalarm:Active=1,Inactive=0.

Formoreinformation,see

FlexiPowerDistributionandFusesOutdoor(FPFC)descriptioninFlexiMultiradio
BTSLTEOptionalItemsDescription
InstallingFlexiPowerDistributionandFusesOutdoor(FPFC)inInstallingFlexi
MultiradioBTSLTEOptionalItems

6.6.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces

260

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

Newinterfacesavailable.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.6.5 LTE950: Flexi power distribution module FPFC


management data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.6.6 Sales information


Table157

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

6.7 LTE1040: FXEB Flexi 3-sector RF Module 1800


Introduction to the feature
FlexiMultiradioRFModulefor1800MHz(FXEB)supportsone,two,orthreesectors
withthemaximumof3x80WoutputpowerattheBTSantennaconnectors.RFModule
HWTXbandwidthis35MHzandRX75MHzforefficientGSM,WCDMA,andLTE
Multiradioconfigurations.
FXEBcanbeusedasonesectorRemoteRFHead(RRH)withthemaximumof80W+
80W2TXMIMO.SizeandvisualoutlookaresimilartotheexistingFlexi3-sectorRF
Modules.TheenvironmentalprotectionclassisIP65.

Issue:01J

DN09185979

261

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.7.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
FXEBFlexi3-sectorRFModule80W1800MHzhasfull20MHzLTEbandwidthsupport
at3GPPbands3and9.
LTE1040:FXEBFlexi3-sectorRFModule1800providesthefollowingbenefits:

themostcost-,size-,andweight-optimizedthree-sectorBTSsite,easierinstallation,
lessvisualimpact
industry-leadingRFintegrationlevel
SWconfigurableradio:thesameRFModuleforLTE,HSPA+,andWCDMA,and
GSM/EDGE
thewidestambienttemperaturerange:-35...+55C
thesmallestpowerconsumptionandOPEX
3sectorRFModuleinoneoutdoorIP65protectedbox
lesswindload
canalsobeusedasafeederlesssitewithoneDCandoneortwoopticalcables
TXdiversityandMIMO2TXcanbebuiltusingtwo3-sectorRFModules
RFredundancyoptioncomesasanadditionaladvantage
infeederlessinstallationsone3-sectorRFModuleismorecosteffectivethanthree
RemoteRadioHeads(RRHs)
typically,onlyonethirdofDCandopticalcablingrequired,comparedtotheRemote
RadioHeads
canbeusedasapowerfullonesectorRRH:40+40W2TXMIMOwithHW
preparedfor4RX

6.7.2 Requirements
Software requirements
Table158:Softwarerequirementslistssoftwarerequiredforthisfeature.
Table158

Release

Softwarerequirements

System release

eNodeB

MME

SAE GW

UE

NetAct

RL40

LBTS4.0

OSS5.4
CD2

6.7.3 Functional description


Functional overview
FlexiMultiradioRFModuleHWsupportsLTEatthe3GPPBand3and9.
FlexiMultiradioRFModuleFXEBsupportsthefollowingLTEconfigurations:

262

1,1+1,or1+1+1atthemaximumof20MHzLTEbandwithand1TX/2RX

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

8,20,or40Wmodepersector(controlledbySWlicenses)
1sectorwiththemaximumof80+80W2TX/2RXMIMO
HWreadyfor1sectorwiththemaximumof40+40W2TX/4RXMIMO

FlexiMultiradioRFModuleFXEBcanbeusedinFeederless(DCupto200m)and
DistributedBTSsites.
Front panel view of the RF Module
Figure35

FXEBfrontpanelconnectorsandlabels

6.7.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.7.5 Sales information


ThismodulehassamepowerandMulticarrierlicensesaspreviousmodules.Itrequires
abranchlicense.
Table159

Issue:01J

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

263

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.8 LTE1125: GNSS Receiver FYGB


Introduction
Thisfeatureintroducesastandalone,combinedGNSS/GPSsatellitereceiverforBTS
timingsynchronization.ItusesGNSS(GlobalNavigationSatelliteSystem)asthe
primarysourceforfrequencyandtimesynchronizationprovidingthe1ppsinputsignalto
theFSM.

6.8.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
LTE1125:GNSSReceiverFYGBprovidessupportfortwooperationallyavailableglobal
navigationsatellitesystemsGNSS-GPSandGLONASS.Thefeaturedecreasesthe
probabilityoflosingsatellitecoverageindenseurbanareas.FYGBalsoenhances
stabilityof1ppssynchronizationsignalwithfallbackcapabilitytoGNSS-modeorGPS
-onlymode.

6.8.2 Requirements
Software requirements
Table160:Softwarerequirementsliststhesoftwarerequiredforthisfeature.
Table160

Release

Softwarerequirements

System release

eNode B

NetAct

MME

SAE GW

RL40

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

6.8.3 Functional description


ThestandaloneFYGBGNSSreceiverisanoptionalsynchronizationsolutionforsites
requiringexternaltimingsynchronization.
FYGBintroducesfollowingmodesofoperation:
1. onlyGPSsatellitesareinuse,
2. onlyGLONASSsatellitesareinuse,
3. bothGPS&GLONASSsatellitesareinuse(default).

264

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

Figure36

DescriptionsofBTSsitesolutionfeatures

FlexiBTSSynchronizationwithGNSS

6.8.4 System impact


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkandnetworkelementmanagementtools.
Impact on system performance and capacity
Thisfeaturehasnoimpactonsystemperformanceorcapacity.

6.8.5 LTE1125: GNSS Receiver FYGB management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms

Issue:01J

DN09185979

265

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Table161:Relatedexistingalarmslistsexistingalarmsrelatedtothisfeature.
Table161

Relatedexistingalarms

Alarm ID

Alarm name

7651

BASESTATIONOPERATIONDEGRADED

7652

BASESTATIONNOTIFICATION

Measurements and counters


Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Table162:Relatedexistingparameterslistsparametersintroducedwiththisfeature.
Table162

Relatedexistingparameters

Full name

Abbreviated name

Managed object

CableLengthBetweenGPSandeNB

gpsCableLength

BTSSCL

GPSInUse

gpsInUse

BTSSCL

TotalGPSAntennaLineDelay

gpsTotalAntennaLineDelay

BTSSCL

AirFrameTimingAsFor1PPS
Reference

ppsTimingOffset

BTSSCL

6.8.6 Sales information


Table163

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

6.9 LTE1148: FRIG Flexi RRH 4TX 1.7/2.1


Introduction to the feature
ThisfeatureintroducesFlexiMultiradioRemoteRFHead(RRH)FRIGwith4TXfor
3GPPbandIV2100MHz(downlink)/1700MHz(uplink).

266

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6.9.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
OnesectorFlexiRemoteRadioHeadisabletosupport4TXMIMOwithhighoutput
powerforhotspotdenseurbancapacitysites.Itenableseasyoutdoorinstallationclose
toantennasbymaximizingBTSsitecapacityandcoverageforonesector.

6.9.2 Requirements
Software requirements
Table164:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi

Flexi Lite

Flexi 10

RL40

LBTS4.0

supportnotneeded

LBTS4.0

Table164

Softwarerequirements

OMS

UE

NetAct

MME

SAE GW

OMS4.0

supportnot
needed

OSS5.4CD2

supportnot
needed

supportnot
needed

6.9.3 Functional description


Functional overview
FRIGFlexiRRH4TX1.7/2.1GHzprovidesthefollowingfeatures:

Issue:01J

4x30Wwithfourpoweramplifiersactive
2x60Wwithtwopoweramplifiersactive
optimizedforsinglesectordeploymentwith4TXMIMO
oneLTEcellwith4TXMIMOupto2x20MHzLTEpersector
IP65with-35to+50Cwithconvectioncooling
LTE-Aready
CPRIready
AISG2.0Antennatiltsupportwithexternalconnector(RS485)
4-wayUplinkRXMaximumRatioCombining(MRC)HWsupport
externalalarmsinput
opticalchainingsupportedbyHW(threeopticalconnectorswith6Gbit/sinterfaces)
MHAand3GPPAntennatiltpowerfeedandcontrolcapable(Antennaport1and
port3)

DN09185979

267

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.9.4 LTE1148: FRIG Flexi RRH 4TX 1.7/2.1 management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.9.5 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.9.6 Sales information


ThismodulehassamepowerandMulticarrierlicensesasotherearliermodules.It
requiresBranchlicense.
Table165

Salesinformation

BSW/ASW
BSW

License control in network element

License control attributes

6.10 LTE1261: FHDB Flexi RRH 2TX 900


Introduction to the feature

268

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

ThisfeatureintroducesFHDBFlexiMultiradioRemoteRadioHead(RRH)with2TX
downlinkMIMOand2RXreceiveruplinkdiversityforworldmarketLTEoperationat
3GPPbandVIII:

UL:880-915Mhz
DL:925-960Mhz

6.10.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
OnesectorFlexiRemoteRadioHeadsupports2TXMIMOwithhighoutputpower(2x
60W)forhotspotdenseurbancapacitysites.Itenableseasyoutdoorinstallationclose
toantennasbymaximizingBTSsitecapacityandcoverageforonesector.

6.10.2 Requirements
Software requirements
Table166:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi

Flexi Lite

Flexi 10

RL40

LBTS4.0

supportnotneeded

LBTS4.0

Table166

Softwarerequirements

OMS

UE

NetAct

MME

SAE GW

OMS4.0

supportnot
needed

OSS5.4CD2

supportnot
needed

supportnot
needed

6.10.3 Functional description


Functional overview
FHDBFlexiRRH2TX2RX900MHzprovidesthefollowingfeatures:

2x60Wwithtwopoweramplifiers
optimizedforsinglesectordeploymentwith2TXMIMO
opticalchainingsupportedbyHW(twoopticalconnectorswith6Gbit/sinterfaces)
IP65with-40Cto+50Cwithconvectioncooling
externalalarmsandoutputs
AISG2.0Antennatiltsupportwithexternalconnector(RS485)

FHDBsupportsupto20MHzbandwidth.

Issue:01J

DN09185979

269

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.10.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

6.10.5 Sales information


ThismodulehassamepowerandMulticarrierlicensesasotherearliermodules.It
requiresBranchlicense.
Table167

Salesinformation

BSW/ASW
BSW

License control in network element

License control attributes

6.11 LTE1263: FRGV Flexi RRH 2TX 2100


Introduction to the feature
FRGVFlexiMultiradioRemoteRFHead(RRH)with2TXMIMOand2RXreceiverfor
worldmarketWCDMA/HSPAandLTEoperationat2100MHz3GPPbandI.FRGVisan
enhancementtoFRGQwithlowerweightandimprovedpowerconsumption.

6.11.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
OnesectorFlexiRemoteRFHeadsupports2TXMIMOwithhighoutputpower.It
enableseasyoutdoorinstallationclosetoantennasbymaximizingBTSsitecapacityand
coverageforonesector.

6.11.2 Requirements
Software requirements
Table168:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

270

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

System release

Flexi

Flexi Lite

Flexi 10

RL40

LBTS4.0

supportnotneeded

LBTS4.0

Table168

Softwarerequirements

OMS

UE

NetAct

MME

SAE GW

OMS4.0

supportnot
needed

OSS5.4CD2

supportnot
needed

supportnot
needed

6.11.3 Functional description


Functional overview
FRGVFlexiRRH2TX2RX2100MHzprovidesthefollowingfeatures:

40W+40Wwithtwopoweramplifiers
optimizedforsinglesectordeploymentwith2TXMIMO
opticalchainingsupportedbyHW(twoopticalconnectors)
IP65with-35to+50Cwithconvectioncooling
twoexternalRXoutputs(mainanddivwithsmallSMAconnectors)forfutureuse
(e.g.devicelocation)
externalalarmsandoutputs
AISG2.0Antennatiltsupportwithexternalconnector(RS485)
MHAsupportedbybothRXbrancheswithadjustable0...30dBLNAsotherTX/RX
branchwithintegratedBiasTtosupportAISG2.0MHA(orantennatiltinfuture
possiblebythesameHW)MHASWsupportviaintegratedBiasT
VSWRmonitoringonbothTXbranches

6.11.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impacts on system performance and capacity
Newconfigurationsareavailable.

Issue:01J

DN09185979

271

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

6.11.5 LTE1263: FRGV Flexi RRH 2TX 2100 management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.11.6 Sales information


ThismodulehassamepowerandMulticarrierlicensesasotherearliermodules.It
requiresBranchlicense.
Table169

Salesinformation

BSW/ASW
BSW

License control in network element

License control attributes

6.12 LTE1306: FRMD Flexi 3-sector RF Module 800


Introduction to the feature
FRMDisFlexiMultiradioRFModulevariantfor800MHz3GPPband20:

DL791-806MHz
UL832-847MHz

FRMDsupportsthelowest15MHz(A+1/2B-block)forthreesectorswith60Woutput
powerattheBTSantennaconnector.ItcanbeusedaspowerfulonesectorRRHwith
max60W+60W2TXMIMO.

6.12.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits

272

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

OnesectorFlexiRemoteRFHeadsupports2TXMIMOwithhighoutputpower.It
enableseasyoutdoorinstallationclosetoantennasbymaximizingBTSsitecapacityand
coverageforonesector.

6.12.2 Requirements
Software requirements
Table170:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi

Flexi Lite

Flexi 10

RL40

LBTS4.0

supportnotneeded

LBTS4.0

Table170

Softwarerequirements

OMS

UE

NetAct

MME

SAE GW

OMS4.0

3GPPR10UE
capabilities

OSS5.4CD2

supportnot
needed

supportnot
needed

6.12.3 Functional description


Functional overview
FRMDFlexiRRH2TX2RX2100MHzprovidesthefollowingfeatures:

themostcostandsizeandweightoptimized3-sectorBTSsite
SWconfigurableradiomodule:thesameRFModuleforLTE,HSPA+andWCDMA
IP65with-35to+50Cwithconvectioncooling
smallestsizeandweight
smallestpowerconsumptionandOPEX
canbeusedasfeederlesssiteaswellwithoneDCand1...2opticalcables
TXdivandMIMO2TXcanbebuildusingtwo3-sectorRFModules
typically1/3ofDCandopticalcablingcomparedtositewithRemoteRFHeads
(RRH)
easyinstallation

6.12.4 System impacts


Interdependencies between features
Therearenointerdependenciesbetweenthisandanyotherfeature.
Impacts on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impacts on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.

Issue:01J

DN09185979

273

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Impacts on system performance and capacity


Newconfigurationsareavailable.

6.12.5 1306: FRMD Flexi 3-sector RF Module 800 management


data
Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.12.6 Sales information


ThismodulehassamepowerandMulticarrierlicensesasotherearliermodules.It
requiresBranchlicense.
Table171

Salesinformation

BSW/ASW
BSW

License control in network element

License control attributes

6.13 Description of LTE1514: Additional RF sharing


Configurations LTE-GSM
Introduction to the feature
ThisfeatureintroducesadditionalLTE-GSMRFSharingconfigurations,includinglarger
GSMsetupsandfour-RFModuleconfigurations.

6.13.1 Benefits
End-user benefits
Thisfeaturedoesnotaffecttheend-userexperience.
Operator benefits
Lowersitescosts,reducedneedtosplitthesites.

274

DN09185979

Issue:01J

LTERL40,FeatureDescriptionsandInstructions

DescriptionsofBTSsitesolutionfeatures

6.13.2 Requirements
Software requirements
Table172:Softwarerequirementsliststhesoftwarerequiredforthisfeature.

System release

Flexi Multiradio BTS

Flexi Multiradio 10
BTS

RL40

LBTS4.0

LBTS4.0

Table172

OMS

notrelevant

Softwarerequirements

UE

NetAct

MME

SAE GW

notrelevant

notrelevant

notrelevant

notrelevant

Hardware requirements
Thisfeaturerequiresnoneworadditionalhardware.

6.13.3 Functional description


Functional overview

Note: Notethatforconfigurationswithmorethan36GSMTRXsanadditionalGSM
SystemModuleisneeded.
Thefollowingconfigurationsareintroduced:

ConfigurationswiththreeRFModules(twoshared+oneGSM-dedicated):

3xFXEB,1+1+1LTE10/20MHzplusupto8+8+8(4+4+4+4+4+4)GSM
3xFXEB,1+1+1LTE20MHzplus6+6+6GSM

ConfigurationwithfourRFModules(twoshared+twoGSM-dedicated):
4xFXEB,1+1+1LTE10/20MHzplusupto12+12+12(4+4+4+8+8+8)GSM

6.13.4 System impact


Interdependencies between features
FeaureLTE447/BSS21250:SWSupportforRFsharingGSM-LTEisrequired.
Impact on interfaces
Thisfeaturehasnoimpactoninterfaces.
Impact on network and network element management tools
Thisfeaturehasnoimpactonnetworkmanagementandnetworkelementmanagement
tools.
Impact on system performance and capacity

Issue:01J

DN09185979

275

DescriptionsofBTSsitesolutionfeatures

LTERL40,FeatureDescriptionsandInstructions

Thisfeaturehasnoimpactonsystemperformanceorcapacity.

6.13.5 Management data


Forinformationonalarm,counter,keyperformanceindicator,andparameterdocuments,
seeReferencedocumentation.
Alarms
Therearenoalarmsrelatedtothisfeature.
Measurements and counters
Therearenomeasurementsorcountersrelatedtothisfeature.
Key performance indicators
Therearenokeyperformanceindicatorsrelatedtothisfeature.
Parameters
Therearenoparametersrelatedtothisfeature.

6.13.6 Sales information


Table173

276

Salesinformation

BSW/ASW

License control in network element

License control attributes

BSW

DN09185979

Issue:01J