Вы находитесь на странице: 1из 212

EDMT281512

Heat pump 50/60Hz


FBQ-E + RZQS, RZQ series

EDMT281512

Part 1 SkyAir FBQ-E + RZQS, RZQ series ..................................... 5


1. External appearance ...............................................................................7
2. Model name, power supply and nomenclature .......................................9
2.1 Model name and power supply ................................................................9
2.2 Nomenclature .........................................................................................10

3. Functions...............................................................................................11
4. Specifications ........................................................................................12
4.1
4.2
4.3
4.4
4.5

RZQS .....................................................................................................12
RZQ-LV1 ................................................................................................13
RZQ-HAY4A...........................................................................................15
RZQ-KCTLT ...........................................................................................17
RZQ-LUYLT ...........................................................................................19

5. Dimensions and service space .............................................................21


5.1
5.2
5.3
5.4
5.5

Indoor unit ..............................................................................................21


Wired remote controller ..........................................................................23
Wireless remote controller......................................................................25
Outdoor unit............................................................................................26
Installation Service Space ......................................................................32

6. Piping diagrams ....................................................................................42


7. Wiring diagrams ....................................................................................48
7.1 Indoor unit ..............................................................................................48
7.2 Outdoor unit............................................................................................49

8. Field wiring ............................................................................................57


9. Electric characteristics ..........................................................................58
10.Capacity tables......................................................................................63
10.1
10.2
10.3
10.4
10.5
10.6

RZQS .....................................................................................................63
RZQ-LV1 ................................................................................................65
RZQ-HAY4A...........................................................................................69
RZQ-KCTLT ...........................................................................................72
RZQ-LUYLT ...........................................................................................75
Capacity correction factor by the length of refrigerant piping .................78

11.Operation limits .....................................................................................80


12.Fan performance...................................................................................81
12.1 FBQ-E ....................................................................................................81

13.Airflow auto adjustment characteristics.................................................85


13.1 FBQ-E ....................................................................................................85

14.Sound level ...........................................................................................89


14.1 Indoor unit ..............................................................................................89
14.2 Outdoor unit............................................................................................91

15.Accessories.........................................................................................105
15.1 Indoor unit ............................................................................................105
15.2 Outdoor unit..........................................................................................106

Part 2 Installation of indoor / outdoor unit ............................... 107


1. Centre of gravity..................................................................................108
2. Installation of indoor unit .....................................................................111
2.1 FBQ50EVE / FBQ60EVE / FBQ71EVE / FBQ100EVE /
FBQ125EVE / FBQ140EVE .................................................................111

3. Installation of outdoor unit ...................................................................130


Table of contents

EDMT281512

3.1 RZQS50AV1 / RZQS60AV1 / RZQ71LV1 / RZQ100LV1 /


RZQ125LV1 .........................................................................................130
3.2 RZQ140LV1 .........................................................................................146
3.3 RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A ...........................162
3.4 RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT /
RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT .............................178
3.5 Equivalent piping length of joints (reference) .......................................206

Table of contents

EDMT281512

Publication list

Publication list
Refrigerant

Inverter/
Series
Non Inverter

Book No.

Type, Hz

Model name of
indoor / outdoor unit

Area

Note

Published
in

- Indoor units
FCQ71/100/125/140KVEA
FFQ25/35/50/60BV1B
FHQ35/50/60/71/100/125BVV1B
FBQ50/60BV1A
FBQ71/100/125/140DV1
EDHK281002 H/P 50Hz

RZQ

R410A

- Outdoor units
RZQ71KBV1
RZQ100/125/140HY4A
RXS25/35EBVMA
RXS50/60FVMA
RKS25/35EBVMA
RKS50/60FVMA

- Indoor units
FCQ50/60LUV1V
FCQ71-140LUV1
FFQ25-60BV1B
FHQ50/60BVV1V
FHQ35/71/100/125BVV1B
FHQ140CAVEA
FDXS25-60CVMA
FBQ50-71BV1A
FBQ50/60DV1V
EDVN281408 H/P 50Hz FBQ71-140DV1
FVQ50/60CVE
FVQ71-140CVEB
- Outdoor units
RZQ50/60KBV1V
RZQ50/60KBV4A
RZQ71-140KCV4A
RZQ100-140HAY4A
RXS25/35EBVMA
RXS50FAVMA
RXS50-71FVMA

Inverter

Hong Kong

Jun. 2010

- New lineup of indoor units:


FCQ50/60LUV1V
FHQ50/60BVV1V
Vietnam FBQ50/60DV1V
Sep. 2014
FVQ50/60CVE
- New lineup of outdoor units:
RZQ50/60KBV1V

- New line-up of indoor units:


FHQ71/100/125BWV1A
FBQ71/100/125/140DBVEA

- Indoor units
FCQ71/100/125/140KAVEA
FHQ71/100/125BWV1A
FHQ140CAVEA
FAQ71/100CVEA
FBQ71/100/125/140DBVEA Vietnam
India
EDMT281426 H/P 50Hz FVQ50/60CVE
FVQ71/100/125/140CVEB Hong Kong - Outdoor units
RZQS50/60AV1
RZQ71/100/125/140LV1
RZQ100/125/140HAY4A

RZQS
RZQ

Model change of indoor units:


FCQ71/100/125/140KVEA

FCQ71/100/125/140KAVEA
Mar. 2015
New line-up of outdoor units:
RZQS50/60AV1
RZQ71/100/125/140LV1

- Discontinued outdoor units:


RZQ71KBV1
RZQ50/60KBV4A
RZQ71-140KCV4A

- Indoor units
FBQ50/60/71/100/125/140EVE
H/P
EDMT281512 50/60Hz

EDMT281512 as shown by

Table of contents

- Outdoor units
RZQS50/60AV1
RZQ71/100/125/140LV1
RZQ100/125/140HAY4A
RZQ100/125/140KCTLT
RZQ100/125/140LUYLT

Vietnam
Philippines - New line-up of indoor units:
India
FBQ50/60/71/100/125/140EVE Aug. 2015
Hong Kong

Publication list

EDMT281512

Table of contents

EDMT281512

Part 1
SkyAir
FBQ-E + RZQS, RZQ series
Model series
50

60

71

100

125

140

Power
supply

FBQ

50E

60E

71E

100E

125E

140E

VE

RZQS

50A

60A

Class
Indoor
unit

V1
71L

Outdoor
unit
RZQ

100L

125L

140L

V1

100HA 125HA 140HA

Y4A

100KC 125KC 140KC

TLT

100LU 125LU 140LU

YLT

1. External appearance ...............................................................................7


2. Model name, power supply and nomenclature .......................................9
2.1 Model name and power supply ................................................................9
2.2 Nomenclature .........................................................................................10

3. Functions...............................................................................................11
4. Specifications ........................................................................................12
4.1
4.2
4.3
4.4
4.5

RZQS .....................................................................................................12
RZQ-LV1 ................................................................................................13
RZQ-HAY4A...........................................................................................15
RZQ-KCTLT ...........................................................................................17
RZQ-LUYLT ...........................................................................................19

5. Dimensions and service space .............................................................21


5.1
5.2
5.3
5.4
5.5

Indoor unit ..............................................................................................21


Wired remote controller ..........................................................................23
Wireless remote controller......................................................................25
Outdoor unit............................................................................................26
Installation Service Space ......................................................................32

6. Piping diagrams ....................................................................................42


7. Wiring diagrams ....................................................................................48
7.1 Indoor unit ..............................................................................................48
7.2 Outdoor unit............................................................................................49

8. Field wiring ............................................................................................57


9. Electric characteristics ..........................................................................58
10.Capacity tables......................................................................................63
10.1 RZQS .....................................................................................................63
10.2 RZQ-LV1 ................................................................................................65
10.3 RZQ-HAY4A...........................................................................................69
SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

10.4 RZQ-KCTLT ...........................................................................................72


10.5 RZQ-LUYLT ...........................................................................................75
10.6 Capacity correction factor by the length of refrigerant piping .................78

11.Operation limits .....................................................................................80


12.Fan performance...................................................................................81
12.1 FBQ-E ....................................................................................................81

13.Airflow auto adjustment characteristics.................................................85


13.1 FBQ-E ....................................................................................................85

14.Sound level ...........................................................................................89


14.1 Indoor unit ..............................................................................................89
14.2 Outdoor unit............................................................................................91

15.Accessories.........................................................................................105
15.1 Indoor unit ............................................................................................105
15.2 Outdoor unit..........................................................................................106

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

External appearance

1. External appearance

Indoor unit

FBQ-E

Wired
remote controller

BRC1C61

BRC1D61

BRC1E62

Wireless
remote controller

BRC4C65 (for FBQ-E)

SkyAir FBQ-E + RZQS, RZQ series

Signal receiver unit


(for FBQ-E)

External appearance

EDMT281512

Outdoor unit

RZQS50AV1
RZQS60AV1

RZQ71LV1

RZQ100LV1

RZQ100HAY4A
RZQ125HAY4A
RZQ140HAY4A

RZQ100KCTLT
RZQ125KCTLT
RZQ140KCTLT
RZQ100LUYLT
RZQ125LUYLT
RZQ140LUYLT

RZQ125LV1

RZQ140LV1

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Model name, power supply and nomenclature

2. Model name, power supply and nomenclature


2.1

Model name and power supply


Indoor unit
Type

Middle static pressure


ceiling mounted duct type

Model name
FBQ50EVE
FBQ60EVE
FBQ71EVE
FBQ100EVE
FBQ125EVE
FBQ140EVE
FBQ100EVE
FBQ125EVE
FBQ140EVE
FBQ100EVE
FBQ125EVE
FBQ140EVE
FBQ100EVE
FBQ125EVE
FBQ140EVE

SkyAir FBQ-E + RZQS, RZQ series

Outdoor unit
Model name
RZQS50AV1
RZQS60AV1
RZQ71LV1
RZQ100LV1
RZQ125LV1
RZQ140LV1
RZQ100HAY4A
RZQ125HAY4A
RZQ140HAY4A
RZQ100KCTLT
RZQ125KCTLT
RZQ140KCTLT
RZQ100LUYLT
RZQ125LUYLT
RZQ140LUYLT

Power supply intake

Indoor unit: 1 phase, 50Hz, 220-240V


Outdoor unit: 1 phase, 50Hz, 220-240V

Indoor unit: 1 phase, 50Hz, 220-240V


Outdoor unit: 3 phase, 50Hz, 415V
Indoor unit: 1 phase, 60Hz, 200V
Outdoor unit: 3 phase, 60Hz, 220V
Indoor unit: 1 phase, 60Hz, 200V
Outdoor unit: 3 phase, 60Hz, 380V

Model name, power supply and nomenclature

2.2

EDMT281512

Nomenclature

Indoor unit

50

VE
Power supply symbol
V1: 1 phase, 220-240V, 50Hz
VE: 1 phase, 220-240/220V, 50/60Hz
Indicates major design category
Capacity indication
Refrigerant and type
Q: R410A, Heat pump or Cooling only
Shape
C: Ceiling mounted cassette (Round flow)
H: Ceiling suspended
A: Wall mounted
B(-E): Middle static pressure ceiling mounted duct
Unit category
F: Air cooled split indoor unit

Outdoor unit

50

V1
Power supply symbol
V1: 1 phase, 220-240V, 50Hz
Y4: 3 phase, 415V, 50Hz
TL: 3 phase, 220V, 60Hz
YL: 3 phase, 380V, 60Hz
Indicates major design category
Capacity indication
Grade and refrigerant symbol
S: Inverter, R410A
Refrigerant and type
Q: R410A, Heat Pump
Inverter / Non inverter
Z: Inverter
Unit category
R: Air cooled split outdoor unit

10

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Functions

3. Functions
Category

1
Indoor
unit

Function

Outdoor
unit

Inverter control
Auto swing

FBQ50-60EVE

FBQ71-140EVE

FBQ100-140EVE

RZQS50-60AV1

RZQ71-140LV1
RZQ100-140HAY4A

RZQ100-140KCTLT
RZQ100-140LUYLT

Swing pattern selection

Draft prevention function (heating)

Independent up-and-down airflow

DC fan motor (Indoor unit)

{ (3 step)

{ (3 step)

{ (3 step)

Switchable fan speed

{ (*5)

{ (*5)

{ (*5)

High fan speed mode

Program Dry

High ceiling application

Two selectable temperature-sensors (*1)

Hot start (after defrost)

Year-round cooling applicable

Night quiet operation (*2)

Setpoint auto reset (*5)

Setpoint range set (*5)

Remote
Weekly schedule timer
controller
Off timer (programmed) (*5)

{ (*3)

{ (*3)

{ (*3)

On/Off timer (*6)

Anti-bacterial air filter

{ (*4)

{ (*4)

{ (*4)

Mould-proof air filter

Silver ion anti-bacterial drain pan

Mould-proof drain pan

Drain pump mechanism

Pre-charged for up to 30 m (*2)

Pre-charged for up to 10 m (*2)

{ (*4)

{ (*4)

{ (*4)

Low gas pressure detection (*2)

Emergency operation

Self-diagnosis function

Auto-restart

Auto-cooling/heating change-over

Control by 2 remote controllers

Group control by 1 remote controller

{ (*4)

{ (*4)

{ (*4)

Central remote control

Interlock control

DIII-NET communication standard

High-efficiency filter

Ultra long-life filter

Fresh air intake kit

Anti corrosion treated heat exchangers (*2)

Comfort

Cleanliness

Auto airflow rate

Long-life filter
Work & Filter sign
servicing
Ceiling soiling prevention

Control
features

Options
Others

External command control

Notes:

{: Functions exist.
: No functions
*1: Applicable when wired remote controller is used
*2: For the outdoor units
*3: Applicable when BRC1D61 or BRC1E62 is used
*4: Option
*5: Applicable when BRC1E62 is used
*6: Applicable when BRC1C61 is used

SkyAir FBQ-E + RZQS, RZQ series

11

Specifications

EDMT281512

4. Specifications
4.1

RZQS

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Cooling
Sound pressure
Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ50EVE
RZQS50AV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
5.0 (3.2-5.6)
17,100 (10,900-19,100)
4,300 (2,800-4,800)
6.0 (3.5-7.0)
20,500 (11,900-23,900)
5,200 (3,000-6,000)
FBQ50EVE

2451,000800
Cross fin coil
3261.4
0.288
Sirocco fan
230
18/15/12.5
300/250/208
635/530/442
Rated 50 (50-150 *5)
35/33/31
*4
37
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQS50AV1
Ivory white
770900320
Cross fin coil
2341.4
0.650
2YC63FXD
Hermetically sealed swing type
1.3
Propeller fan
70
52
48
50
44
64
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch, Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
50 (Equivalent length 70m)
30
R410A
2.0 (Charged for 30m)
Refer to the nameplate of compressor.
0.75
C: 3D096338
C: 4D095799
C: 4D090424, C: 4D090423

FBQ60EVE
RZQS60AV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
5.8 (3.2-6.0)
19,800 (10,900-20,500)
5,000 (2,800-5,200)
7.0 (3.5-8.0)
23,900 (11,900-27,300)
6,000 (3,000-6,900)
FBQ60EVE

2451,000800
Cross fin coil
3261.4
0.288
Sirocco fan
230
18/15/12.5
300/250/208
635/530/442
Rated 50 (50-150 *5)
35/33/31
*4
37
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQS60AV1
Ivory white
770900320
Cross fin coil
2341.4
0.650
2YC63FXD
Hermetically sealed swing type
1.6
Propeller fan
70
52
48
50
44
64
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch, Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
50 (Equivalent length 70m)
30
R410A
2.0 (Charged for 30m)
Refer to the nameplate of compressor.
0.75
C: 3D096338
C: 4D095799
C: 4D090424, C: 4D090423

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae

Piping length
7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

12

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

4.2

Specifications

RZQ-LV1

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Cooling
Sound pressure
Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ71EVE
RZQ71LV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
7.1 (3.2-8.0)
24,200 (10,900-27,300)
6,100 (2,800-6,900)
8.0 (3.5-9.0)
27,300 (11,900-30,700)
6,900 (3,000-7,700)
FBQ71EVE

2451,000800
Cross fin coil
3261.4
0.288
Sirocco fan
230
23/19.5/16
383/325/267
812/688/565
Rated 50 (50-150 *5)
38/35/33
*4
37
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ71LV1
Ivory white
770900320
Cross fin coil
2341.4
0.650
2YC63FXD
Hermetically sealed swing type
1.7
Propeller fan
70
52
49
51
45
64
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
50 (Equivalent length 70m)
30
R410A
2.0 (Charged for 30m)
Refer to the nameplate of compressor.
0.75
C: 3D096337
C: 4D095800A
C: 4D075745A, C: 4D075748A

FBQ100EVE
RZQ100LV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
10.0 (5.0-11.2)
34,100 (17,100-38,200)
8,600 (4,300-9,600)
11.2 (5.1-12.8)
38,200 (17,400-43,700)
9,600 (4,400-11,000)
FBQ100EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
32/27/22.5
533/450/375
1,130/953/794
Rated 50 (50-150 *5)
38/35.5/33
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ100LV1
Ivory white
990940320
Cross fin coil
2441.4
0.884
2YC63FXD
Hermetically sealed swing type
2.08
Propeller fan
200
76
51
53
47
75
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
2.9 (Charged for 30m)
Refer to the nameplate of compressor.
0.75
C: 3D096337
C: 4D095801
C: 4D089676, C: 4D089677A

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length
7.5m
(Horizontal)

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

SkyAir FBQ-E + RZQS, RZQ series

13

Specifications

EDMT281512

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Cooling
Sound pressure
Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ125EVE
RZQ125LV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
12.0 (5.7-14.0)
40,900 (19,500-47,800)
10,300 (4,900-12,000)
14.0 (6.0-16.2)
47,800 (20,500-55,300)
12,000 (5,200-13,900)
FBQ125EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ125LV1
Ivory white
1,170900320
Cross fin coil
2521.4
1.010
JT100G-VD@T3
Hermetically sealed scroll type
2.4
Propeller fan
70+70
95
51
53
47
98
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
3.15 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096337
C: 4D095802
C: 4D075741A, C: 4D075747A

FBQ140EVE
RZQ140LV1
1 phase, 220-240V, 50Hz
1 phase, 220-240V, 50Hz
Indoor/Outdoor unit side
13.0 (6.2-15.5)
44,400 (21,200-52,900)
11,200 (5,300-13,300)
16.0 (6.2-18.0)
54,600 (21,200-61,400)
13,800 (5,300-15,500)
FBQ140EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ140LV1
Ivory white
1,430940320
Cross fin coil
2641.4
1.286
JT100G-VD@T3
Hermetically sealed scroll type
3.15
Propeller fan
200+200
140
54
56
50
108
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
4.2 (Charged for 30m)
Refer to the nameplate of compressor.
1.5
C: 3D096337
C: 4D95802
C: 4D089680A, C: 4D089681A

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

14

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

4.3

Specifications

RZQ-HAY4A

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Cooling
Sound pressure
Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ100EVE
RZQ100HAY4A
1 phase, 220-240V, 50Hz
3 phase, 415V, 50Hz
Indoor/Outdoor unit side
10.0 (5.0-11.2)
34,100 (17,100-38,200)
8,600 (4,300-9,600)
11.2 (5.1-12.8)
38,200 (17,400-43,700)
9,600 (4,400-11,000)
FBQ100EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
32/27/22.5
533/450/375
1,130/953/794
Rated 50 (50-150 *5)
38/35.5/33
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ100HAY4A
Ivory white
1,345900320
Cross fin coil
2601.4
1.15
JT1G-VDYR@T
Hermetically sealed scroll type
1.9
Propeller fan
70+70
100
49
51
45
108
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
4.3 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096336
C: 4D095801
C: 4D061464A, C: 4D061483A

FBQ125EVE
RZQ125HAY4A
1 phase, 220-240V, 50Hz
3 phase, 415V, 50Hz
Indoor/Outdoor unit side
12.0 (5.7-14.0)
40,900 (19,500-47,800)
10,300 (4,900-12,000)
14.0 (6.0-16.2)
47,800 (20,500-55,300)
12,000 (5,200-13,900)
FBQ125EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ125HAY4A
Ivory white
1,345900320
Cross fin coil
2601.4
1.15
JT1G-VDYR@T
Hermetically sealed scroll type
2.4
Propeller fan
70+70
100
50
52
45
108
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
4.3 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096336
C: 4D095801
C: 4D061473A, C: 4D061484A

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length
7.5m
(Horizontal)

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

SkyAir FBQ-E + RZQS, RZQ series

15

Specifications

EDMT281512

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Cooling
Sound pressure
Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

FBQ140EVE
RZQ140HAY4A
1 phase, 220-240V, 50Hz
3 phase, 415V, 50Hz
Indoor/Outdoor unit side
13.0 (6.2-15.4)
44,400 (21,200-52,600)
11,200 (5,300-13,200)
16.0 (6.2-18.0)
54,600 (21,200-61,400)
13,800 (5,300-15,500)
FBQ140EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ140HAY4A
Ivory white
1,345900320
Cross fin coil
2601.4
1.15
JT1G-VDYR@T
Hermetically sealed scroll type
2.9
Propeller fan
70+70
100
50
52
46
108
9.5 (Flare)
15.9 (Flare)
26 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
75 (Equivalent length 90m)
30
R410A
4.3 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096336
C: 4D095802
C: 4D061482B, C: 4D061485B

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

16

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

4.4

Specifications

RZQ-KCTLT

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Sound pressure Cooling / Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ100EVE
RZQ100KCTLT
1 phase, 220V, 60Hz
3 phase, 220V, 60Hz
Indoor/Outdoor unit side
10.0 (5.0-11.4)
34,100 (17,100-38,900)
8,600 (4,300-9,800)
11.2 (5.6-12.8)
38,200 (19,100-43,700)
9,600 (4,800-11,000)
FBQ100EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
32/27/22.5
533/450/375
1,130/953/794
Rated 50 (50-150 *5)
38/35.5/33
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ100KCTLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT100GDVDL@J
Hermetically sealed scroll type
1.9
Propeller
70+70
95
49/52
45
99
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096334
C: 4D095802
C: 4D060229B, C: 4D060230B

FBQ125EVE
RZQ125KCTLT
1 phase, 220V, 60Hz
3 phase, 220V, 60Hz
Indoor/Outdoor unit side
12.5 (6.0-14.3)
42,700 (20,500-48,800)
10,800 (5,200-12,300)
14.0 (6.0-16.2)
47,800 (20,500-55,300)
12,000 (5,200-13,900)
FBQ125EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ125KCTLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT100GDVDL@J
Hermetically sealed scroll type
2.4
Propeller
70+70
95
49/52
45
99
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096334
C: 4D095801
C: 4D052735C, C: 4D052736C

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19.0CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length
7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

SkyAir FBQ-E + RZQS, RZQ series

17

Specifications

EDMT281512

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Sound pressure Cooling / Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

FBQ140EVE
RZQ140KCTLT
1 phase, 220V, 60Hz
3 phase, 220V, 60Hz
Indoor/Outdoor unit side
13.3 (6.2-15.8)
45,400 (21,200-53,900)
11,400 (5,300-13,600)
16.0 (6.2-18.1)
54,600 (21,200-61,800)
13,800 (5,300-15,600)
FBQ140EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ140KCTLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT100GDVDL@J
Hermetically sealed scroll type
2.9
Propeller
70+70
95
49/52
45
99
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096334
C: 4D095802
C: 4D052737C, 4D052738C

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19.0CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

18

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

4.5

Specifications

RZQ-LUYLT

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Sound pressure Cooling / Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

FBQ100EVE
RZQ100LUYLT
1 phase, 220V, 60Hz
3 phase, 380V, 60Hz
Indoor/Outdoor unit side
10.0 (5.0-11.4)
34,100 (17,100-38,900)
8,600 (4,300-9,800)
11.2 (5.6-12.8)
38,200 (19,100-43,700)
9,600 (4,800-11,000)
FBQ100EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
32/27/22.5
533/450/375
1,130/953/794
Rated 50 (50-150 *5)
38/35.5/33
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D.25O.D.32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ100LUYLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT1G-VDYR@T
Hermetically sealed scroll type
1.8
Propeller
70+70
95
49/51
45
101
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096335
C: 4D095802
C: 4D083253, 4D083256

FBQ125EVE
RZQ125LUYLT
1 phase, 220V, 60Hz
3 phase, 380V, 60Hz
Indoor/Outdoor unit side
12.5 (6.0-14.3)
42,700 (20,500-48,800)
10,800 (5,200-12,300)
14.0 (6.0-16.2)
47,800 (20,500-55,300)
12,000 (5,200-13,900)
FBQ125EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ125LUYLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT1G-VDYR@T
Hermetically sealed scroll type
2.4
Propeller
70+70
95
50/52
45
101
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096335
C: 4D095801
C: 4D083254, 4D083257

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19.0CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length
7.5m
(Horizontal)

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.

*5. External static pressure is changeable in 11 stages by remote controller.

SkyAir FBQ-E + RZQS, RZQ series

19

Specifications

EDMT281512

FBQ-E (Middle static pressure ceiling mounted duct type)


Model
Power supply

Indoor unit
Outdoor unit
Indoor unit
Outdoor unit
Power supply intake
kW
Btu/h
kcal/h
kW
Btu/h
kcal/h

Cooling capacity *1 *2

Heating capacity *1 *2
Indoor unit
Colour
Dimensions
Coil

Fan

HWD
Type
RowsStagesFin pitch
Face area
Type
Motor output
Airflow rate (H/M/L)

External static pressure


Sound pressure level (H/M/L) *3
Air filter
Mass
Liquid
Piping
Gas
connections
Drain
Wired
Remote controller (option)
Wireless
Outdoor unit
Colour
Dimensions
HWD
Type
Coil
RowsStagesFin pitch
Face area
Model
Comp.
Type
Motor output
Type
Motor output
Fan
Airflow rate
Sound pressure Cooling / Heating
level *3
Night quiet mode
Mass
Liquid
Piping
Gas
connections
Drain
Safety devices
Capacity step
Refrigerant control
Max. length
Ref. piping
Max. height difference
Model
Refrigerant
Charge (factory charge)
Model
Ref. oil
Charge
Specification
Drawing No.
Sound (Indoor)
Sound (Outdoor)

Notes:

FBQ140EVE
RZQ140LUYLT
1 phase, 220V, 60Hz
3 phase, 380V, 60Hz
Indoor/Outdoor unit side
13.1 (6.2-15.8)
44,700 (21,200-53,900)
11,300 (5,300-13,600)
16.0 (6.2-18.1)
54,600 (21,200-61,800)
13,800 (5,300-15,600)
FBQ140EVE

2451,400800
Cross fin coil
3261.4
0.433
Sirocco fan
300
36/30.5/25
600/508/417
1,271/1,077/883
Rated 50 (50-150 *5)
40/37.5/35
*4
47
9.5 (Flare)
15.9 (Flare)
VP25 (I.D25O.D32)
BRC1C61/BRC1D61/BRC1E62
BRC4C65
RZQ140LUYLT
Ivory white
1,170900320
Cross fin coil
2521.4
1.01
JT1G-VDYR@T
Hermetically sealed scroll type
2.9
Propeller
70+70
95
50/52
45
101
9.5 (Flare)
15.9 (Flare)
26.0 (Hole)
High pressure switch. Fuse.
Compressor revolution speed control (Inverter system)
Electronic expansion valve
70 (Equivalent length 90m)
30
R410A
3.7 (Charged for 30m)
Refer to the nameplate of compressor.
1.2
C: 3D096335
C: 4D095802
C: 4D083255, 4D083258

mm

m
W
m/min
l/s
cfm
Pa
dB(A)
kg
mm
mm
mm

mm

kW
W
m/min
dB(A)
dB(A)
kg
mm
mm
mm
%
m
m
kg
L

*1. The above data are based on the following conditions.


Cooling
Indoor: 27CDB, 19.0CWB
Outdoor: 35CDB, 24CWB

Heating
Indoor: 20CDB, 15CWB
Outdoor: 7CDB, 6CWB

Conversion formulae
Piping length

kcal/h=kW860
Btu/h=kW3412
l/s=m/min1000/60
cfm=m/min35.3

7.5m
(Horizontal)

*2. Capacities are net, including a deduction for cooling (an addition for heating) for indoor fan motor heat.
*3. Anechoic chamber conversion value, measured according to JIS parameters and criteria. During operation
these values are somewhat higher owing to ambient conditions.

*4. Air filter is not standard accessory, but please mount it in the duct system of the suction side.
Select its dust collection efficiency (gravity method) 50% or more.
*5. External static pressure is changeable in 11 stages by remote controller.

20

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

5. Dimensions and service space


5.1

Indoor unit

5.1.1

FBQ-E

SkyAir FBQ-E + RZQS, RZQ series

3D095426

Unit (mm)

FBQ50EVE / FBQ60EVE / FBQ71EVE

21

Dimensions and service space

EDMT281512

22

3D095427

Unit (mm)

FBQ100EVE / FBQ125EVE / FBQ140EVE

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

5.2

Dimensions and service space

Wired remote controller

BRC1C61
Unit (mm)

3D028952A

BRC1D61
Unit (mm)

3D048117

SkyAir FBQ-E + RZQS, RZQ series

23

Dimensions and service space

EDMT281512

BRC1E62
Unit (mm)

3D081567

24

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

5.3

Dimensions and service space

Wireless remote controller

BRC4C65 (for FBQ-E)


Unit (mm)

3D007898B

SkyAir FBQ-E + RZQS, RZQ series

25

Dimensions and service space

5.4

EDMT281512

Outdoor unit

26

3D064945G

Unit (mm)

RZQS50AV1 / RZQS60AV1 / RZQ71LV1

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

SkyAir FBQ-E + RZQS, RZQ series

3D089674B

Unit (mm)

RZQ100LV1

27

Dimensions and service space

EDMT281512

28

3D058488F

Unit (mm)

RZQ125LV1

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

SkyAir FBQ-E + RZQS, RZQ series

3D077411C

Unit (mm)

RZQ140LV1

29

Dimensions and service space

EDMT281512

30

3D060941B

Unit (mm)

RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

SkyAir FBQ-E + RZQS, RZQ series

3D060249D

Unit (mm)

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

31

Dimensions and service space

5.5

EDMT281512

Installation Service Space

RZQS50AV1 / RZQS60AV1 / RZQ71LV1

3D073764B

32

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

3D073764B

SkyAir FBQ-E + RZQS, RZQ series

33

Dimensions and service space

EDMT281512

RZQ100LV1

3D089675A

34

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

3D089675A

SkyAir FBQ-E + RZQS, RZQ series

35

Dimensions and service space

EDMT281512

RZQ125LV1 / RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

3D073763B

36

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

3D073763B

SkyAir FBQ-E + RZQS, RZQ series

37

Dimensions and service space

EDMT281512

RZQ140LV1

3D077417B

38

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

3D077417B

SkyAir FBQ-E + RZQS, RZQ series

39

Dimensions and service space

EDMT281512

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

3D071119E

40

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Dimensions and service space

3D071119E

SkyAir FBQ-E + RZQS, RZQ series

41

Piping diagrams

EDMT281512

6. Piping diagrams

3D089740

FBQ50EVE + RZQS50AV1
FBQ60EVE + RZQS60AV1

42

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Piping diagrams

1
3D064949F

FBQ71EVE + RZQ71LV1

SkyAir FBQ-E + RZQS, RZQ series

43

Piping diagrams

EDMT281512

3D089678

FBQ100EVE + RZQ100LV1

44

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Piping diagrams

1
3D058486H

FBQ125EVE + RZQ125LV1
FBQ140EVE + RZQ140LV1

SkyAir FBQ-E + RZQS, RZQ series

45

Piping diagrams

EDMT281512

3D060712B

FBQ100EVE + RZQ100HAY4A
FBQ125EVE + RZQ125HAY4A
FBQ140EVE + RZQ140HAY4A

46

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Piping diagrams

3D060254E

FBQ100EVE + RZQ100KCTLT
FBQ125EVE + RZQ125KCTLT
FBQ140EVE + RZQ140KCTLT
FBQ100EVE + RZQ100LUYLT
FBQ125EVE + RZQ125LUYLT
FBQ140EVE + RZQ140LUYLT

SkyAir FBQ-E + RZQS, RZQ series

47

Wiring diagrams

EDMT281512

7. Wiring diagrams
7.1

Indoor unit

3D092733A

FBQ50EVE / FBQ60EVE / FBQ71EVE / FBQ100EVE / FBQ125EVE / FBQ140EVE

48

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

7.2

Wiring diagrams

Outdoor unit

1
3D089620

RZQS50AV1 / RZQS60AV1

SkyAir FBQ-E + RZQS, RZQ series

49

Wiring diagrams

EDMT281512

3D064851K

RZQ71LV1

50

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Wiring diagrams

1
3D089520

RZQ100LV1

SkyAir FBQ-E + RZQS, RZQ series

51

Wiring diagrams

EDMT281512

3D056474K

RZQ125LV1

52

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Wiring diagrams

1
3D077448D

RZQ140LV1

SkyAir FBQ-E + RZQS, RZQ series

53

Wiring diagrams

EDMT281512

C: 3D047451H

RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

54

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Wiring diagrams

1
3D070626D

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT

SkyAir FBQ-E + RZQS, RZQ series

55

Wiring diagrams

EDMT281512

3D081698

RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

56

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Field wiring

8. Field wiring

FBQ50EVE + RZQS50AV1
FBQ60EVE + RZQS60AV1
FBQ71EVE + RZQ71LV1
FBQ100EVE + RZQ100LV1 / RZQ100HAY4A / RZQ100KCTLT / RZQ100LUYLT
FBQ125EVE + RZQ125LV1 / RZQ125HAY4A / RZQ125KCTLT / RZQ125LUYLT
FBQ140EVE + RZQ140LV1 / RZQ140HAY4A / RZQ140KCTLT / RZQ140LUYLT

4D095797

SkyAir FBQ-E + RZQS, RZQ series

57

Electric characteristics

EDMT281512

9. Electric characteristics

3D097408

FBQ50EVE + RZQS50AV1
FBQ60EVE + RZQS60AV1

58

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Electric characteristics

1
3D097401

FBQ71EVE + RZQ71LV1
FBQ100EVE + RZQ100LV1
FBQ125EVE + RZQ125LV1
FBQ140EVE + RZQ140LV1

SkyAir FBQ-E + RZQS, RZQ series

59

Electric characteristics

EDMT281512

3D097403

FBQ100EVE + RZQ100HAY4A
FBQ125EVE + RZQ125HAY4A
FBQ140EVE + RZQ140HAY4A

60

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Electric characteristics

1
C: 3D097402

FBQ100EVE + RZQ100KCTLT
FBQ125EVE + RZQ125KCTLT
FBQ140EVE + RZQ140KCTLT

SkyAir FBQ-E + RZQS, RZQ series

61

Electric characteristics

EDMT281512

3D097404

FBQ100EVE + RZQ100LUYLT
FBQ125EVE + RZQ125LUYLT
FBQ140EVE + RZQ140LUYLT

62

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

10. Capacity tables


10.1

RZQS

3D089737C

FBQ50EVE + RZQS50AV1

SkyAir FBQ-E + RZQS, RZQ series

63

Capacity tables

EDMT281512

3D089738B

FBQ60EVE + RZQS60AV1

64

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

10.2

Capacity tables

RZQ-LV1

1
3D097386

FBQ71EVE + RZQ71LV1

SkyAir FBQ-E + RZQS, RZQ series

65

Capacity tables

EDMT281512

3D097387

FBQ100EVE + RZQ100LV1

66

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

1
3D097388

FBQ125EVE + RZQ125LV1

SkyAir FBQ-E + RZQS, RZQ series

67

Capacity tables

EDMT281512

3D097389

FBQ140EVE + RZQ140LV1

68

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

10.3

Capacity tables

RZQ-HAY4A

1
3D097390

FBQ100EVE + RZQ100HAY4A

SkyAir FBQ-E + RZQS, RZQ series

69

Capacity tables

EDMT281512

3D097391

FBQ125EVE + RZQ125HAY4A

70

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

1
3D097392

FBQ140EVE + RZQ140HAY4A

SkyAir FBQ-E + RZQS, RZQ series

71

Capacity tables

10.4

EDMT281512

RZQ-KCTLT

3D097393

FBQ100EVE + RZQ100KCTLT

72

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

1
3D097394A

FBQ125EVE + RZQ125KCTLT

SkyAir FBQ-E + RZQS, RZQ series

73

Capacity tables

EDMT281512

3D097395

FBQ140EVE + RZQ140KCTLT

74

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

10.5

Capacity tables

RZQ-LUYLT

1
3D097396

FBQ100EVE + RZQ100LUYLT

SkyAir FBQ-E + RZQS, RZQ series

75

Capacity tables

EDMT281512

3D097397

FBQ125EVE + RZQ125LUYLT

76

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

1
3D097398

FBQ140EVE + RZQ140LUYLT

SkyAir FBQ-E + RZQS, RZQ series

77

Capacity tables

10.6

EDMT281512

Capacity correction factor by the length of refrigerant piping

10.6.1 RZQS / RZQ-L


RZQS50AV1 / RZQS60AV1
RZQ71LV1 / RZQ100LV1 / RZQ125LV1 / RZQ140LV1

3D089679

78

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Capacity tables

10.6.2 RZQ

RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A


The capacity of the unit has to be corrected in accordance with the length of refrigerant piping.
(The distance between the indoor unit and the outdoor unit)
RZQ50/60: Heating (98.8%)

Capacity correction factor

(%)
100

RZQ50/60: Cooling (97.2%)


7.5

RZQ100-140: Heating (96.7%)

95

RZQ71: Cooling (95%)

90
85

RZQ100: Cooling (84.2%)

80
RZQ125: Cooling (75.2%)

75
70

RZQ140: Cooling (70.0%)

05

Notes:

RZQ71: Heating (97.9%)

10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 (m)
Length of refrigerant piping (Total length)

1. line: Correction factor for Cooling Capacity,


line: Correction factor for Heating Capacity
2. The correction factor remains the same whether the outdoor unit is to be installed above or below
the indoor unit.
3. You cannot extend the refrigerant piping exceeding the limit shown in the above table.

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT
The capacity of the unit has to be corrected in accordance with the length of refrigerant piping.
(The distance between the indoor unit and the outdoor unit)

Capacity correction factor

100

(%) 7.5

RZQ50/60/71: Heating (97.9%)


RZQ100/125/140: Heating (96.9%)

95

RZQ50/60/71: Cooling (95%)

90
RZQ100: Cooling (85.4%)

85
80

RZQ125: Cooling (77.0%)

75
RZQ140: Cooling (72.2%)

70
05

Notes:

10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 (m)
Length of refrigerant piping (Total length)

1. line: Correction factor for Cooling Capacity


line: Correction factor for Heating Capacity
2. The correction factor remains the same whether the outdoor unit is to be installed above or below
the indoor unit.
3. You cannot extend the refrigerant piping exceeding the limit shown in the above table.

SkyAir FBQ-E + RZQS, RZQ series

79

Operation limits

EDMT281512

11. Operation limits


RZQS50AV1 / RZQS60AV1
RZQ71LV1 / RZQ100LV1 / RZQ125LV1 / RZQ140LV1
RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

3D046720M

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

3D052741D

80

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Fan performance

12. Fan performance


12.1

FBQ-E

3D095834

FBQ50EVE / FBQ60EVE

SkyAir FBQ-E + RZQS, RZQ series

81

Fan performance

EDMT281512

3D095835

FBQ71EVE

82

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Fan performance

1
3D095836

FBQ100EVE

SkyAir FBQ-E + RZQS, RZQ series

83

Fan performance

EDMT281512

3D095837

FBQ125EVE / FBQ140EVE

84

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Airflow auto adjustment characteristics

13. Airflow auto adjustment characteristics


13.1

FBQ-E

3D095826

FBQ50EVE / FBQ60EVE

SkyAir FBQ-E + RZQS, RZQ series

85

Airflow auto adjustment characteristics

EDMT281512

3D095827

FBQ71EVE

86

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Airflow auto adjustment characteristics

1
3D095828

FBQ100EVE

SkyAir FBQ-E + RZQS, RZQ series

87

Airflow auto adjustment characteristics

EDMT281512

3D095829

FBQ125EVE / FBQ140EVE

88

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

14. Sound level


14.1

Indoor unit

14.1.1 FBQ-E

4D095799

FBQ50EVE / FBQ60EVE

4D095800A

FBQ71EVE

SkyAir FBQ-E + RZQS, RZQ series

89

Sound level

EDMT281512

4D095801

FBQ100EVE

4D095802

FBQ125EVE / FBQ140EVE

90

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

14.2

Sound level

Outdoor unit

14.2.1 RZQS

4D090424

RZQS50AV1 / RZQS60AV1 (Cooling)

4D090423

RZQS50AV1 / RZQS60AV1 (Heating)

SkyAir FBQ-E + RZQS, RZQ series

91

Sound level

EDMT281512

14.2.2 RZQ-L

4D075745A

RZQ71LV1 (Cooling)

4D075748A

RZQ71V1 (Heating)

92

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

1
4D089676

RZQ100LV1 (Cooling)

4D089677A

RZQ100LV1 (Heating)

SkyAir FBQ-E + RZQS, RZQ series

93

Sound level

EDMT281512

4D075741A

RZQ125LV1 (Cooling)

4D075747A

RZQ125LV1 (Heating)

94

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

1
4D089680A

RZQ140LV1 (Cooling)

4D089681A

RZQ140LV1 (Heating)

SkyAir FBQ-E + RZQS, RZQ series

95

Sound level

EDMT281512

14.2.3 RZQ-HA

4D061464A

RZQ100HAY4A (Cooling)

4D061483A

RZQ100HAY4A (Heating)

96

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

1
4D061473A

RZQ125HAY4A (Cooling)

4D061484A

RZQ125HAY4A (Heating)

SkyAir FBQ-E + RZQS, RZQ series

97

Sound level

EDMT281512

4D061482B

RZQ140HAY4A (Cooling)

4D061485B

RZQ140HAY4A (Heating)

98

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

14.2.4 RZQ-KC

1
4D060229B

RZQ100KCTLT (Cooling)

4D060230B

RZQ100KCTLT (Heating)

SkyAir FBQ-E + RZQS, RZQ series

99

Sound level

EDMT281512

4D052735C

RZQ125KCTLT (Cooling)

4D052736C

RZQ125KCTLT (Heating)

100

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

1
4D052737C

RZQ140KCTLT (Cooling)

4D052738C

RZQ140KCTLT (Heating)

SkyAir FBQ-E + RZQS, RZQ series

101

Sound level

EDMT281512

14.2.5 RZQ-LU

4D083253

RZQ100LUYLT (Cooling)

4D083256

RZQ100LUYLT (Heating)

102

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Sound level

1
4D083254

RZQ125LUYLT (Cooling)

4D083257

RZQ125LUYLT (Heating)

SkyAir FBQ-E + RZQS, RZQ series

103

Sound level

EDMT281512

4D083255

RZQ140LUYLT (Cooling)

4D083258

RZQ140LUYLT (Heating)

104

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Accessories

15. Accessories
15.1

Indoor unit

15.1.1 FBQ-E
Optional
accessories

Model

Item
High-efficiency filter

FBQ50EVE FBQ60EVE FBQ71EVE FBQ100EVE FBQ125EVE FBQ140EVE


65%

KAFP632B80

90%

KAFP633B80

KAFP633B160

KDDFP63B80

KDDFP63B160

Filter chamber (for rear suction) (Note 1)


Long life filter (Note 1)
Service panel

KAFP632B160

KAFP631B80

KAFP631B160

White

KTBJ25K80W

KTBJ25K160W

Fresh white

KTBJ25K80F

KTBJ25K160F

Brown

KTBJ25K80T

KTBJ25K160T

KDAP25A71A

KDAP25A140A

Air discharge adapter


Shield plate for side plate

KDBD63A160
C: 3D095820A

Note:

1. If installing high efficiency filter and long-life filter to the unit, filter chamber is required.

Item

Remote controller

Model
FBQ50EVE FBQ60EVE FBQ71EVE FBQ100EVE FBQ125EVE FBQ140EVE

For Heat
Wireless
pump

BRC4C65

Wired (Note 1)

BRC1C61

Wired remote controller with weekly


schedule timer (Note 1)

BRC1D61

Navigation remote controller (Note 1)

BRC1E62

Adaptor for wiring


Wiring adaptor for electrical appendices (2)
Remote sensor
Mounting plate for adaptor PDB (Note 2, 3, 4)

KRP1C64
KRP4AA51
KRCS01-4B
KRP4A98

Central remote controller (Note 5)

DCS302CA61

Unified on/off controller (Note 5)

DCS301BA61

Schedule timer (Note 5)

DST301BA61

intelligent Touch Controller (Note 5)

DCS601C51
C: 3D095823B

Notes:

1. Wiring for wired remote controller to be procured locally.


2. Mounting plate is necessary for each adaptor marked .
3. Up to 2 adaptors can be fixed for each mounting plate.
4. Only one mounting plate can be installed for each indoor unit.
5. The indoor unit is equipped standardly with the interface adaptor for SkyAir series.
The interface adaptor for SkyAir series is not necessary for this indoor unit since it is equipped as standard.

SkyAir FBQ-E + RZQS, RZQ series

105

Accessories

15.2

EDMT281512

Outdoor unit

15.2.1 RZQS
Kit name
Name of option

RZQS50AV1
RZQS60AV1

Central drain plug

KKPJ5F180

Wire fixture for preventing


overturning

K-KYZP15C

Fixture for preventing


overturning

KPT-60B160

Demand adaptor

KRP58M51
C: 4D046721M

Note:

*1. For details, refer to the Option Handbook.

15.2.2 RZQ-L / HA
Optional
accessories

Kit name
Name of option
Central drain plug

RZQ71LV1
RZQ125LV1

RZQ100LV1
RZQ140LV1

RZQ100HAY4A
RZQ125HAY4A
RZQ140HAY4A

KKPJ5F180

KKPJ5G280

KKPJ5F180

Wire fixture for preventing overturning

K-KYZP15C

Fixture for preventing overturning

KPT-60B160

Demand adaptor

KKTP5B112

KPT-60B160

KRP58M51
C: 4D046721M
C: 4D077521D

Note:

*1. For details, refer to the Option Handbook.

15.2.3 RZQ-KC / LU
Optional
accessories

Kit name
Name of option

Remark

Central drain plug *1


Fixture for preventing
overturning

RZQ100KCTLT
RZQ125KCTLT
RZQ140KCTLT

RZQ100LUYLT
RZQ125LUYLT
RZQ140LUYLT
KKPJ5F180

Base stationary type

KPT-60B160

Wire type

K-KYZP15C

Demand adapter

KRP58M51
3D052740E

Note:

106

*1. Standard accessory.


*2. For details, refer to the Option Handbook.

SkyAir FBQ-E + RZQS, RZQ series

EDMT281512

Part 2
Installation of
indoor / outdoor unit
1. Centre of gravity..................................................................................108
2. Installation of indoor unit .....................................................................111
2.1 FBQ50EVE / FBQ60EVE / FBQ71EVE / FBQ100EVE ........................111

3. Installation of outdoor unit ...................................................................130


3.1 RZQS50AV1 / RZQS60AV1 / RZQ71LV1 / RZQ100LV1 /
RZQ125LV1 .........................................................................................130
3.2 RZQ140LV1 .........................................................................................146
3.3 RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A ...........................162
3.4 RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT /
RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT .............................178
3.5 Equivalent piping length of joints (reference) .......................................206

Installation of indoor / outdoor unit

107

Centre of gravity

EDMT281512

1. Centre of gravity
RZQS50AV1 / RZQS60AV1 / RZQ71LV1

Unit (mm)

4D064948F

RZQ100LV1

Unit (mm)

4D089656B

108

Installation of indoor / outdoor unit

EDMT281512

Centre of gravity

RZQ125LV1

Unit (mm)

4D058487H

RZQ140LV1

Unit (mm)

4D077529C

Installation of indoor / outdoor unit

109

Centre of gravity

EDMT281512

RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

Unit (mm)

4D061670B

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT /


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

Unit (mm)

4D060251E

110

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

2. Installation of indoor unit


2.1

FBQ50EVE / FBQ60EVE / FBQ71EVE / FBQ100EVE / FBQ125EVE / FBQ140EVE

2.1.1

Names and Functions of Parts

a
h

k
f
l
b
e
c

o
d

m
j

a Drain discharge device (built-in)


b Drain pan inspection window
Remote controller
c Depending on the system configuration, the
remote controller is not provided.
d Wiring between the indoor and outdoor units
e Air outlet grille (Field supply)
f Exhaust duct (Field supply)
g Refrigerant piping
h Drain piping
i

Model name (Model name plate)

Air filter (Optional parts)

k Suction filter chamber (Optional parts)


l

Suction duct (Field supply)

m Suction grille (Field supply)


Earth wiring
The wiring passes electricity from the inside
n
unit to the earth to prevent accidental electrical
shock.
o Power supply wiring
3P338600-19E

Installation of indoor / outdoor unit

111

Installation of indoor unit

2.1.2

EDMT281512

Installation

FBQ50EVE
FBQ60EVE
FBQ71EVE

FBQ100EVE
FBQ125EVE
FBQ140EVE

SPLIT SYSTEM
Air Conditioner

CONTENTS
1. SAFETY PRECAUTIONS ................................................ 1
2. BEFORE INSTALLATION ................................................ 2

r

3. SELECTION OF INSTALLATION LOCATION.................. 4


4. PREPARATION BEFORE INSTALLATION ...................... 4
5. INSTALLATION OF INDOOR UNIT ................................. 6
6. REFRIGERANT PIPING WORK ...................................... 6

r

7. DRAIN PIPING WORK .................................................... 8


8. DUCT WORK................................................................. 10
9. ELECTRIC WIRING WORK........................................... 11
10. FIELD SETTING ............................................................ 14
11. TEST OPERATION ........................................................ 16

r

1. SAFETY PRECAUTIONS
Be sure to follow this SAFETY PRECAUTIONS.
This product comes under the term appliances not accessible
to the general public.

r

This is a class A product. In a domestic environment this


product may cause radio interference in which case the user
may be required to take adequate measures.
r This manual classifies the precautions into WARNINGS and
CAUTIONS.
Be sure to follow all the precautions below: They are all
important for ensuring safety.

WARNING ..............Indicates a potentially

r

hazardous situation which,


if not avoided, could result in
death or serious injury.

CAUTION ...............Indicates a potentially


hazardous situation which,
if not avoided, may result in
minor or moderate injury.
It may also be used to alert
against unsafe practices.
r After the installation is completed, test the air conditioner
and check if the air conditioner operates properly. Give the
user adequate instructions concerning the use and cleaning
of the indoor unit according to the Operation Manual. Ask the
user to keep this manual and the Operation Manual together
in a handy place for future reference.

r
r

r

r

WARNING
r Ask your local dealer or qualified personnel to carry out
installation work.
Improper installation may result in water leakage, electric
shocks or a fire.
r Perform installation work in accordance with this installation
manual.
Improper installation may result in water leakage, electric
shocks or a fire.
r Consult your local dealer regarding what to do in case of
refrigerant leakage.
When the air conditioner is installed in a small room, it is
necessary to take proper measures so that the amount of

r

r

r

Installation manual

any leaked refrigerant does not exceed the concentration


limit in the event of a leakage.
Otherwise, this may lead to an accident due to oxygen
deficiency.
Be sure to use only the specified parts and accessories for
installation work.
Failure to use the specified parts may result in the air
conditioner falling down, water leakage, electric shocks, a
fire, etc.
Install the air conditioner on a foundation that can withstand
its mass.
Insufficient strength may result in the air conditioner falling
down and causing injury.
In addition, it may lead to vibration of indoor units and cause
unpleasant chattering noise.
Carry out the specified installation work in consideration of
strong winds, typhoons, or earthquakes.
Improper installation may result in an accident such as air
conditioner falling.
Make certain that all electrical work is carried out by qualified
personnel according to the applicable legislation (Note 1)
and this installation manual, using a separate circuit.
In addition, even if the wiring is short, make sure to use a
wiring that has sufficient length and never connect additional
wiring to make the length sufficient.
Insufficient capacity of the power supply circuit or improper
electrical construction may lead to electric shocks or a fire.
(Note 1) applicable legislation means All international,
national and local directives, laws, regulations
and/or codes which are relevant and applicable for
a certain product or domain.
Earth the air conditioner.
Do not connect the earth wiring to gas or water piping,
lightning conductor or telephone earth wiring.
Incomplete earthing may cause electric shocks or a fire.
Be sure to install an earth leakage breaker.
Failure to do so may cause electric shocks and a fire.
Disconnect the power supply before touching the electric
components.
If you touch the live part, you may get electric shocks.
Make sure that all wiring is secure, using the specified
wirings and ensuring that external forces do not act on the
terminal connections or wirings.
Incomplete connection or fixing may cause an overheat or a
fire.
When wiring between the indoor and outdoor units, and
wiring the power supply, form the wirings orderly so that the
control box lid can be securely fastened.
If the control box lid is not in place, overheating of the
terminals, electric shocks or a fire may be caused.
If refrigerant gas leaks during installation work, ventilate the
area immediately.
Toxic gas may be produced if refrigerant gas comes into
contact with a fire.
After completing the installation work, check to make sure
that there is no leakage of refrigerant gas.
Toxic gas may be produced if refrigerant gas leaks into the
room and comes into contact with a source of a fire, such as
a fan heater, stove or cooker.
Never directly touch any accidental leaking refrigerant. This
could result in severe wounds caused by frostbite.

English
3PN14093-14J

112

Installation of indoor / outdoor unit

EDMT281512

CAUTION
r Install drain piping according to this installation manual to
ensure good drainage, and insulate the piping to prevent
condensation.
Improper drain piping may cause water leakage, make the
furniture get wet.
r Install the air conditioner, power supply wiring, remote
controller wiring and transmission wiring at least 1 meter
away from televisions or radios to prevent image interference
or noise.
(Depending on the radio waves, a distance of 1 meter may
not be sufficient to eliminate the noise.)
r Install the indoor unit as far as possible from fluorescent
lamps.
If a wireless remote controller kit is installed, the transmission
distance may be shorter in a room where an electronic lighting
type (inverter or rapid start type) fluorescent lamp is installed.
r Do not install the air conditioner in places such as the
following:
1. Where there is mist of oil, oil spray or vapour for example
a kitchen.
Resin parts may deteriorate, and fall out or water may
leak.
2. Where corrosive gas, such as sulfurous acid gas, is
produced.
Corrosion of copper pipings or brazed parts may cause
the refrigerant to leak.
3. Where there is machinery which emits electromagnetic
waves.
Electromagnetic waves may disturb the control system,
and cause malfunction of the equipment.
 9JGTGCOOCDNGICUGUOC[NGCMYJGTGECTDQPDTG
or ignitable dust is suspended in the air or where volatile
COOCDNGUUWEJCUVJKPPGTQTICUQNKPGCTGJCPFNGF
If the gas should leak and remain around the air conditioner, it may cause ignition.
r The air conditioner is not intended for use in a potentially
explosive atmosphere.
r Pay careful attention when transporting the product.
Carry the product by the handle sections indicated on the
packaging material.
Do not hold the PP band since the PP band can become
loose and may result in danger.
r Do not touch the heat exchanger fins.
Inadvertently touching the fins can cause injury.

Installation of indoor unit

(2) Do not unpack the unit until it is carried to the installation location.
Where unpacking is unavoidable, use a sling of soft
material or protective plates together with a rope when
lifting, to avoid damage or scratches to the indoor unit.
r Have the customer actually operate the air conditioner while
looking at the operation manual.
Instruct the customer how to operate the air conditioner
(particularly cleaning of the air filters, operation procedures,
and temperature adjustment).
r Do not use the air conditioner in a salty atmosphere such as
coastal areas, vehicles, vessels or where voltage fluctuation
is frequent such as factories.
r Take off static electricity from the body when carrying out
wiring and the control box lid is removed.
The electric parts may be damaged.

2-1 ACCESSORIES
Check if the following accessories are attached to the
indoor unit.
Name

(1) Metal
clamp

(2) Drain hose

(3) Duct flange connection


screw

Quantity

1 pc.

1 pc.

See below
506071
18 pcs.
class
100125140
30 pcs.
class

Shape

Name

Joint insulating
material

(6) Sealing
material

(7) Sealing
material

(8) Clamp

Quantity

1 each

1 sheet

2 sheets

9 pcs.

Large
(Dark gray)

Medium
(Dark gray)

Thin
(4) For liquid
piping
Shape
Thick
(5) For gas
piping

Name

(9) Washer
clamp

Quantity

4 pcs.

Shape

2. BEFORE INSTALLATION

(10) Wire
(11) Washer
sealing material for hanger
2 sheets
Small
(Gray)

8 pcs.

Others
rOperation
manual
rInstallation
manual

When unpacking the indoor unit or moving the unit after


unpacked, hold the hangers (4 places) and do not apply
force to other parts (particularly refrigerant piping, drain
piping).
r Make sure to check in advance that the refrigerant to be
used for installation work is R410A.
(The air conditioner will not properly operate if a wrong
refrigerant is used.)
r For installation of the outdoor unit, refer to the installation
manual attached to the outdoor unit.
r Do not throw away the accessories until the installation work
is completed.
r After the indoor unit is carried into the room, to avoid the
indoor unit from getting damaged, take measures to protect
the indoor unit with packing materials.
(1) Determine the route to carry the unit into the room.

English

2
3PN14093-14J

Installation of indoor / outdoor unit

113

Installation of indoor unit

EDMT281512

2-2 OPTIONAL ACCESSORIES

2. Items to be checked at delivery

r A remote controller is required for the indoor unit.


(No remote controllers are required for multi slave units
in simultaneous multi operation.)
r There are 2 kinds of remote controller; wired type and
wireless type.
Install the remote controller to the place where the customer
has given consent.
Refer to the catalog for the applicable model.
(Refer to the installation manual attached to the remote
controller for how to install.)
r The indoor unit can be switched to lower suction.
(Refer to 4. PREPARATION BEFORE INSTALLATION.)
The side cover plate (KDBD63A160) is required in the case
of wiring from the bottom for underside suction.
For installation work, refer to the instruction sheet provided
with the side cover plate.

CARRY OUT THE WORK GIVING CAUTION


TO THE FOLLOWING ITEMS AND AFTER THE
WORK IS COMPLETED CHECK THESE AGAIN.
1. Items to be checked after the installation work is

completed
Items to be checked

In case of defective

Are the indoor and outdoor


units rigidly fixed?
Are the installation works of
the outdoor and indoor units
completed?
Have you carried out a leakage
test with the test pressure
specified in the outdoor unit
installation manual?
Is the insulation of refrigerant
piping and drain piping
completely carried out?
Does the drain flow out
smoothly?
Is the power supply voltage
identical to that stated in the
manufacturers label on the
air conditioner?
Are you sure that there is no
wrong wiring or piping or no
loose wiring?

Drop vibration
noise

Is earthing completed?
Are the sizes of electric
wiring according to the
specification?
Are any of air outlets or inlets
of the indoor and outdoor
units blocked with obstacles?
(It may lead to capacity drop
due to fan speed drop or
malfunction of equipment.)

Check column

Does not operate


burnout
Does not cool / Does
not heat

Items to be checked

Check column

Have you carried out field setting? (if necessary)


Are the control box lid, the air filter and the suction
grille attached?
Does the cool air discharge during the cooling
operation and the warm air discharge during the
heating operation? Does the indoor unit makes
unpleasant sound of air discharge?
Have you explained how to operate the air
conditioner showing the operation manual to the
customer?
Have you explained the description of cooling,
heating, program dry and automatic (cooling/
heating) given in the operation manual to the
customer?
If you set the fan speed at thermostat OFF, did you
explain the set fan speed to the customer.
Have you handed the operation manual and the
installation manual to the customer?
Have you checked that there is no generation
of abnormal noise (i.e., noise resulting from
contamination or missing parts)?
Is the printed circuit board switch not on the
emergency (EMG.) side?
The switch is factory set to the normal (NORM.) side.
If an optional accessory is in use, did you check the
operation of the optional accessory and make field
settings as needed?
Is the remote controller icon displayed? Is the
remote controller connected to the master unit if the
system is in simultaneous multi operation?
Have you explained failure examples of
3. SELECTION OF INSTALLATION LOCATION?

Points of the operation explanation


Water leakage
Water leakage
Does not operate
burnout
Does not operate
burnout

In addition to the general usage, since the items in the


operation manual with the
WARNING and
CAUTION marks are likely to result in human bodily
injuries and property damages, it is necessary not only
to explain these items to the customer but also to have
the customer read them.
Furthermore, it is necessary to have the customer read
through the troubleshooting items while explaining the
above items.

Danger in case of
leakage
Does not operate
burnout

Does not cool /


Does not heat

Is the external static


pressure set correctly?

Does not cool /


Does not heat

Have you recorded the


refrigerant piping length
and the refrigerant charge
amount added?

Refrigerant charge
amount is not clear

Make sure to recheck the items of SAFETY PRECAUTIONS.

English
3PN14093-14J

114

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

3. SELECTION OF INSTALLATION LOCATION


Hold the hangers at 4 locations to move the indoor unit
when unpacking or after unpacked, and do not apply force
to the piping (refrigerant and drain) and air outlet flange.
If the temperature and humidity in the ceiling is likely to
exceed 30C, RH80%, use the additional insulation stick to
the indoor unit.
Use the insulation such as glass wool or polyethylene
that has thickness of 10 mm or more. However, keep the
insulated outside dimension smaller than the ceiling
opening so that the unit may go through the opening at
installation.
(1) Select the installation location that meets the following
conditions and get approval of the customer.
r Where the cool and warm air spreads evenly in the
room.
r Where there are no obstacles in the air passage.
r Where drainage can be ensured.
r Where the ceilings lower surface is not remarkably
inclined.
r 9JGTGVJGTGKUUWHEKGPVUVTGPIVJVQYKVJUVCPFVJGOCUU
QHVJGKPFQQTWPKV
+HVJGUVTGPIVJKUKPUWHEKGPVVJGKPdoor unit may vibrate and get in contact with the ceiling
and generate unpleasant chattering noise.)
r 9JGTGCURCEGUWHEKGPVHQTKPUVCNNCVKQPCPFUGTXKEGECP
be ensured. (Refer to Fig. 1 and Fig. 2)
r Where the piping length between the indoor and the outdoor units is ensured within the allowable length. (Refer
to the installation manual attached to the outdoor unit.)
r 9JGTGVJGTGKUPQTKUMQHCOOCDNGICUNGCM

Maintenance
space for
electrical
components

<Failure example>
If there is an obstacle in the airflow path or proper installation
space is not provided, the indoor unit will cause air volume
reduction and take in air blown out of the indoor unit,
thus resulting in performance degradation or turning the
thermostat OFF frequently.

CAUTION
r Install the indoor and outdoor units, power supply wiring,
remote controller wiring and transmission wiring at least
1 meter away from televisions or radios to prevent image
interference or noise.
(Depending on the radio waves, a distance of 1 meter may
PQVDGUWHEKGPVVQGNKOKPCVGVJGPQKUG
r +PUVCNNVJGKPFQQTWPKVCUHCTCURQUUKDNGHTQOWQTGUEGPV
lamps.
If a wireless remote controller kit is installed, the transmission distance may be shorter in a room where an electronic
NKIJVKPIV[RG
KPXGTVGTQTTCRKFUVCTVV[RG WQTGUEGPVNCORKU
installed.
(2) Use hanging bolts for installation.
Investigate if the installation place can withstand the mass
of the indoor unit and, if necessary, hang the indoor unit
with bolts after it is reinforced by beams etc.

4. PREPARATION BEFORE INSTALLATION


(1) Check the relation of location between the ceiling
opening and the indoor unit hanging bolts. (unit [mm])
r Provide one of the following service spaces for the
maintenance and inspection of the control box and
drain pump or for other services.
1. Inspection ports 1 and 2 (450 450) (Fig. 3-1) and
a minimum space of 300 mm at the bottom of the
product (Fig. 3).
2. Inspection port 1 (450 450) on the control box side
and inspection port 2 on the bottom of the product.
(Fig. 4, arrow A-1)
3. Inspection port 3 on the bottom of the product and on
the bottom side of the control box. (Fig. 4, arrow A-2)
Control box

300 or more

Maintenance
space for
drain pan

450mm
or more

[ Required installation space ]


Figures indicate the minimum required installation space.

r * Dimension H1 indicates the product height.


r 5GEWTGCFQYPYCTFUNQRGQHCVNGCUVURGEKGFKP
7. DRAIN PIPING WORK and determine dimension H2.

Secure the maintenance


space for the drain pan and
electrical components.

Ceiling

H2 or more*

Inspection port
< In the case of (1)-1 >

Fig. 3

2500mm
or more

H1=245mm*

20mm
or more

Fig. 1

Ceiling
Floor

Fig. 2

English

4
3PN14093-14J

Installation of indoor / outdoor unit

115

Installation of indoor unit

EDMT281512

800

Inspection port 1
(450450)

200 or less

630
(Hanging bolt pitch)

Hanging bolts ( 4)

Air outlet
Bottom of
indoor unit

Inspection port 2*
(450450)

Air inlet

C
(Hanging bolt pitch)

500

Control box

(For drain pan


removal and
* Inspection port 2 is not required
component replacement) if the bottom space under the product
is accessible for work.

Fig. 3-1
20 or more

Control box

Ceiling

(4) Open installation holes


(in the case of installation onto the existing ceiling).
r Open the installation holes on the ceiling of the installation location, and work on the refrigerant piping, drain
piping, remote controller wiring (unless a wireless remote controller is used), and wiring between the indoor
and outdoor units to the piping connection port and
wiring connection port of the indoor unit (refer to each
piping and wiring procedure items).
r Ceiling framework reinforcement may be required in
order to keep the ceiling horizontal and prevent ceiling
vibration after opening the ceiling holes. For details,
consult your building and upholstery work contractors.
(5) Install the hanging bolts.
r Use M8 or M10 bolts for hanging the indoor unit.
Use hole-in-anchors for the existing bolts and embedFGFKPUGTVUQTHQWPFCVKQPDQNVUHQTPGYDQNVUCPFZVJG
KPFQQTWPKVTON[VQVJGDWKNFKPIUQVJCVKVOC[YKVJUVCPF
the mass of the unit.
In addition, adjust clearance (50 - 100 mm) from the ceiling in advance.
<Installation examples>
Ceiling slab
Foundation bolt

Inspection port

Inspection
port 1
(450450)

200mm
or less

Inspection
port 3

D=B+300 or more

(Indoor unit size


+ 300 or more)

Control box

800

Arrow A-1

Inspection port 2
800
(Indoor unit
size or more) Arrow A-2

Control box

< In the case of (1)-2, 3 >

Fig. 4
Table 1
Model
506071 class
100125140 class

(unit [mm])
B
1000
1400

Long nut or
turnbuckle

Indoor
unit

C
1038
1438

D
1300
1700

Hanging bolt

Note) Components shown in the gure above are


all local procurement.
(6) In the case of changing the preset suction to underside suction, replace the chamber cover and the sucVKQPCPIG
4GHGTVQ(KI
4GOQXGVJGUWEVKQPCPIGCPFEJCODGTEQXGT
4GRNCEGVJGUWEVKQPCPIGCPFVJGEJCODGTEQXGT

CAUTION
r 5GEWTGCUWHEKGPVOCKPVGPCPEGURCEGHQTVJGFTCKPRCP
and electrical components before installing the indoor
unit.
r 5GEWTGCUWHEKGPVOCKPVGPCPEGURCEGHQTVJGNVGT
chamber, and peripheral components before installing the
indoor unit.
Suction ange

(2) Mount canvas ducts to the air outlet and inlet so that
the vibration of the indoor unit will not be transmitted to the ducts or ceiling. Furthermore, attach sound
absorbing material (thermal insulation material) to the
duct inner walls and anti-vibration rubber to the hanging bolts (refer to 8. DUCT WORK).
(3) The indoor unit is set to standard external static pressure.
r If external static pressure is higher or lower than the
standard set value, the remote controller may be used to
make on-site setting change in the external static pressure.
Refer to 10. FIELD SETTING.

Replacement

Chamber cover
Fig. 5

English
3PN14093-14J

116

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

5. INSTALLATION OF INDOOR UNIT


Depending on the optional parts, it may be easier to attach
them before installing the indoor unit. Refer to also the
installation manual attached to the optional parts.
For installation, use the attached installation parts and
specified parts.
(1) Install the indoor unit temporarily.
r Fix the hanger to the hanging bolt.
/CMGUWTGVQUGEWTGN[ZVJGJCPIGTYKVJVJGPWVCPFVJG
washer for hanger (11) from the upper and lower side.
(Refer to Fig. 6)
If the washer clamp (9) is used, the upper side washer
for hanger (11) may be protected from falling off.
(Refer to Fig. 7)

CAUTION
r Install the indoor unit leveled.
If the indoor unit is inclined and the drain piping side gets
JKIJKVOC[ECWUGOCNHWPEVKQPQHQCVUYKVEJCPFTGUWNVKP
water leakage.
r Attach nuts on the upper and lower side of hanger.
If there is no upper nut and the lower nut is over-tightened,
the hanger and the top plate will deform and cause abnormal
sound.
r &QPQVKPUGTVOCVGTKCNUQVJGTVJCPVJCVURGEKGFKPVQ
the clearance between the hanger and the washer for
hanger (11).
Unless the washers are properly attached, the hanging
bolts may come off from the hanger.

[ Fix the hanger ]


Field supply

WARNING

Washer for
hanger (11)
(accessory)

The indoor unit must be securely installed on a place


that can withstand the mass.
+HVJGUVTGPIVJKUKPUWHEKGPVVJGKPFQQTWPKVOC[HCNNFQYP
and cause injuries.

6. REFRIGERANT PIPING WORK


Tighten
(double nut)
Fig. 6
[ Washer xing ]
Upper nut

Washer
clamp (9)
(accessory)
Insert

Washer for
hanger (11)
(accessory)

r For the outdoor unit refrigerant piping, refer to the installation


manual attached to the outdoor unit.
r Carry out insulation of both gas and liquid refrigerant piping
securely. If not insulated, it may cause water leakage. For
gas piping, use insulation material of which heat resistant
temperature is not less than 120C.
For use under high humidity, strengthen the insulation
material for refrigerant piping. If not strengthened, the
surface of insulation material may sweat.
r Before installation work, make sure that the refrigerant
is R410A. (Unless the refrigerant is R410A, the normal
operation cannot be expected.)

CAUTION
Fig. 7
r Keep the air outlet covered with a protective sheet to prevent
weld spatter and other foreign materials from entering the
indoor unit and damaging the resin drain pan.
(If holes or cracks are generated in the resin drain pan, water
can leak.)
(2) Adjust so that the unit is properly positioned.
(3) Check the level of the unit. (Refer to Fig. 8)
(4) Remove the washer clamp (9) used for preventing the
washer for hanger (11) from dropping and tighten the upper side nut.
Hanger

This air conditioner is a dedicated model for new refrigerant R410A. Make sure to meet the requirements
shown below and carry out installation work.
r 7UGFGFKECVGFRKRKPIEWVVGTUCPFCTKPIVQQNUHQT
R410A.
r 9JGPOCMKPICCTGEQPPGEVKQPEQCVVJGCTGFKPPGT
surface only with ether oil or ester oil.
r 7UGQPN[VJGCTGPWVUCVVCEJGFVQVJGCKTEQPFKVKQPGT
+HQVJGTCTGPWVUCTGWUGFKVOC[ECWUGTGHTKIGTCPV
leakage.
r To prevent contamination or moisture from getting
into the piping, take measures such as pinching or
taping the pipings.
&QPQVOKZUWDUVCPEGQVJGTVJCPVJGURGEKGFTGHTKIGTant such as air into the refrigeration circuit.
If the refrigerant leaks during the work, ventilate the
room.

Bottom of
product

Level

Vinyl tube
Feed water into the tube and
set the indoor unit to the water
levels on the left and right.
[Maintaining horizontality]
Fig. 8

English

r The refrigerant is pre-charged in the outdoor unit.


r When connecting the pipings to the air conditioner, make
sure to use a spanner and a torque wrench as shown in
Fig. 9.
r (QTVJGFKOGPUKQPQHCTGFRCTVCPFVJGVKIJVGPKPIVQTSWG
refer to the Table 2.
r 9JGPOCMKPICCTGEQPPGEVKQPEQCVVJGCTGFKPPGT
surface only with ether oil or ester oil.
(Refer to Fig. 10)
6JGPVWTPVJGCTGPWVVQVKOGUYKVJ[QWTJCPFCPF
screw in the nut.

6
3PN14093-14J

Installation of indoor / outdoor unit

117

Installation of indoor unit

EDMT281512

r After leak test, referring to Fig. 11, insulate both the gas
and liquid piping connection with the attached joint insulating material (4) and (5) to prevent the pipings from
getting exposed.
Then, tighten both the ends of insulating material with the
clamp (8).
r Wrap the sealing material (Medium) (7) around the joint
KPUWNCVKPIOCVGTKCN
 CPF
 
CTGPWVUGEVKQP DQVJVJG
gas and liquid piping.
r Make sure to bring the seam of joint insulating material (4)
and (5) to the top.

Torque wrench
Spanner

Flare nut

Union joint
Fig. 9

Gas side piping insulating method

Coat the ared inner surface


only with ether oil or ester oil

Joint insulating
material (5)
(accessory)
Flare nut
connection
Bring the
seam
to the top.

Fig. 10
Table 2
Tightening
torque
(Nm)

Dimension for
processing flare
A (mm)

68.6 6.8

19.5 0.2

45

13.0 0.2

R0.4-0.8

I 15.9

36.3 3.6

902

I 9.5

Wind around the


piping until top of the
are nut connection,
beginning at the base.

Do not leave
clearance.

Indoor unit

Flare shape

Piping
size
(mm)

Piping insulating
material (main unit)

Clamp (8)
(accessory)

Piping
insulating
material
(eld supply)

Sealing material
(7) Medium
(accessory)

Tighten the portion


where overlapped by
the piping insulating
material.

Do not expose the


piping in order to
prevent the vapor
condensation.

CAUTION
&QPQVJCXGQKNCFJGTGVQVJGUETGYZKPIRCTVQHTGUKP
parts.
If oil adheres, it may weaken the strength of screwed part.
&QPQVVKIJVGPCTGPWVUVQQVKIJV
If a flare nut cracks, the refrigerant may leak.
Gas piping

r If there is no torque wrench, use Table 3 as a rule of


thumb.
9JGPVKIJVGPKPICCTGPWVYKVJCURCPPGTJCTFGTCPF
harder, there is a point where the tightening torque suddenly increases.
From that position, tighten the nut additionally at the angle
shown in Table 3.
#HVGTVJGYQTMKUPKUJGFEJGEMUGEWTGN[VJCVVJGTGKUPQ
gas leak.
If the nut is not tightened as instructed, it may cause slow
refrigerant leak and result in malfunction (such as does
not cool or heat).

Liquid piping

Liquid side piping insulating method


Joint insulating
material (4)
(accessory)
Flare nut
connection

Piping insulating
material (main unit)

Bring the
seam
to the top.

Table 3
Piping size
(mm)
I 9.5
I 15.9

Tightening
angle
60 - 90
30 - 60

Recommended arm length of


tool used
approx. 200 mm
approx. 300 mm

CAUTION
+PUWNCVKQPQHGNFRKRKPIOWUVDGECTTKGFQWVWRVQVJG
connection inside the casing.
If the piping is exposed to the atmosphere, it may cause
sweating, burn due to touching the piping, electric shocks or
a fire due to the wiring touching the piping.

Do not leave
clearance.

Wind around the


piping, beginning
at the base.

Indoor unit
Piping
insulating
material
(eld supply)
Do not expose the
piping in order to
prevent the vapor
condensation.

Clamp (8)
(accessory)
Tighten the portion
where overlapped by
the piping insulating
material.

Sealing material
(7) Medium
(accessory)

Fig. 11

English
3PN14093-14J

118

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

r $GHQTGDTC\KPITGHTKIGTCPVRKRKPIJCXGPKVTQIGPQY
through the refrigerant piping and substitute air with nitrogen (NOTE 1) (Refer to Fig. 12). Then, carry out brazing
(NOTE 2).
#HVGTCNNVJGDTC\KPIYQTMUCTGPKUJGFECTT[QWVCTG
connection with the indoor unit. (Refer to Fig. 11)

1~1.5 m
Support

Downward
inclination of
1/100 or more

Good

Pressure reducing valve


Taping
Brazing place
Nitrogen
Refrigerant piping

Wrong

Stop valve

Fig. 13

Nitrogen
Fig. 12

CAUTION
NOTE
1. 6JGRTQRGTRTGUUWTGHQTJCXKPIPKVTQIGPQYVJTQWIJVJG
piping is approximately 0.02 MPa, a pressure that makes
one feel like slight breeze and can be obtained through a
pressure reducing valve.
2. &QPQVWUGWZYJGPDTC\KPITGHTKIGTCPVRKRKPI
7UGRJQURJQTEQRRGTDTC\KPINNGTOGVCN
$%W2,+5<
3264/B-Cu93P-710/795: ISO 3677) that does not require
WZ

+HEJNQTKPCVGFWZKUWUGFVJGRKRKPIYKNNDGEQTTQFGFCPF
KPCFFKVKQPKHWQTKPGKUEQPVCKPGFVJGTGHTKIGTCPVQKNYKNN
be deteriorated and the refrigerant circuit will be affected
badly.)
3. When carrying out leakage test of refrigerant piping and
VJGKPFQQTWPKVCHVGTVJGKPUVCNNCVKQPQHKPFQQTWPKVKUPKUJGFEQPTOVJGEQPPGEVKPIQWVFQQTWPKVKPUVCNNCVKQP
manual for test pressure.
Refer to also the outdoor unit installation manual or technical document for refrigerant piping.
4. In case of refrigerant shortage due to forgetting additional
refrigerant charge etc., it will result in malfunction such as
does not cool or does not heat.
Refer to the outdoor unit installation manual or technical
document for refrigerant piping.

CAUTION
Do not use antioxidant when brazing piping.
It may result in malfunction of components and clogging of
piping due to residue.

7. DRAIN PIPING WORK


(1) Carry out drain piping.
Carry out drain piping so that drainage is ensured.
r Select the piping diameter equal to or larger than
(except for riser) that of the connection piping (polyvinyl chloride piping, nominal diameter 25 mm, outside
diameter 32 mm).
r Install the drain piping as short as possible with downward inclination of 1/100 or more and without such that
air may not stagnate. (Refer to Fig. 13) (It may cause
abnormal sound such as bubbling noise.)

English

If drain stagnates in the drain piping, the piping may be


clogged.
r +HUWHEKGPVFQYPYCTFKPENKPCVKQPECPPQVDGGPUWTGF
carry out upward drain piping.
r Install supports at a distance of 1 to 1.5 m so that the pipKPIOC[PQVFGGEV(Refer to Fig. 13)
r Make sure to use the attached drain hose (2) and the
metal clamp (1).
Insert the drain hose (2) into the drain socket up to the
point where the socket diameter becomes larger.
Put the metal clamp (1) to the taped hose end and
tighten the metal clamp (1) with torque 1.2~1.5 Nm

`|0EO 
Indoor unit

Metal clamp (1)


(accessory)
Drain hose (2)
(accessory)
VP25 side
Tape
Fig. 14

CAUTION
r Do not tighten the metal clamp (1) with the torque more
VJCPVJGURGEKGFXCNWG
The drain hose (2), the socket or the metal clamp (1) may
be damaged.
r Wrap the vinyl tape around the end of the metal clamp
(1) so that the sealing material (Large) (6) to be used at
the next process may not be damaged with the clamp
end or bend the tip of the metal clamp (1) inward as
shown. (Refer to Fig. 15)

8
3PN14093-14J

Installation of indoor / outdoor unit

119

Installation of indoor unit

EDMT281512

<In case of sticking vinyl tape>

CAUTION
r To avoid the attached drain hose (2) getting excessive
force, do not bend nor twist it.
It may cause water leakage.
r As for drain piping connection, do not connect the drain
hose directly to a sewage that gives off ammonia odor.
(The ammonia in the sewage may go through the drain
piping and corrode the heat exchanger of the indoor unit.)
r In case of centralized drain piping, carry out piping work
according to the procedure shown in the following Fig. 17.

approx. 90

Tightened part

Vinyl tape

0 ~ 675 mm

Stick vinyl tape without


tearing the sealing
material (Large) (6).
<In case of bending the tip>

approx. 90

Tightened part

Centralized drain piping


Make a downward inclination of 1/100
or more to avoid stagnation of air.
If water stagnates in the drain
piping, it may cause clogging of
drain piping.

Bend the tip without tearing the


sealing material (Large) (6).
Fig. 15

Fig. 17

< Caution to be taken when carrying out upward drain


piping (Refer to Fig. 16) >
r The maximum height of the drain riser is 675 mm. Since
the drain pump mounted on this indoor unit is a high
head type, from the characteristic point of view, the
higher the drain riser the lower the draining noise.
Therefore, the drain riser of 300 mm or higher is recommended.
r For upward drain piping, keep the horizontal piping distance of 300 mm or less between the drain socket root
to the drain riser.
(unit [mm])
Ceiling slab
1~1.5 m

Support

Adjustable
(675 or less)

(850 or less)

300 or less

r As for the size of centralized drain piping, select the size


that meets the capacity of indoor units to be connected.
(Refer to the technical document)
r Positioning the upward drain piping at an angle may cause
QCVUYKVEJOCNHWPEVKQPCPFNGCFVQYCVGTNGCMCIG
r While replacing with new indoor unit, use the attached
new drain hose (2) and the metal clamp (1).
If an old drain hose or a metal clamp is used, it may
cause water leakage.
(2) #HVGTRKRKPIKUPKUJGFEJGEMKHVJGFTCKPQYU
smoothly.
=9JGPVJGGNGEVTKEYKTKPIYQTMKUPKUJGF?
r Gradually pour 1 liter of water from the inspection port
at the bottom of the drain socket on the left side of the
drain socket into the drain pan giving caution to avoid
splashing water on the electric components such as
FTCKPRWORCPFEQPTOFTCKPCIGD[QRGTCVKPIVJG
indoor unit under cooling mode according to
10. FIELD SETTING. (Refer to Fig. 18)
Control box

Upward drain piping


(Field supply)

Metal clamp (1)


(accessory)

Drain socket

Control box lid

Filling port
Drain pan

Drain hose (2)


(accessory)
Drain hose (2)
(accessory)

Terminal block
for wiring between
the indoor and
outdoor units
Air outlet
Screw

Level or upward
inclination
Keep the drain hose level or make a slight up-grade so
that air may not stagnate in the drain hose.
If air stagnates, the drain may ow oppositely when
the drain pump stops and generate abnormal sound.
Fig. 16

Drain socket
(with rubber cap)

Access
window

Drain pump
position

Plastic container
for pouring water

[Method of adding water]


Fig. 18
=9JGPVJGGNGEVTKEYKTKPIYQTMKUPQVPKUJGF?
r The electric wiring works (including earthing) must be
ECTTKGFQWVD[CSWCNKGFGNGEVTKEKCP

English
3PN14093-14J

120

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

r +HCSWCNKGFRGTUQPKUPQVRTGUGPVCHVGTVJGGNGEVTKEYKTKPIYQTMKUPKUJGFEJGEMVJGFTCKPCIGCEEQTFKPIVQVJG
OGVJQFURGEKGFKP[When the electric wiring work is
PKUJGF?.
1. Open the control box lid and connect the single phase
220 - 240 V power supply to the terminal (L, N) on the
terminal block (X2M).
Connect the earth wiring to the earth terminal.
2. Make sure the control box lid is closed before turning
on the power supply.
r Throughout the whole process, carry out the work
giving caution to the wiring around the control box
so that the connectors may not come off.
3. Gradually pour 1 liter of water from the air outlet on
the left side of the drain socket into the drain pan
giving caution to avoid splashing water on the electric
components such as drain pump. (Refer to Fig. 18)
4. When the power supply is turned on, the drain pump
will operate. Drainage can be checked at the transparent part of the drain socket.
(The drain pump will automatically stop after 10
minutes.)
6JGFTCKPCIGQHYCVGTECPDGEQPTOGFYKVJYCVGTNGXGN
change in the drain pan through the access window.
r Do not connect the drain piping directly to the sewage that gives off ammonia odor.
The ammonia in the sewage may go through the
drain piping and corrode the heat exchanger of the
indoor unit.
r &QPQVCRRN[GZVGTPCNHQTEGVQVJGQCVUYKVEJ
+V
may result in malfunction)
r Do not touch the drain pump.
Touching the drain pump may cause electric shocks.
r &QPQVCRRN[GZVGTPCNHQTEGVQVJGQCVUYKVEJ
'ZVGTPCNHQTEGOC[ECWUGCQCVUYKVEJOCNHWPEVKQP
5. Turn off the power supply after checking drainage,
and remove the power supply wiring.
6. Attach the control box lid as before.
(3) Sweating may occur and result in water leakage.
Therefore, make sure to insulate the following 2 locations (drain piping that laid indoors and drain sockets).
r Use the provided sealing material (large) (6), and perform the thermal insulation of the metal clamp (1) and
drain hose (2) after checking the drainage of water.
(Refer to Fig. 19)
Sealing material - Large
(6) (accessory)

8. DUCT WORK
Pay the utmost attention to the following items and
conduct the ductwork.
r Check that the duct is not in excess of the setting range of
external static pressure for the unit. (Refer to the technical
datasheet for the setting range.)
r Attach a canvas duct each to the air outlet and air inlet so
that the vibration of the equipment will not be transmitted to
the duct or ceiling.
Use a sound-absorbing material (insulation material) for the
lining of the duct and apply vibration insulation rubber to the
hanging bolts.
r At the time of duct welding, perform the curing of the duct so
that the sputter will not come in contact with the drain pan for
the filter.
r If the metal duct passes through a metal lath, wire lath, or
plate of a wooden structure, separate the duct and wall
electrically.
r Be sure to heat insulate the duct for the prevention of
dew condensation. (Material: Glass wool or styrene foam;
Thickness: 25 mm)
r Be sure to attach the field supply air filter to the air inlet of the
unit or field supply inlet in the air passage on the air suction
side. (Be sure to select an air filter with a duct collection
efficiency of 50 weight percent.)
r Explain the operation and washing methods of the locally
procured components (i.e., the air filter, air inlet grille, and air
outlet grille) to the customer.
r Locate the air outlet grille on the indoor side for the
prevention of drafts in a position where indirect contact with
people.
r The air conditioner incorporates a function to adjust the fan
to rated speed automatically. (10. FIELD SETTING)
Therefore, do not use booster fans midway in the duct.
Connection method of ducts on air inlet and outlet sides.
r Connect the field supply duct in alignment with the inner side
of the flange.
r Connect the flange and unit with the flange connection screw (3).
r Wrap aluminum tape around the flange and duct joint in
order to prevent air leakage.
Flange on air inlet side
(provided with the unit)
Screws for duct
anges (3)
(accessory)

Air inlet

Flange on air outlet side


(provided with the unit)
Insulation material
(eld supply)
Unit

Insulation material
(eld supply)

Air outlet
Canvas duct
(eld supply)

Screws
for duct
anges (3)
(accessory)

Fig. 20

No clearance is
allowed.
Drain hose (2)
(accessory)

CAUTION

Sealing material (Large) (6)


(accessory)
Start wrapping from where the
metal clamp (1) is tightened.

Connect the flange and unit with the flange connection screw
(3) regardless of whether the duct is connected to the air
inlet side.

Metal clamp (1)


(accessory)
Wrap the sealing material (Large) (6)
so that the metal clamp (1) end side
may be doubled.
Fig. 19

English

10
3PN14093-14J

Installation of indoor / outdoor unit

121

Installation of indoor unit

EDMT281512

9-3 WIRING CONNECTION METHOD

9. ELECTRIC WIRING WORK

CAUTION FOR WIRING

9-1 GENERAL INSTRUCTIONS


r Make certain that all electric wiring work is carried out by
qualified personnel according to the applicable legislation
and this installation manual, using a separate dedicated
circuit.
Insufficient capacity of the power supply circuit or improper
electrical construction may lead to electric shocks or a fire.
r Make sure to install an earth leakage breaker.
Failure to do so may cause electric shocks and a fire.
r Do not turn on the power supply (branch switch, branch
overcurrent circuit breaker) until all the works are finished.
r Multiple number of indoor units are connected to one
outdoor unit. Name each indoor unit as A-unit, B-unit .. and
the like. When these indoor units are wired to the outdoor
unit, always wire the indoor unit to the terminal indicated
with the same symbol on the terminal block. If the wiring and
the piping are connected to the different indoor units and
operated, it will result in malfunction.
r Make sure to earth the air conditioner.
Earthing resistance should be according to applicable
legislation.
r Do not connect the earth wiring to gas or water pipings,
lightning conductor or telephone earth wiring.
r Gas piping .................Ignition or explosion may occur if
the gas leaks.
r Water piping ..............Hard vinyl tubes are not effective
earths.
r Lightning conductor or telephone earth wiring ..................
Electric potential may rise abnormally if struck by a lightning bolt.
r For electric wiring work, refer to also the WIRING
DIAGRAM attached to the control box lid.
r Carry out wiring between the outdoor units, indoor units and
the remote controllers according to the wiring diagram.
r Carry out installation and wiring of the remote controller
according to the installation manual attached to the remote
controller.
r Do not touch the Printed Circuit Board assembly. It may
cause malfunction.

r For connection to the terminal block, use ring type crimp


style terminals with insulation sleeve or insulate the wirings
properly.
Wiring
Insulation sleeve
Ring type crimp
style terminals
Fig. 21
r Connect the terminal as shown in Fig. 22.
r Do not carry out soldering finish when stranded wirings
are used. (Otherwise, the loosening of wiring may result in
abnormal heat radiation.)

Use wirings the same in size


(if the air conditioner is
in simultaneous multi operation)

Fig. 22
(Abnormal heating may occur if the wirings are not tightened
securely.)
r Use the required wirings, connect them securely and fix
these wirings securely so that external force may not apply to
the terminals.
r Use a proper screw driver for tightening the terminal screws.
If an improper screw driver is used, it may damage the screw
head and a proper tightening cannot be carried out.
r If a terminal is over tightened, it may be damaged.
Refer to the table shown below for tightening torque of
terminals.
Table 5

9-2 SPECIFICATION FOR FIELD SUPPLY FUSES


AND WIRING
Table 4
Power supply wiring
Model

Field
fuses

Wiring

Size

Remote controller wiring


Transmission wiring
Wiring

Size

FBQ60EVE
FBQ71EVE
15A
FBQ125EVE

0.88 0.08
1.47 0.14
1.47 0.14

r &QPQVECTT[QWVUQNFGTKPIPKUJYJGPUVTCPFGFYKTKPIU
are used.

WARNING

FBQ50EVE

FBQ100EVE

Tightening torque (Nm)


Terminal block for remote controller
and transmission wirings
Terminal for power supply
Earth terminal

Wiring
Vinyl cord
size and
with sheath
H05VV-U3G
length
or cable
must
(2 core)
NOTE 1)
comply
with local
NOTE 2)
codes.

0.751.25 mm2

r When wiring, form the wirings orderly so that the control box
lid can be securely fastened. If the control box lid is not in
place, the wirings may come out or be sandwiched by the
box and the lid and cause electric shocks or a fire.
(1) Remove the control box lid.

FBQ140EVE

The lengths of remote controller wiring are as follows:


Remote controller wiring (indoor unit - remote controller) ....Max. 500 m

NOTE
1. Shows only in case of protected piping. Use H07RN-F in
case of no protection.
2. Vinyl cord with sheath or cable (Insulated thickness : 1 mm
or more)

Screws
(2 points)

Fig. 23

11

English
3PN14093-14J

122

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

(2) Connect the wiring into the control box through the
wiring intake beside the control box.
Wiring intake
(high voltage)
Wiring intake
Wiring between
the indoor and
outdoor units
Earth wiring
Power supply
wiring

(low voltage)
Remote controller
wiring

(5) 5GEWTGN[ZGCEJYKTKPIYKVJVJGRTQXKFGFENCOR
material (8).
Clamp (8)
(accessory)

2
Wiring between the
indoor and outdoor units,
earth wiring, and
power supply wiring

Remote controller wiring


Fig. 27

9-4 WIRING EXAMPLE


CAUTION
Be sure to install an earth leakage breaker to the outdoor unit.
This is to avoid electric shocks or a fire.

Fig. 24
(3) Follow the instructions below and perform wiring in
the control box.
Power supply terminals (X1M, X2M)

Outdoor unit
Indoor unit
1
1
2
2
3
3
Terminal block
Terminal block
Match the numbers

Terminal block (X1M)


Terminal block (X2M)
for wiring between the
for power supply
indoor and outdoor units wiring

X1M

Connection method of wiring


between the indoor and outdoor units

X2M

Connection method for


wiring between the
indoor and outdoor units,
and earth wiring

Securely x the wiring to


the provided wiring xture
with the clamp (8).

For the wiring of outdoor units, refer to the installation manual


attached to the outdoor units. Confirm the system type.
r Pair type:
1 remote controller controls 1 indoor unit (standard system).
(Refer to Fig. 28)
r Simultaneous operation system:
1 remote controller controls 2 indoor units
(2 indoor units operates equally). (Refer to Fig. 29)
r Group control:
1 remote controller controls up to 16 indoor units
(All indoor units operate according to the remote controller).
(Refer to Fig. 30)
r 2 remote controllers control:
2 remote controllers control 1 indoor unit. (Refer to Fig. 33)
Main power supply

Pair type

Earth leakage
circuit breaker

Remote controller wiring


(low voltage)

1~220-240V 50Hz
1~220V
60Hz

Outdoor unit

Connect the wiring


through the control box
up to the sheathed part.

1 2 3

Indoor unit
Terminal block (X3M) for remote controller wiring

Remote controller wiring


No polarity

Do not connect wiring between


the indoor and outdoor units
(high voltage).

<Remote controller wiring method>

Wiring between the indoor and


outdoor units (high voltage)
Earth wiring (high voltage)
Power supply wiring (high voltage)

Fig. 25

Earth leakage
circuit breaker
1~220-240V 50Hz
1~220V 60Hz

L
N

L
N

Indoor unit

Fig. 28

Main power supply


Earth leakage
circuit breaker

Wiring between the


indoor and outdoor units,
earth wiring, power
supply wiring, or remote
controller wiring

English

1~220-240V 50Hz
1~220V
60Hz

Outdoor unit
1 2 3

Indoor unit

(accessory)

Fig. 26

Remote controller
(Optional accessory)

1
2
3

Simultaneous operation system

(4) Mount the control box lid and wrap the wire sealing
material (small) (10) so that the wiring through hole
will be covered by the sealing material.
r Seal the clearance around the wirings with putty or insuNCVKPIOCVGTKCN
GNFUWRRN[ 
(If insects and small animals get into the indoor unit,
short-circuiting may occur inside the control box.)
Wiring through
hole
Wire sealing material (small) (10)

Wiring xture

P1
P2

P1
P2

Prohibited

P1 P2 F1 F2 T1 T2

Earth leakage
circuit breaker
1~220-240V
50Hz
1~220V
60Hz

L
N

Remote controller
(Optional accessory)

P1
P2

P1
P2

1
2
3

1
2
3

L
N

L
N

Indoor unit

P1
P2

Indoor unit
(slave)

Earth leakage
circuit breaker
L
N

1~220-240V
50Hz
1~220V
60Hz

Fig. 29

12
3PN14093-14J

Installation of indoor / outdoor unit

123

Installation of indoor unit

EDMT281512

NOTE
1. Terminal numbers of outdoor and indoor units must be
matched.
2-1. Connect the remote controller only to the master unit.
2-2. The remote controller needs to be wired only to the master
unit; it does not need to be connected to the slave units
through transition wiring. (Do not connect transition wiring
to the slave units.)
2-3. The indoor temperature sensor is effective only for indoor
units to which the remote controller is connected.
2-4. The length of wiring between the indoor unit and the
outdoor unit varies depending on the connected model,
the number of connected units, and the maximum piping
length.
For details, refer to the technical documents.

Wiring Method
(1) Remove the control box lid.
(2) Connect crossover wiring between the terminals (P1, P2)
inside the control box for the remote controller. (There is
no polarity.) (Refer to Fig. 31)
Terminal for remote
controller wiring (P1, P2)

Indoor unit 1

Terminal block
(X3M)
Crossover wiring

to next unit
Terminal block
(X3M)

Fig. 32

Group control
Main power
supply

Main power
supply

1~220-240V 50Hz
1~220V 60Hz

Earth leakage
circuit breaker

Indoor unit 2
(Master)

Outdoor unit

Earth leakage
circuit breaker

Main power
supply

1~220-240V 50Hz
1~220V 60Hz

Outdoor unit

1 2 3

Earth leakage
circuit breaker

2 remote controllers control

1~220-240V 50Hz
1~220V 60Hz

Outdoor unit

1 2 3

Main power supply


Earth leakage
circuit breaker

Indoor unit
(Slave)

1 2 3

Outdoor unit

Outdoor unit
Indoor unit
(Master)

1 2 3
P1 P2

Earth leakage
circuit breaker
1~220-240V
50Hz
1~220V
60Hz

L
N

1
2
3

P1 P2

P1 P2

P1 P2

Remote
controller
(Optional
accessory)

Remote
controller
(Optional
accessory)

Earth leakage
circuit breaker

Earth leakage
circuit breaker

1~220-240V NL
50Hz
Indoor unit 1~220V
60Hz
L
N

1
2
3

P1 P2

P1 P2

Remote
controller
(Optional
accessory)
1
2
3

1~220-240V NL
50Hz
Indoor unit 1~220V
60Hz
L
N

Indoor unit
Earth
leakage
circuit
breaker

L
N

Indoor unit

Fig. 30

L
N

1
2
3
L
N

1~220-240V 50Hz
1~220V 60Hz

NOTE

(NOTE 2)
P1
P2

Remote controller
P1
P2

Remote
Remote
controller 1 controller 2
(Optional
(Optional
accessory) accessory)

Remote controller
(Slave)
(Optional accessories)

Fig. 33

r Terminal numbers of outdoor and indoor units must be


matched.
When implementing group control
r When using as a pair unit or as a master unit for
simultaneous operation system, you may carry out
simultaneous start/stop (group) control up to 16 units with
the remote controller. (Refer to Fig. 31)
r In this case, all the indoor units in the group will operate in
accordance with the group control remote controller.
r Select a remote controller which matches as many of the
functions (airflow direction, etc.) in the group as possible.
Outdoor
unit 2

Outdoor
unit 1
Indoor
unit 1

P1
P2

Indoor
unit 2
(Slave)

Indoor
unit 2
(Master)

Outdoor
unit 16

Two remote controllers control (Controlling 1 indoor unit


by 2 remote controllers)
r When using 2 remote controllers, one must be set to MAIN
and the other to SUB.
MAIN/SUB CHANGEOVER
r Refer to the manual attached to the remote controller.
Wiring Method
(1) Remove the control box lid.
(2) Add wiring between the remote controller 2 (Sub) and the
terminal (P1, P2) of the terminal block (X3M) for the remote
controller in the control box. (There is no polarity.)
Terminal block
(X3M)
(Master*)

Indoor
unit 16

Group control remote controller

Fig. 31
Additional
remote controller
Remote
controller 1
(Main)

Remote
controller 2
(Sub)

* For simultaneous operation system, be sure to


connect the remote controller to the master unit.

Fig. 34

NOTE
r Terminal numbers of outdoor and indoor units must be
matched.

13

English
3PN14093-14J

124

Installation of indoor / outdoor unit

EDMT281512

10. FIELD SETTING


CAUTION
Before carrying out field setting, check the items mentioned in
1. Items to be checked after the installation work is
completed on page 3.
r Check if all the installation and piping works for the air
conditioner are completed.
r Check that the outside panel and piping cover of the indoor
and outdoor units are closed.
< FIELD SETTING >
After turning on the power supply, carry out field setting
from the remote controller according to the installation
state.
r Carry out setting at 3 places, Mode No., FIRST CODE No.
and SECOND CODE No..
The settings shown by
in the following tables indicate
those when shipped from the factory.
r The method of setting procedure and operation is shown in
the installation manual attached to the remote controller.
(Note) Though setting of Mode No. is carried out as a group,
if you intend to carry out individual setting by each
indoor unit or confirmation after setting, carry out
setting with the Mode No. shown in the parenthesis ( ).
r Ask your customer to keep the manual attached to the remote
controller together with the operation manual.
r Do not carry out settings other than those shown in the table.
r Settings are performed by selecting Mode No., FIRST
CODE No., and SECOND CODE No..

10-1 Settings for external static pressure


r Make settings in either method (a) or method (b).
(a) Make settings with Air volume automatic adjustment
function.
Air volume automatic adjustment function: The air volume
is adjusted to the rated air volume automatically.

Installation of indoor unit

(3) Make settings to adjust the air volume automatically.


After setting the operating mode to Fan, set the air conFKVKQPGTVQGNFUGVVKPIOQFGYKVJVJGQRGTCVKQPQHVJGCKT
conditioner stopped. Select Mode No. [21] (11 in the case
of batch settings), select FIRST CODE No. 7, and set the
SECOND CODE No. to 03.
Return to the Basic screen (Normal mode if a wireless
remote controller is used), and press the ON/OFF button.
The operation lamp is lit, and the indoor unit will go into fan
operation for air volume automatic adjustments (at which
time, do not adjust the opening of the air outlet or inlet).
The air volume adjustments will automatically terminate
approximately 1 to 15 minutes after the indoor unit comes
into operation, and the operation lamp will be OFF and the
indoor unit will come to a stop.

Table 6
Mode No.

FIRST
CODE
No.

Setting
content

11 (21)

Air volume
adjustment

SECOND CODE No.


01

02

03

Air volume
Air volume
adjustadjustment
ment start
completion

OFF

(4) After the air conditioner comes to a stop, be sure to check


with Mode No. [21] per indoor unit that the above SECOND
CODE No. is 02. If the operation of the air conditioner
does not stop automatically or the SECOND CODE No. is
not set to 02, repeat the setting procedure from (3). If the
remote controller displays an error, refer to 11-1 HOW TO
DIAGNOSE FOR PROBLEMS and check the error.

CAUTION
r If airflow pathway changes, such as duct and air outlet
changes, are made after air volume adjustments, be sure to
make Air volume automatic adjustment again.
r If airflow pathway changes, such as duct and air outlet
changes, are made after 11. TEST OPERATION or air
conditioner relocation, contact your dealer.

CAUTION
r Be sure to check that the external static pressure is within
the specification range before making settings. The external
static pressure will not be automatically adjusted and air
volume insufficiency or water leakage may result if the
external static pressure is outside the range. (Refer to the
technical document for the setting range of external static
pressure.)
r If the air conditioner is in simultaneous multi operation, the
air volume automatic adjustment function cannot be set
collectively for the slaves. Therefore, make main and slave
unit settings according to Simultaneous multi operation
individual settings.
(1) Check that the electrical wiring and duct work have been
completed.
(If the closing damper is set midway, be sure to check that
the damper is opened. Furthermore, check that the air
passage on the suction side is provided with an air filter
(field supply)).
(2) If air conditioner has more than one air outlet and air inlet,
be sure to make adjustments so that the air volume ratio of
each air outlet and the corresponding air inlet will conform
to the designed air volume ratio.
In that case, set the operating mode to Fan. (In the case
of changing the air volume, press the fan speed button on
the remote controller and change the current selection to
High, Medium, or Low.)

English

(b) Select external static pressure with the remote controller.


Check with Mode No. [21] per indoor unit that the SECOND
CODE No. for the above Air volume adjustment is set to 01
(OFF). (The SECOND CODE No. is factory set to 01 (OFF).)
Change the SECOND CODE No. by referring to the table
below according to the external static pressure of the duct to
be connected.
Table 7
External static
pressure

Mode No.

FIRST
CODE No.

50Pa
60Pa
70Pa
80Pa
90Pa
100Pa
110Pa
120Pa
130Pa
140Pa
150Pa

13 (23)

SECOND
CODE No.
05
06
07
08
09
10
11
12
13
14
15

14
3PN14093-14J

Installation of indoor / outdoor unit

125

Installation of indoor unit

EDMT281512

10-2 SETTING WHEN AN OPTIONAL ACCESSORY IS


ATTACHED
r For setting when attaching an optional accessory, refer to the
installation manual attached to the optional accessory.

10-3 SETTING FAN SPEED DURING THERMOSTAT


OFF
r Set the fan speed according to the using environment after
consultation with your customer.
r When the fan speed is changed, explain the set fan speed to
your customer.
Table 8
Setting
State of fan in
operation with
thermostat OFF
(cooling and heating)

Mode No.

FIRST
SECOND
CODE No. CODE No.

Normal

01
11 (21)

Stop

02

LL
Fan speed during
(Extra low)
cooling
thermostat OFF
Setting
LL
Fan speed during
(Extra low)
heating
thermostat OFF
Setting

12 (22)

01

12 (22)

01
02

r A message to inform the air filter cleaning time will be


indicated on the remote controller.
r Set the SECOND CODE No. shown in the Table 9 according
to the amount of dust or pollution in the room.
r The periodical filter cleaning time can be shortened
depending on the environment.
Table 9
Hours until
indication
Approx.
Normal
2500 hrs
More
Approx.
contaminated
1250 hrs
With indication
No indication*

Mode No.

FIRST
SECOND
CODE No. CODE No.

Table 11
Setting
Pair system (1-unit)
Simultaneous
operation
system (2-unit)
Simultaneous
operation
system (3-unit)
Double twin multi
(4-unit)

Mode No.

FIRST
CODE No.

SECOND
CODE No.
01
02

11 (21)

0
03
04

10-7 SIMULTANEOUS OPERATION SYSTEM INDIVIDUAL SETTING


It is easier if the optional remote controller is used when setting
the slave unit.
< Procedure >
r Perform the following procedure when setting the master and
slave unit separately.
r
in the tables indicates factory settings.
(Note) The Mode No. is set on a group basis. To individually
set a Mode No. for each indoor unit or confirm the
settings, set the Mode No. in the parenthesis.
(1) Change the SECOND CODE No. to 02, individual setting,
so that the slave unit can be individually set.
Table 12

01
0
02

10 (20)
3

01
02

* Use No indication setting when cleaning indication is not


necessary such as the case of periodical cleaning being carried out.

r Change the SECOND CODE No. by referring to the table


below in the case of remote control.
Table 10
Setting content

Mode No.
(Note)

FIRST
CODE No.

Forced stop
Start-stop control

12 (22)

Setting

Mode No.

FIRST
CODE No.

7PKGFUGVVKPI
Individual setting

11 (21)

SECOND
CODE No.
01
02

(2) 2GTHQTOGNFUGVVKPI
4GHGTVQVQ HQTVJGOCUVGT
unit.
(3) 6WTPQHHVJGOCKPRQYGTUWRRN[UYKVEJCHVGT
 KUPKUJGF
(4) Detach remote controller from the master unit and connect
it to the slave unit.

10-5 Remote control settings


(forced stop or start-stop control)

SECOND
CODE No.
01
02

<In the case of using a wireless remote controller>


r In the case of using a wireless remote controller, address
settings for the wireless remote controller are required in
addition to the above.
For settings, refer to the operation manual provided with the
wireless remote controller.

15

r When using in simultaneous operation system mode,


change the SECOND CODE No. as shown in Table 11.
r When using in simultaneous operation system mode, refer
to SIMULTANEOUS OPERATION SYSTEM INDIVIDUAL
SETTING section to set master and slave units separately.

02

10-4 SETTING FILTER SIGN

Contamination

10-6 SETTING NUMBER OF THE CONNECTED INDOOR UNITS AS SIMULTANEOUS OPERATION


SYSTEM

(5) Turn on the main power supply switch again, and as in (1),
change the SECOND CODE No. to 02, individual setting
for the slave unit.
(6) 2GTHQTOGNFUGVVKPI
4GHGTVQVQ HQTVJGUNCXG
unit.
(7) 6WTPQHHVJGOCKPRQYGTUWRRN[UYKVEJCHVGT
 KUPKUJGF
(8) If there is more than one slave unit, repeat steps (4) to (7).
(9) Detach the remote controller from the slave unit after the
setting, and reattach to the master unit. This is the end of
the setting procedure.
* You do not need to rewire the remote controller from the
master unit if the optional remote controller for slave unit
is used. (However, remove the wiring attached to the
remote controller terminal block of the master unit.) After
the slave unit setting, remove the remote controller wiring, and rewire the remote controller to the master unit.
(The indoor unit does not operate properly when two or
more remote controllers are attached to the unit in the
simultaneous operation system mode.)

English
3PN14093-14J

126

Installation of indoor / outdoor unit

EDMT281512

(3)(7)
Earth
leakage
circuit
breaker
Outdoor unit

Installation of indoor unit

[Mode switching]
Main
power supply
1~220-240V 50Hz
1~220V
60Hz

1 2 3

Indoor unit
(Master)

Indoor unit
(Slave)

NOTE)

1 2 3
P1 P2

L N

Indoor unit
(Master)

1 2 3
P1 P2

L N

Earth leakage
circuit breaker
L N

Once
(Press 4
seconds
or more)

Once

Test
operation
mode

Once
*
*

Once

1 2 3
P1 P2

P1 P2

L N

Earth leakage
circuit breaker
L N

Indoor unit
(Slave)

Normal
operating
mode

Wireless remote controller

ce
On

Earth
leakage
circuit
L N breaker
Power supply
1~220-240V 50Hz
1~220V 60Hz

1~220-240V 50Hz
1~220V
60Hz

1 2 3

1 2 3
L N

BRC1C, BRC1D,

Once

NOTE)

Main
power supply

Earth
leakage
circuit
breaker
Outdoor unit

Earth leakage
circuit breaker
L N

Power supply
Power supply
Power supply
1~220-240V 50Hz
1~220-240V 50Hz
1~220-240V 50Hz
1~220V 60Hz
1~220V 60Hz
1~220V 60Hz P1 P2
P1 P2
( 9 ) Remote controller
Remote controller ( 4 )
(1)
(5)
(2)
(6)

Field setting
* After leaving 10
seconds or
more, the mode
returns to the
normal
operating mode.

Outdoor
Indoor
Malfunction
unit type
unit type
code
Once code
Once
code
display
display
display
Inspection mode

Fig. 36

Fig. 35

11-1 HOW TO DIAGNOSE FOR PROBLEMS


NOTE
r Terminal numbers of outdoor and indoor units must be
matched.

11. TEST OPERATION


Complete all the 1. Items to be checked after the
installation work is completed on page 3. Please also refer
to the installation manual attached to outdoor unit.
(1) The settings of BRC1E model remote controller should be
performed while referring to the manual attached to the
remote controller.
(2) The settings of the other remote controller should be
switched in accordance with the following procedure.
r Make sure that the installation work for the indoor and
outdoor units are all completed.
r Make sure that the following items are all closed: the
control box lid of the indoor unit and the outer board and
piping cover of the outdoor unit.
r After completing the refrigerant piping, drain piping, and
electrical wiring, clean the interior of the indoor unit and
front panel. Next, perform test operation in accordance
with the installation manual attached to the outdoor unit
in order to protect the unit. (It is recommended that the
VGUVQRGTCVKQPKURGTHQTOGFKPVJGRTGUGPEGQHSWCNKGF
electrical technician or engineer.)
r In test operation, make sure that fan speed can be obtained according to the settings.
r +HKPVGTKQTYQTMKUUVKNNWPPKUJGFYJGPVGUVQRGTCVKQP
PKUJGUGZRNCKPVQVJGEWUVQOGTVJCVVJGCKTEQPFKVKQPGT
must not be operated until interior work is completed in
order to protect the indoor units.
(If the indoor unit is operated under this condition, paint,
INWGCPFQVJGTOCVGTKCNUWUGFFWTKPIVJGKPVGTKQTPishing work will contaminate the indoor unit. This may
cause water splashes or leakage.)
r If a malfunction occurs and the air conditioner cannot operate, refer to 11-1 HOW TO DIAGNOSE FOR
PROBLEMS.
r After completing the test operation, press the INSPECTION/TEST OPERATION button once to put the indoor
unit in inspection mode, and make sure the malfunction
code is 00 (= normal).
If the code reads anything other than 00, refer to 11-1
HOW TO DIAGNOSE FOR PROBLEMS.
r Press the INSPECTION/TEST OPERATION button four
times to return to normal operation mode.

English

With the power on, troubles can be monitored on the


remote controller.
The fault diagnosis for BRC1E model remote controller
should be performed while referring to the installation
manual supplied with the remote controller. For the other
remote controllers, perform the fault diagnosis using the
following procedure.
Trouble shooting with the remote controller display.
1. With the wired remote controller. (NOTE 1)
When the operation stops due to trouble, the opGTCVKQPNCORCUJGUCPFVJGFKURNC[KPFKECVGU

and the malfunction code. Diagnosis can be


carried out using the malfunction code list according to the indicated malfunction code.
In addition, when in group control it indicates the
unit No., so the malfunction detected unit No. will
DGENCTKGF(QTTGUGVVKPIVJGOCNHWPEVKQPUGG
(NOTE 2).
2. With the wireless remote controller.
(Also refer to the operation manual attached to the
wireless remote controller.)
When the operation stops due to trouble, the
FKURNC[QPVJGKPFQQTWPKVCUJGU+PUWEJCECUG
diagnose the fault contents with the table on the
Malfunction code list looking for the Malfunction
code which can be found by following procedures.
(NOTE 2)
(1) Press the INSPECTION /TEST OPERATION button,
qKUFKURNC[GFCPFpqCUJGU
(2) 2TGUUVJG241)4#//+0)6+/'DWVVQPCPFPF
the unit No. which stopped due to trouble.
Number of beeps 3 short beeps
...................Perform all the following operations
1 short beep
...................Perform (3) and (6)
1 long beep
...................No trouble
(3) Press the OPERATION MODE SELECTOR
DWVVQPCPFWRRGTIWTGQHVJGOCNHWPEVKQPEQFG
CUJGU
(4) Continue pressing the PROGRAMMING TIME
DWVVQPWPKVKVOCMGUUJQTVDGGRUCPFPFVJG
upper code.
(5) Press the OPERATION MODE SELECTOR
DWVVQPCPFNQYGTIWTGQHVJGOCNHWPEVKQPEQFG
CUJGU

16
3PN14093-14J

Installation of indoor / outdoor unit

127

Installation of indoor unit

EDMT281512

(6) Continue pressing the PROGRAMMING TIME


DWVVQPWPKVKVOCMGUCNQPIDGGRCPFPFVJGNQYGT
code.
r A long beep indicate the malfunction code.

NOTE
1. When the INSPECTION/OPERATION button on the
remote controller is pressed, the
indication starts
CUJKPI
2. When the ON/OFF button is kept pressed for 5 seconds or
longer during the inspection mode, the above trouble history indication disappears. In this case, after the malfuncVKQPEQFGKPFKECVKQPCUJGUVYKEGVJGKPFKECVKQPQHEQFG
becomes 00 (normal) and unit NO. becomes 0. Then,
the display automatically changes from the inspection
mode to the normal mode.

High pressure malfunction


(Outdoor unit)

E4

Low pressure malfunction


(Outdoor unit)

E5

Compressor motor lock


malfunction (Outdoor unit)

E6

Compressor motor lock by


over current (Outdoor unit)
Outdoor fan motor lock malfunction (Outdoor unit)

E7

Outdoor fan instant overcurrent malfunction


(Outdoor unit)

E8

Input overcurrent
(outdoor unit)

E9

Electric expansion valve


malfunction (Outdoor unit)

EA

Cooling/heating switch
malfunction (Outdoor unit)

F3

Discharge piping temperature malfunction


(Outdoor unit)

F6

High pressure control


(in cooling) (Outdoor unit)

H0

Sensor fault for inverter


(Outdoor unit)

H3

High pressure switch failure


(Outdoor unit)

Indoor fan motor overload,


over current, lock

H4

Low pressure switch failure


(Outdoor unit)

Indoor Printed Circuit Board


connection failure

H7

A8

Indoor unit power supply


voltage abnormal

Outdoor fan motor position


signal malfunction
(Outdoor unit)

H8

CT abnormality
(Outdoor unit)

AF

*WOKFKGTU[UVGOOCNHWPEtion
H9

Outdoor air thermistor


system malfunction
(Outdoor unit)

J1

Pressure sensor system


malfunction (batch)
(Outdoor unit)

J2

Abnormal stop is applied


Current sensor system maldepending on the model or
function (Outdoor unit)
condition.

J3

Discharge piping thermistor Abnormal stop is applied


depending on the model or
system malfunction
(Outdoor unit)
condition.

J5

Suction piping thermistor


system malfunction
(Outdoor unit)

J6

Outdoor heat exchanger


distributor liquid piping
thermistor malfunction
(Outdoor unit)

Abnormal stop is applied


depending on the model or
condition.

11-2 MALFUNCTION CODE


r For places where the malfunction code is left blank,
the
indication is not displayed. Though the system
continues operating, be sure to inspect the system and make
repairs as necessary.
r Depending on the type of indoor or outdoor unit, the
malfunction code may or may not be displayed.
MalfuncDescriptions and measures
tion code
A1

Indoor Printed Circuit Board


failure

A3

Drain level abnormal

A6

Remarks

Air cleaner faulty


AH

AJ

Only the air cleaner does


not function.

Capacity setting failure

Capacity setting adapter


or capacity data error, or
disconnection of the capacity setting adapter, failure
to connect the adapter, or
the capacity is not set to the
data-retention IC.

Abnormal stop is applied


depending on the model or
condition.

C1

Transmission error between


indoor Printed Circuit Board
(Master) and indoor Printed
Circuit Board (Slave)

C4

Indoor heat exchanger


liquid pipe temperature
sensor malfunction

Abnormal stop is applied


depending on the model or
condition.

C5

Indoor heat exchanger


condenser / evaporator
temperature sensor malfunction

Abnormal stop is applied


depending on the model or
condition.

J7

Abnormal stop is applied


depending on the model or
condition.

Suction air thermistor


malfunction

Abnormal stop is applied


depending on the model or
condition.

Outdoor heat exchanger


condenser / evaporator
thermistor malfunction
(Outdoor unit)

J8

Abnormal stop is applied


depending on the model or
condition.

CJ

Remote controller air


thermistor malfunction

Remote controller thermo


does not function, but
body thermo operation is
enabled.

Liquid piping thermistor


system malfunction
(Outdoor unit)

J9

Gas piping thermistor malfunction (cooling)


(Outdoor unit)

E0

Action of safety device


(Outdoor unit)

JA

E1

Outdoor Printed Circuit


Board failure (Outdoor unit)

Discharge piping pressure


sensor system malfunction
(Outdoor unit)

C9

17

E3

English
3PN14093-14J

128

Installation of indoor / outdoor unit

EDMT281512

Installation of indoor unit

JC

Suction piping pressure


sensor system malfunction
(Outdoor unit)

UE

Transmission error (between indoor unit and centralized remote controller)

L1

Inverter system malfunction


(Outdoor unit)

UC

Remote controller address


setting error

L3

Reactor thermistor malfunction (Outdoor unit)

UJ

Accessory equipment
transmission error

L4

Overheated heat-radiating
P
1WVFQQTWPKV

Inverter cooling failure.

L5

Instantaneous overcurrent
(Outdoor unit)

The compressor engines


and turbines may be experiencing a ground fault or
short circuit.

L8

Electric thermal
(Outdoor unit)

The compressor engines


and turbines may be overloaded and disconnected.

L9

Stall prevention
(Outdoor unit)

The compressor may be


locked.

LC

Transmission malfunction between inverter and


outdoor control unit
(Outdoor unit)

P1

Open-phase (Outdoor unit)

P3

DCL sensor system malfunction (Outdoor unit)

P4

*GCVTCFKCVKPIPVJGTOKUtor malfunction
(Outdoor unit)

P6

DC output current sensor


system malfunction
(Outdoor unit)

CAUTION
After test operation is completed, check the items mentioned in
the clause 2 2. Items to be checked at delivery on page 3.
If the interior finish work is not completed when the test
operation is finished, for protection of the air conditioner, ask
the customer not operate the air conditioner until the interior
finish work is completed.
If the air conditioner is operated, the inside of the indoor units
may be polluted by substances generated from the coating and
adhesives used for the interior finish work and cause water
splash and leakage.

To the operator carrying out test operation

Abnormal stop is applied


depending on the model or
condition.

PJ

Capacity setting failure


(Outdoor unit)

Capacity setting adapter


or capacity data error, or
disconnection of the capacity setting adapter, failure
to connect the adapter, or
the capacity is not set to the
data-retention IC.

U0

Suction piping temperature


abnormal (Outdoor unit)

The refrigerant may be


KPUWHEKGPV
Abnormal stop is applied
depending on the model or
condition.

U1

Reverse phase
(Outdoor unit)

Reverse two phase of L1,


L2 and L3 leads.

U2

Power voltage malfunction


(Outdoor unit)

The inverter open-phase or


main circuit condenser may
be malfunctioning.
Abnormal stop is applied
depending on the model or
condition.

U4
UF

Transmission error (between indoor and outdoor


units)

Wiring error between


indoor and outdoor unit. Or
Indoor and outdoor Printed
Circuit Board failure.

U5

Transmission error (between indoor and remote


controller units)

Transmission between
indoor unit and remote
controller is not performed
properly.

U7

Transmission error of the


inverter module

U8

Transmission error between main and sub remote


controllers (sub remote
controller malfunction)

UA

Field setting error

English

Abnormal stop is applied


depending on the model or
condition.

After test operation is completed, before delivering the air


conditioner to the customer, confirm that the control box lid is
closed.
In addition, explain the power supply status (power supply ON/
OFF) to the customer.

System setting error of the


simultaneous on/off multisplit type.

18
3PN14093-14J

Installation of indoor / outdoor unit

129

Installation of outdoor unit

EDMT281512

3. Installation of outdoor unit


3.1

RZQS50AV1 / RZQS60AV1 / RZQ71LV1 / RZQ100LV1 / RZQ125LV1

1P379050-1A

130

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379050-1A

Installation of indoor / outdoor unit

131

Installation of outdoor unit

EDMT281512

1P379050-1A

132

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379050-1A

Installation of indoor / outdoor unit

133

Installation of outdoor unit

EDMT281512

1P379050-1A

134

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379050-1A

Installation of indoor / outdoor unit

135

Installation of outdoor unit

EDMT281512

1P379050-1A

136

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379050-1A

Installation of indoor / outdoor unit

137

Installation of outdoor unit

EDMT281512

1P379051-1A

138

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379051-1A

Installation of indoor / outdoor unit

139

Installation of outdoor unit

EDMT281512

1P379051-1A

140

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379051-1A

Installation of indoor / outdoor unit

141

Installation of outdoor unit

EDMT281512

1P379051-1A

142

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379051-1A

Installation of indoor / outdoor unit

143

Installation of outdoor unit

EDMT281512

1P379051-1A

144

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P379051-1A

Installation of indoor / outdoor unit

145

Installation of outdoor unit

3.2

EDMT281512

RZQ140LV1

1P325929-1E

146

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325929-1E

Installation of indoor / outdoor unit

147

Installation of outdoor unit

EDMT281512

1P325929-1E

148

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325929-1E

Installation of indoor / outdoor unit

149

Installation of outdoor unit

EDMT281512

1P325929-1E

150

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325929-1E

Installation of indoor / outdoor unit

151

Installation of outdoor unit

EDMT281512

1P325929-1E

152

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325929-1E

Installation of indoor / outdoor unit

153

Installation of outdoor unit

EDMT281512

1P325930-1E

154

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325930-1E

Installation of indoor / outdoor unit

155

Installation of outdoor unit

EDMT281512

1P325930-1E

156

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325930-1E

Installation of indoor / outdoor unit

157

Installation of outdoor unit

EDMT281512

1P325930-1E

158

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325930-1E

Installation of indoor / outdoor unit

159

Installation of outdoor unit

EDMT281512

1P325930-1E

160

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P325930-1E

Installation of indoor / outdoor unit

161

Installation of outdoor unit

3.3

EDMT281512

RZQ100HAY4A / RZQ125HAY4A / RZQ140HAY4A

1P296089-1B

162

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296089-1B

Installation of indoor / outdoor unit

163

Installation of outdoor unit

EDMT281512

1P296089-1B

164

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296089-1B

Installation of indoor / outdoor unit

165

Installation of outdoor unit

EDMT281512

1P296089-1B

166

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296089-1B

Installation of indoor / outdoor unit

167

Installation of outdoor unit

EDMT281512

1P296089-1B

168

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296089-1B

Installation of indoor / outdoor unit

169

Installation of outdoor unit

EDMT281512

1P296090-1B

170

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296090-1B

Installation of indoor / outdoor unit

171

Installation of outdoor unit

EDMT281512

1P296090-1B

172

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296090-1B

Installation of indoor / outdoor unit

173

Installation of outdoor unit

EDMT281512

1P296090-1B

174

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296090-1B

Installation of indoor / outdoor unit

175

Installation of outdoor unit

EDMT281512

1P296090-1B

176

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1P296090-1B

Installation of indoor / outdoor unit

177

Installation of outdoor unit

3.4

EDMT281512

RZQ100KCTLT / RZQ125KCTLT / RZQ140KCTLT /


RZQ100LUYLT / RZQ125LUYLT / RZQ140LUYLT

RZQ50KCVLT
RZQ60KCVLT
RZQ71KCVLT
RZQ100KCVLT
RZQ125KCVLT
RZQ140KCVLT

RZQ100KCTLT
RZQ125KCTLT
RZQ140KCTLT

RZQ100LUYLT
RZQ125LUYLT
RZQ140LUYLT

SPLIT SYSTEM Air Conditioner

Installation manual

CONTENTS
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.

SAFETY PRECAUTIONS...............................................................................................2
BEFORE INSTALLATION ..............................................................................................4
SELECTING INSTALLATION SITE................................................................................5
INSTALLATION SERVICING SPACE ............................................................................6
PRECAUTIONS ON INSTALLATION...........................................................................10
REFRIGERANT PIPING WORK ..................................................................................12
EVACUATING ..............................................................................................................19
REFILLING THE REFRIGERANT ................................................................................20
ELECTRICAL WIRING WORK.....................................................................................22
ON SITE SETTING AND CHECK ITEMS BEFORE TEST RUN..................................26
ON SITE SETTINGS ....................................................................................................27
TEST RUNS .................................................................................................................28
WIRING DIAGRAM ......................................................................................................30

IMPORTANT: INSULATION RESISTANCE OF THE COMPRESSOR


If, after installation, refrigerant accumulates in the compressor, the insulation resistance can drop, but if it is
at least 1 M, then the machine will not break down.
s Turn on the power and leave it on for six hours. Then, check to see if the insulation resistance of the compressor has risen or not.
The compressor will heat up and evaporate any refrigerant in the compressor.
Check the following items if the earth leakage breaker is triggered.
s Make sure that the interrupter is compatible with harmonics.
This unit has an inverter, so an interrupter capable of handling harmonics is needed to prevent malfunction
of the interrupter itself.
1. This unit uses R410A as a refrigerant. For R410A refrigerant, the entry of any impurities (mineral oils such
as SUNISO oil and liquids) must be prevented more strictly. Be sure to follow the precautions in chapter
6-1 PRECAUTIONS ON REFRIGERANT PIPING.
2. The design pressure of this unit high pressure area is 4.00 MPa, and the low pressure area is 2.21 MPa.
The local inter-unit piping is a high pressure area. Use a local inter-unit piping which supports the design
pressure. For the piping specifications, please refer to chapter 6. REFRIGERANT PIPING WORK.
3. R410A is a mixed refrigerant. Be sure to charge additional refrigerant as liquid.
(Charging the additional refrigerant as gas will change the refrigerant composition and prevent normal
operation.)
Be sure to connect a R410A indoor unit.
See the catalog for indoor unit models which can be connected.
(Normal operation is not possible when connected to other units.)

English
3P281953-1D

178

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

1. SAFETY PRECAUTIONS
Please read the these " SAFETY CONSIDERATIONS" carefully before installing air conditioning unit and
be sure to install it correctly. After completing the installation, make sure that the unit operates properly
during the start-up operation.
Please instruct the customer on how to operate the unit and keep it maintained.
Also, inform customers that they should store this installation manual along with the operation manual for
future reference.
Meaning of WARNING and CAUTION notices.
Both are important notices for safety. Be sure to follow them.

WARNING ........Failure to follow these instructions properly may result in personal injury or loss of life.
CAUTION ..........Failure to observe these instructions properly may result in property damage or
personal injury, which may be serious depending on the circumstances.
After completing installation, conduct a trial operation to check for faults and explain to the customer how to
operate the air conditioner and take care of it with the aid of the operation manual. Ask the customer to store
the installation manual along with the operation manual for future reference.
This air conditioner comes under the term appliances not accessible to the general public.
s

s
s

s
s
s
s

s
s
s

s
s

WARNING
Ask your dealer or qualified personnel to carry out installation work.
Do not attempt to install the air conditioner yourself. Improper installation may result in water leakage,
electric shocks or fire.
Install the air conditioner in accordance with the instructions in this installation manual.
Improper installation may result in water leakage, electric shocks or fire.
When installing the unit in a small room, take measures against to keep refrigerant concentration from
exceeding allowable safety limits in the event of refrigerant leakage.
Contact the place of purchase for more information. Excessive refrigerant in a closed ambient can lead to
oxygen deficiency
Be sure to use only the specified accessories and parts for installation work.
Failure to use the specified parts may result in the unit falling, water leakage, electric shocks or fire.
Install the air conditioner on a foundation strong enough to withstand the weight of the unit.
A foundation of insufficient strength may result in the equipment falling and causing injury.
Carry out the specified installation work after taking into account strong winds, typhoons or earthquakes.
Failure to do so during installation work may result in the unit falling and causing accidents.
Make sure that a separate power supply circuit is provided for this unit and that all electrical work is carried
out by qualified personnel according to local laws and regulations and this installation manual.
An insufficient power supply capacity or improper electrical construction may lead to electric shocks or fire.
Be sure to earth the air conditioner.
Do not earth the unit to a utility pipe, lightning conductor or telephone earth lead.
Imperfect earthing may result in electric shocks or fire.
A high surge current from lightning or other sources may cause damage to the air conditioner.
Be sure to install an earth leakage breaker.
Failure to install an earth leakage breaker may result in electric shocks or fire.
Be sure to switch off the unit before touching any electrical parts.
Touching a live part may result in electric shock.
Make sure that all wiring is secured, the specified wires are used, and that there is no strain on the terminal
connections or wires.
Improper connections or securing of wires may result in abnormal heat build-up or fire.
When wiring the power supply and connecting the wiring between the indoor and outdoor units, position the
wires so that the control box lid can be securely fastened.
Improper positioning of the control box lid may result in electric shocks, fire or overheating terminals.
If refrigerant gas leaks during installation, ventilate the area immediately.
Toxic gas may be produced if the refrigerant comes into contact with fire.
After completing installation, check for refrigerant gas leakage.
Toxic gas may be produced if the refrigerant gas leaks into the room and comes into contact with a source
of fire, such as a fan heater, stove or cooker.
Do not touch any refrigerant that leaks out of refrigerant piping joints or connections.
Touching it may cause frostbite.

English

2
3P281953-1D

Installation of indoor / outdoor unit

179

Installation of outdoor unit

EDMT281512

s Do not stand on the outdoor unit or put things on it. This may result in an accident caused by falling or
dropping of items.
s Consult your local dealer regarding what to do in case of refrigerant leakage, when the air coditioner is to
be installed in a small room, it is necessary to take proper measures so that the amount of any leaked
refrigerant does not exceed the concentration limit in the event of leakage. Otherwise, this may lead to
an accident due to oxygen depletion.
s

s
s
s
s

s
s

CAUTION
While following the instructions in this installation manual, install drain piping to ensure proper drainage and
insulate piping to prevent condensation.
Improper drain piping may result in indoor water leakage and property damage.
Install the indoor and outdoor units, power cord and connecting wires at least 1 meter away from televisions
or radios to prevent picture interference and noise.
(Depending on the incoming signal strength, a distance of 1 meter may not be sufficient to eliminate noise.)
Install the indoor unit as far away from fluorescent lamps as possible.
Remote controller (wireless kit) transmitting distance can be shorter than expected in rooms with electronic
fluorescent lamps (inverter or rapid start types).
In a domestic environment this product may cause radio interference in which case the user may be
required to take adequate measures.
Do not allow children to climb on the outdoor unit and avoid placing objects on the unit.
Injury may result if the unit becomes loose and falls.
Make sure to provide for adequate measure in order to prevent that the outdoor unit be used as a
shelter by small animals.
Small animals making contact with electrical parts can cause malfunctions, smoke or fire. Please instruct
the customer to keep the area around the unit clean.
Install in a machine room that is free of moisture. The unit is designed for indoor use.
Disposal requirements
Dismantling of the unit, treatment of the refrigerant, of oil and of other parts must be done in
accordance with relevant local and national legislation.

s Do not install the air conditioner in the following locations:


1. Where there is a high concentration of mineral oil spray or vapour (e.g. a kitchen).
Plastic parts will deteriorate, parts may fall off and water leakage could result.
2. Where corrosive gas, such as sulphurous acid gas, is produced. Also areas that are rich in sodium such as seashores.
Corroding of copper pipes or soldered parts may result in refrigerant leakage.
3. Near machinery emitting electromagnetic radiation.
Electromagnetic radiation may disturb the operation of the control system and result in a malfunction of the unit.
4. Where flammable gas may leak, where there is carbon fibre or ignitable dust suspensions in the air, or
where volatile flammables such as paint thinner or gasoline are handled.
Operating the unit in such conditions may result in fire.
5. Where small animals may be housed, fallen leaves are accumulated, or weeds are overgrown.
If small animals touch the electrical parts inside, this may cause malfunction, smoke or fire.

SPECIAL NOTICE OF PRODUCT


s2EFRIGERANT
s4HEREFRIGERANT2!REQUIRESTHATSTRICT0RECAUTIONSBEOBSERVEDFORKEEPINGTHESYSTEMCLEAN
dry and tightly sealed.
A. Clean and Dry
Strict measure must be taken to keep impurities (including SUNISO oil and other mineral oils
as well as moisture) out of the system.
B. Tightly sealed
R410A contains no chlorine, does not destroy the ozone layer and so does not reduce the earths protceti
against harmful ultraviolet radiation. R410A will contribute only slightly to the greenhouse effect if release
into the almosphere
s3INCEDESIGNPRESSUREIS-0AORBARFOR2#UNITS-0AORBAR THETHICKNESSOFPIPES
must be greater than previously. Since R410A is a mixed refrigerant, the required additional refrigerant
must be charged in its liquid state. (If the system is charged with refrigerant in its gaseous state, due to
composition change, the system will not function normally). The indoor units is designed for R410A use.
See the catalogue for indoor unit models that can be connected. (Normal operation is not possible when
connecting units that are originally designed for other refrigerants)
3

English
3P281953-1D

180

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

2. BEFORE INSTALLATION
<Do not throw away accessories that are required for installation.>

2-1 READ THESE INSTRUCTIONS CAREFULLY BEFORE INSTALLATION


s See the indoor units installation manual for indoor unit installation.
s The illustration shows a 140-type. Other models also comply with this.

2-2 ACCESSORIES
Make sure that the accessories shown in Fig. 1 are all present.
(The accessories can be found behind the front panel.)

Name
Quantity

Installation
manual
1

Clamp

Drain socket

Drain cap

Drain receiver

Seal

2 pcs.

Shape

Fig. 1
Front panel

Accessories
Screw for front panel
Transporting the Unit
As shown in Fig. 3, bring the unit slowly. (Take care not to let hands or things come in contact with rear fins.)

Intake hole
Air outlet grille
Fig. 3
Corner
Handle

Outdoor unit
Fig. 2

Do not holding the suction inlet in the side of the


casing, otherwise the casing could be deformed.
(Place your hands on the corner in the case of
71 class model.)
Take care not to let hands or objects
come in contact with rear fins.
Work in a team of at least two people
when carrying the unit.
Only hold the unit at the specified
positions when carrying it using PP
bands or other items.

Installation Parts
Always use accessory parts or those of designated specification as parts required for installation.

English

4
3P281953-1D

Installation of indoor / outdoor unit

181

Installation of outdoor unit

EDMT281512

3. SELECTING INSTALLATION SITE


(1) Select an installation site where the following conditions are satisfied and that meets with your
customers approval.
s Places where there is no possibility of flammable gas leak.
s Places where the unit does not bother next-door neighbors.
s Safe places which can withstand the units weight and vibration and where the unit can be installed level.
s Places which are well-ventilated.
s Places where servicing space can be well ensured.
The minimum required space is shown in chapter 4. INSTALLATION SERVICING SPACE.
s Places where the indoor and outdoor units piping and wiring lengths come within the allowable ranges.
(Please refer to chapter 6. REFRIGERANT PIPING WORK.)
CAUTION
s Inverter air conditioners may cause noise
to occur in electrical appliances.
As shown in the right drawing, select an
installation site well away from radios, PCs,
and stereos.
s Especially in the areas where the incoming
signal strength is weak, keep the indoor
remote controller 3 m or more from electrical appliances. Put the power cord and
connecting wires in a metal pipe and
ground the metal pipe.

Branch switch,
over current
breaker

Indoor unit
Indoor
remote
controller

1 m or more
1 m or more

1.5 m or more
1.5 m or more

(2) When installing the unit in a place exposed to strong wind, pay special attention to the following.
5 m/sec or more strong wind blown against the outdoor units air outlet causes the outdoor unit to deteriorate in air capacity and suck in the air blown out of its air outlet (short circuit), and the following effects
may result.
s Drop in performance.
s Increased frost formation in heating mode.
s Shutting down due to increase in pressure.
If a very high fan strength is used continuously from the front of the outdoor unit outlet side, the fan might
turn in reverse at high speed, and become damaged.
s Turn the air outlet side toward the buildings wall, fence or windbreak screen.

Air inlet grille

Ensuring there is enough


space for installing the unit.

Fig. 4

s Set the outlet side at a right angle to the direction of the wind.

Strong wind

Strong wind
Blown air
Fig. 5
5

English
3P281953-1D

182

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

(3) The refrigerant (R410A) itself is a safe refrigerant that is non-poisonous and non-flammable. However, if the refrigerant leaks into a small room, and the refrigerant concentration in the room
exceeds the allowable safety limit, measures to deal with the refrigerant leakage are required. For
details, please refer to the technical materials.
(4) In installing the unit in a place frequently exposed to snow, pay special attention to the following:
In regions where buildups of snow can be expected, the air inlet and outlet as well as lower section of the
bottom plate may be blocked by the snow. Pay special attention to the following:
s Place the outdoor unit on a stand (field supply) so that it is not covered by snow falls, snow buildups, or
snow drifts. Ensure the bottom plate is at least 500 mm higher than expected snow levels.
s Install a roof cover for a snow fence or other enclosure (field supply).
s Remove the rear suction grille to prevent snow from accumulating on the rear fins.
s Avoid installing the unit in a location where blown snow will build up.
s Also take the following measures, as there is a danger the drainage discharged during defrosting operation may freeze.
s Install the outdoor unit at a sufficient height so that its bottom plate is above expected snow levels. This
is to prevent the buildup of ice on the underside of the bottom plate. (A space of at least 500 mm is recommended.)
s Do not use a centralized drain plug (option). (There is a danger of freezing when a drain plug or drain
pipe is used.)
s If there is a problem with dripping of drainage, take a measure such as positioning a roof cover (field supply) under the outdoor unit.

4. INSTALLATION SERVICING SPACE


s The installation service spaces shown in these drawings are based on an outdoor unit intake area temperature of 35C (DB) for COOL operation. If the planned intake area temperature exceeds 35C (DB), or if the
heat load of all outdoor units is increased significantly and exceeds the maximum operating capacity,
secure a larger space than that indicated by the intake dimensions in these drawings.
s For installation, consider both pedestrian and air flow paths and choose a suitable pattern from these drawings to match the space available onsite. (If the number of units to be installed exceeds the patterns in these
drawings, consider using short-circuits.)
s Regarding the front space, position the units with consideration to the space required for the onsite refrigerant piping work. (Consult your dealer if the work conditions do not match those in the drawings.)
s The values represent the case for the RZQ506071 type through RZQ140 type.
The dimensions in ( ) are for the RZQ100, RZQ125 and RZQ140 type.

4-1 INSTALLATION OF SINGLE UNIT (Units : mm)


When nothing is obstructing the top
1. In case obstacles exist only in front of the air inlet.

50 or more
(100)

2. In case obstacles exist in front of the air inlet and on both


sides of the unit.

100 or more
100 or more

100 or more

3. In case obstacles exist only in front of outlet side.

500 or more

English

6
3P281953-1D

Installation of indoor / outdoor unit

183

Installation of outdoor unit

EDMT281512

When something is obstructing the top


1. In case obstacles exist in front of the air inlet.
500 or less
1000 or more

100 or more

2. In case obstacles exist in front of the air inlet and on both


sides of the unit.

500 or less
1000 or more

150 or more
150 or more

150 or more

3. In case obstacles exist in front of outlet side.

500 or less

1000 or more

500 or more

In case obstacles exist in front of both the air inlet and outlet sides
Pattern 1 Where obstacle in front of the air outlet is higher than the unit.
1. When nothing is obstructing the top.
L>H
(There is no height limit for obstructions on the intake side.)
H

50 or more
(100)
500 or more

2. When something is obstructing the top.


Relation of dimensions of H, A, and L are shown in the table below.

LH
L>H

500 or less

L
A
0 < L 1/2H
750 or more
1/2H < L H
1000 or more
Set the frame to be L H
Refer to the column of L H for A

1000 or more

L
H

Get the lower part of the frame sealed so that air from the outlet does
not bypass.

150 or more
(250)

Pattern 2 Where obstacles in front of the air outlet is lower than the unit.
1. When nothing is obstructing the top.
LH
(There is no height limit for obstructions on the intake side.)
H
L
50 or more
(100)
500 or more

English
3P281953-1D

184

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

2. When something is obstructing the top.


Relation of dimensions of H, A, and L are shown in the table below.

LH
L>H

L
A
0 < L 1/2H
50 (100) or more
1/2H < L H
100 (200) or more
Set the frame to be L H
Refer to the column of L H for A

500
or less
1000 or more

H
L
A
500 or more
(1000)

Get the lower part of the frame sealed so that air from the outlet
does not bypass.

4-2 IN CASE OF INSTALLING MULTIPLE UNITS (2 UNITS OR MORE) IN LATERAL CONNECTION PER ROW (Units : mm)
s Secure appropriate space when using a side piping outlet.
When nothing is obstructing the top
1. In case obstacles exist in front of the air inlet and on both
sides of the unit.

100 or
more
100 or
more
1000 or more

200 or more
(300)

200 or more

2. When something is obstructing the outlet side.

100 or
more
100 or
more

1000 or more

When something is obstructing the top


1. In case obstacles exist in front of outlet side.
500 or less

100 or
more

100 or
more

1000 or more

1000 or more

2. In case obstacles exist in front of the air inlet and on both


sides of the unit.

500
or less

100 or
more

100 or
more

1000 or more

1000 or
more
200 or more

English

200 or more
(300)

8
3P281953-1D

Installation of indoor / outdoor unit

185

Installation of outdoor unit

EDMT281512

In case obstacles exist in front of both the air inlet and outlet sides
Pattern 1 Where obstacle in front of the air outlet is higher than the unit.
1. When nothing is obstructing the top.
(There is no height limit for obstructions on the intake side.)

100 or
more
100 or
more

L>H
L

200 or more
(300)
1000 or more

2. When something is obstructing the top.


Relation of dimensions of H, A, and L are shown in the table below.

LH
L>H

500 or less
100 or
more

L
A
0 < L 1/2H
1000 or more
1/2H < L H
1250 or more
Set the frame to be L H
Refer to the column of L H for A

1000 or more

L
H

Get the lower part of the frame sealed so that air from the outlet does
not bypass.

200 or more
(300)
A

Only two units at most can be installed in series.


Pattern 2 Where obstacles in front of the air outlet is lower than the unit.
1. When nothing is obstructing the top.
(There is no height limit for obstructions on the intake side.)
Relation of dimensions of H, A, and L are shown in the table below.
L
0 < L 1/2H
1/2H < L H

A
150 (250) or more
200 (300) or more

100 or
more

LH
L>H

Get the lower part of the frame sealed so that air from the outlet does
not bypass.

A
1000 or more
(1500)

2. When something is obstructing the top.


Relation of dimensions of H, A, and L are shown in the table below.
L
A
0 < L 1/2H
150 (250) or more
1/2H < L H
200 (300) or more
Set the frame to be L H
Refer to the column of L H for A

100 or
more

500
or less

100 or
more
1000 or more
H

A
1000 or more
(1500)

Only two units at most can be installed in series.


If the dimensions exceed the values in the brackets, the stand does not have to be installed even when H
is lower than L.

4-3 IN CASE OF STACKED INSTALLATION (Units : mm)


1. In case obstacles exist in front of the outlet side.

100 or
more

A
500 or more

1000 or more

English
3P281953-1D

186

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

2. In case obstacles exist in front of the air inlet.


100 or
more

A
500 or more
200 or more
(300)

s Do not exceed two levels for stacked installation.


s Install a roof cover similar to A (field supply), as outdoor units with downward drainage are prone to dripping
and freezing.
s Install the upper-level outdoor unit so that its bottom plate is a sufficient height above the roof cover. This
is to prevent the buildup of ice on the underside of the bottom plate. (A space of at least 500 mm is recommended.)
s It is not necessary to install a roof cover if there is no danger of drainage dripping and freezing. In this case,
the space between the upper and lower outdoor units should be at least 100 mm. (Close off the gap
between the upper and lower units so there is no reintake of discharged air.)

4-4 IN CASE OF MULTIPLE-ROW INSTALLATION (FOR ROOF TOP USE, ETC.) (Units : mm)
1. In case of installing one unit per row.

50 or more
(100)
1000 or more
(2000)
100 or more
(200)
500 or more
(1000)

2. In case of installing multiple units (2 units or more) in lateral


connection per row.
Relation of dimensions of H, A, and L are shown in the table
below.

LH
L>H

L
A
0 < L 1/2H
150 (250) or more
200 (300) or more
1/2H < L H
Installation impossible.

100 or more
100 or more
100 or
more
100 or
more

L
A

100 or
more 100 or
more H

2000 or more
(3000)
400 or more
(600)
1000 or more
(1500)

5. PRECAUTIONS ON INSTALLATION
Drain pipe disposal
s Potentially problematic locations for outdoor unit drainage
In locations where, for example, drainage may fall on passersby or frozen drainage may cause passersby
to slip over, install an enclosure (field supply) to prevent people approaching the outdoor unit.
s In regions where buildups of snow can be expected, the accumulation and freezing of snow in the space
between the heat exchanger and external plate may lower operating efficiency.
In this case, drill a knock hole in the lower part of the bottom frame so the snow can escape. When creating
a knock hole, use a 6 mm drill bit to open round holes around the circumference of the knock hole (4
places).

English

10
3P281953-1D

Installation of indoor / outdoor unit

187

Installation of outdoor unit

EDMT281512

Air outlet side


620
140

350
(345 355)

140

117

219

289

30

s After punching the knock hole, the application of repair-type paint on the surface around the edge sections
is recommended to prevent rust.

47
421
612

Drill
Area around knockout hole
Knockout hole

Drain hole

Diagram of lower surface (Units : mm)


Installation procedure of a central drain plug
1. Insert drain receiver (3) onto drain socket (1) and drain cap (2) beyond 4 projections around drain socket
and drain cap.

Drain socket (1)

Drain cap (2)

Projections

Projections

Drain receiver (3)


2. Insert drain socket and drain caps into their matching drain hole; Drain socket (1) into drain hole B and
drain caps (2) into drain hole C and D. After insertion, turn them about 40 clockwise.

Seal (4)
D

A
B
C

(Be sure not to insert them


into wrong drain holse, or
there causes water leakage.)
(View from bottom)

NOTE
s Please check whether drain receiver (3) is caught in four projections of drain socket (1) and drain cap (2)
correctly.
It will become the cause of the leak they are not attached correctly.

Projection
(4 places)

Projection
(4 places)

3. Connect vinyl hose on the market (internal diameter of 25mm) to drain socket (1).
(If the house is too long and hangs down, fix it carefully to prevent the kinks.)
4. Affix seal (4) to part A as shown on the above drawing.
5. Please check whether there is any leak from A - D each portion.

11

English
3P281953-1D

188

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

NOTE
s If the drain holes of the outdoor unit are covered with the mounting bracket or the floor, raise the unit to provide the space of more than 100 mm under the leg of the outdoor unit.

20

Installation method of outdoor unit


s Check the strength and level of the installation ground so that the unit will not cause any operating vibration
or noise after installation.
s In accordance with the foundation drawing in Fig. 6, fix the unit securely by means of the foundation bolts.
(Prepare four sets of M12 foundation bolts, nuts and washers each which are available on the market.)

Drawing of the foundation


Fig. 6
s It is best to screw in the foundation bolts until their length are 20 mm from the foundation surface.
s Fix the outdoor unit to the foundation bolts using nuts with resin washers.
Resin
(Refer to the right-hand drawing.)
washers
If the coating on the fastening area is stripped off, the nuts rust easily.
Installation method of fitting for prevention of overturning
s If steps need to be taken to prevent the unit from tipping over, use the tipping prevention clasps (option).

Tipping prevention clasps (option)


(Wiring system)

6. REFRIGERANT PIPING WORK


6-1 PRECAUTIONS ON REFRIGERANT PIPING
See the indoor units installation manual for details on the refrigerant piping for indoor units.
CAUTION
To plumbing persons
s Use R410A as additional refrigerant for charging.
s Do not use a flux when brazing the refrigerant pipe joints. Use phosphor copper brazing (BCuP) which does
not require flux.
(Using a chlorine flux may cause the pipes to corrode, and if it contains fluoride it may cause the refrigerant
lubricant to deteriorate, adversely affecting the refrigerant piping system.)
s After chapter 8. REFILLING THE REFRIGERANT is completed, be sure to open the stop valves before
performing 11. ON SITE SETTINGS.
(Operating the unit with the valve shut will break the compressor.)

English

12
3P281953-1D

Installation of indoor / outdoor unit

189

Installation of outdoor unit

EDMT281512

Precautions when re-using pre-existing refrigerant piping


s Abide by the following when re-using pre-existing refrigerant piping. Any problems with the piping may lead
to malfunctioning.
s In the following cases, do not re-use piping, but rather lay new piping.
If indoor or outdoor units have been disconnected from the piping for a long time (as water and foreign
matter might have entered the piping).
If copper piping is corroded.
s Flares should be redone and not re-used, in order to prevent refrigerant leaks.
s Do not reuse the flare nuts. Instead, use the flare nuts included with the product.
s Check for refrigerant leaks on welded areas if the pre-existing piping has been welded anywhere.
s Replace any deteriorated insulation with new insulation.

6-2 INSTALLATION TOOLS


Be sure to use the dedicated tools to ensure sufficient pressure resistance and prevent the entry of
any impurities.
Manifold gauge
Charging hose
Vacuum pump

To ensure sufficient pressure resistance and prevent the entry of any impurities (mineral
oils such as Suniso oil and liquids), use the R410A dedicated item (the screw specifications for R410A and R407C differ).
Be extremely careful not to flow the pump oil backward to inside the piping when the
pump is stopped.
Use a pump whose gauge pressure can vacuum up to 0.1 MPa (755 mmHg).

6-3 SELECTING PIPING MATERIALS


Use the piping whose inside and outside are clean and with no harmful substances for use such as sulphur,
oxide, dust, dust from cutting, grease, or liquid (contamination) is attached.
For the refrigerant piping, use the following material.
Material: Deoxidised phosphorous seamless copper pipe
Thickness and size: Decide based on section 6-5 REFRIGERANT PIPE SIZE AND ALLOWABLE PIPE
LENGTH.
For the handling of the stop valves, refer to Precautions when the handling piping stop valves in section
6-6 REFRIGERANT PIPING WORK.
Be sure to perform piping work using measurements within the maximum allowable length and height difference described in 6-5 REFRIGERANT PIPE SIZE AND ALLOWABLE PIPE LENGTH.

6-4 PIPING PROTECTION


Protect the piping and prevent liquid, dirt and dust from entering into the piping.
Pay special attention when running the copper pipe through the through-hole or when leading the edge of the
pipe outside the room.
Location
Outdoor
Location
Indoor

13

Work period
One month or more
Less than one month

Protection method
Pinching
Pinching or taping

Work period

Protection method
Pinching or taping

N/A

English
3P281953-1D

190

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

6-5 REFRIGERANT PIPE SIZE AND ALLOWABLE PIPE LENGTH


Piping bend radius
Piping diameter
9.5mm
15.9mm

Piping thickness
0.8mm
1.0mm

Bend radius
30mm or more
50mm or more

CAUTION
The maximum allowable pipe length differs depending on the model. Please refer to the table below.
(1) Refrigerant pipe size
(mm)
Outdoor unit capacity
50 60 71 100 125 140 type

Liquid pipe
9.5 t0.8

Gas pipe
15.9 t1.0

(2) Allowable pipe length


Outdoor unit capacity

Maximum allowable pipe length


(It is equivalent length in the inside)

Maximum allowable
height difference

50 60 71 type
100 125 140 type

50m (70m)
70m (90m)

30m
30m

s Equivalent length is the pressure loss due to L joints, traps, and so on along the refrigerant piping converted
to a straight piping length of the same size and added to the overall value.
s
s
s
s

CAUTION
Do not use pipe cutters and flare tools which have been used with refrigerant other than R410A.
When connecting the flares, coat the flare section with ether oil or ester oil.
Only use the flare nuts included with the unit. Using different flare nuts (one type) may cause the refrigerant
to leak.
In order to prevent dirt, liquid or dust from entering the piping, cure the piping with a pinch or taping.

6-6 REFRIGERANT PIPING WORK


s The local interunit piping is connectable in four directions. (Refer to Fig. 7)
s Do not let anything other than the designated refrigerant (such as air or water) enter the refrigerant system.
s When connecting in a downward direction, make four round holes using a 6-mm diameter drill in the central
section around the knock hole and open the knock hole. (Refer to Fig. 8)
s Cutting out the two slits makes it possible to install as shown in Fig. 9. (Use a metal saw to cut out the slits.)

Front panel

Dril

Pipe outlet panel


Backward
Screw for front panel
Forward
Sideways
Pipe outlet panel screw Downward
Fig. 7

English

Center area around


knock hole
Knock hole
Slit

Slit

Connecting pipe
Bottom frame

Fig. 8

Fig. 9

14
3P281953-1D

Installation of indoor / outdoor unit

191

Installation of outdoor unit

EDMT281512

* After knocking out the knock hole, it is recommended to apply repair paint to the edge and the surrounding
end surfaces to prevent rusting.

Side (lateral) connection


Remove the piping outlet
plate (front) for connection.

Back side (rear) connection


Remove the piping outlet plate
(rear) for connection.
Flare nut
Piping on gas side
(field supply)

Piping on the
liquid side
(field supply)
Piping outlet
plate (rear)

Knock hole

Piping on
gas side
(field supply)

Knock hole

Preventing foreign objects from entering


Plug the pipe through-holes with putty or insulating material (procured locally) to stop up all gaps, as shown in Fig. 10.
Insects or small animals entering the outdoor unit may cause a short
in the control box.

Flare nut
Piping on the
liquid side
(field supply)
Piping outlet
plate (front)
Putty or insulating
material
(Procured locally)

Fig. 10
Precautions when the handling piping stop valve
Do not open the stop valves until the 7. EVACUATING is finished.
s The names of the parts necessary for handling the pipe stop valves for the indoor and outdoor units are
described in Fig. 11. The valves are closed before shipment.

Servicing port
Valve bar
Valve lid

Fig. 11

Branch piping
connection

s Since the side boards may be deformed if only a torque wrench is used when loosening or tightening flare
nuts, always lock the shut-off valve with a wrench and then use a torque wrench.
When tightening the flare of the stop valve, do not exceed the rated torque. The rated torque is shown
on page 16.
Applying force by exceeding the rated tightening torque may cause the sheet surface inside the stop valve to
twist, the refrigerant to leak inside the valve, and the flare nut to break.

15

English
3P281953-1D

192

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

Do not apply force to the valve lid.


Using a wrench on the valve lid or body may cause refrigerant to leak.

2
Do not use wrenches
on the valve lid or body.
Spanner
Torque
wrench

s When using the low outdoor temperature heating mode, the pressure on the low pressure side might drop,
so the flare nut on the stop valve should be sealed completely with silicon sealant or the like in order to prevent frost from forming on it (both gas and liquid sides). (Refer to Fig. 12)

Silicon sealing pad


(Make sure that there is no gap)

Fig. 12

How to Operate the Stop Valve (Refer to Fig. 13)


Use hexagonal wrenches 4 mm and 6 mm.
To open:
1. Insert one hex wrench onto the valve rod and turn counter-clockwise.
2. Stop when the valve rod no longer turns. It is now open.
To close:
1. Insert one hex wrench onto the valve rod and turn clockwise.
2. Stop when the valve rod no longer turns. It is now closed.

Direction to open
Direction to open

Fig. 13

Liquid side

Gas side

Precautions for handling valve lid


s A seal is attached to the point indicated by the arrow. Take care not to damage it. (Refer to Fig. 14)
s Be sure to tighten the valve lid securely after operating the valves.
Tightening torque
Liquid side
13.5 16.5N m

English

Gas side
22.5 27.5N m

16
3P281953-1D

Installation of indoor / outdoor unit

193

Installation of outdoor unit

EDMT281512

Valve lid

Stop valve (lid attachment)

Fig. 14

Precautions for handling servicing port


s Use a push-rod-provided charging hose for operation.
s Be sure to tighten the valve lid securely after operation.
Tightening torque
11.5 13.9N m
Precautions for connecting pipes
s Avoid the connection pipes of indoor and outdoor units from getting in contact with the terminal of the compressor.
s If installing the outdoor unit higher than the indoor unit, caulk the space around insulation and tubes
because condensation on the check valve can seep through to the indoor unit side. Adjust the height of the
insulation material on liquid pipe when it has the possibility of getting in contact with the terminal. Also
make sure that the connecting piping does not touch the mounting bolt of the compressor.
(Refer to Fig. 15)
Precautions regarding insulation
Enhance the insulating material of the refrigerant piping according to the installation conditions. If this is not
done, condensation may form on the surface of the insulation material. Please refer to the target values
shown below.
s When the temperature and humidity conditions are 30C and RH 75% or more: thickness of the insulation material is 15 mm or more.
s When the temperature and humidity conditions are 30C and RH 80% or more: thickness of the insulation material is 20 mm or more.
s Always insulate the liquid and gas-side interunit piping as well as the refrigerant branch kit.
(Not insulating them may cause leaking.)
(The highest temperature that the gas-side piping can reach is around 120C, so be sure to use insulating
material which is very resistant.)
CAUTION
For local insulation, be sure to insulate all the way to the pipe connections inside the unit.
(Exposed piping may cause leaking or burns on contact.)

17

English
3P281953-1D

194

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

Inter unit piping for the


Indoor and outdoor units

2
Compressor

Perform treatment such as caulking


Insulation
(field supply)

Wind heat insulation material around


the piping section so it is not exposed
and then cover the insulation material
with vinyl tape.

Insulation
(field supply)
Fig. 15

Precautions when tightening flare nuts


s Be sure to remove the flare nuts using two spanners. Then after the piping connection, tighten them using
a spanner and torque wrench.
s Please refer to the Table 1 for the dimensions for processing flares.
s When connecting the flare nut, coat the flare inner surface with refrigerating machine oil and initially tighten
by hand 3 or 4 turns before tightening firmly.

Spanner
Flare nut
Connecting piping
connecting section

Torque
wrench

Union tube joint

Coat the flare inner


surface only with
ether oil or ester oil.

Flare nut

s Please refer to the Table 1 for the tightening torque. (Too much tightening will end up in splitting of the flare.)
s After all the piping has been connected, use nitrogen to perform a refrigerant leak check.
Table 1

12.8 13.2

15.9

61.8 75.4 Nm

19.3 19.7

English

32.7 39.9 Nm

45

9.5

Flare shape

R0.4-0.8

A dimensions for
processing flares (mm)

90 2

Tightening torque

Pipe size

18
3P281953-1D

Installation of indoor / outdoor unit

195

Installation of outdoor unit

EDMT281512

You must use a torque wrench but if you are obliged to install the unit without a torque wrench, you may
follow the installation method mentioned below.
When you keep on tightening the flare nut with a spanner, there is a point where the tightening torque
suddenly increases. From that position, further tighten the flare nut the angle shown below:
Pipe size
9.5
15.9

Further tightening angle


60 to 90 degrees
30 to 60 degrees

Recommended arm length of tool


Approx. 200mm
Approx. 300mm

Precautions when brazing piping


Be sure to perform a nitrogen blow when brazing.
(Brazing without carrying out nitrogen replacement or releasing nitrogen into the piping will create large quantities of oxidized film on the inside of the pipes, adversely affecting valves and compressors in the refrigerating
system and preventing normal operation.)
s See the Installation manual (available at Daikin dealers) for details on how to perform nitrogen replacement.
s When feeding nitrogen into the pipes while doing the brazing, the letdown valve should be set to 0.02MPa
(i.e. it should feel like a slight breeze if blown on your cheek).
CAUTION
Do not use anti-oxidants when brazing the pipe joints. (Residue can clog pipes and break equipment.)

Part to be brazed
Pressure-reducing valve
Nitrogen
Refrigerant piping
Taping

Hands valve

Nitrogen

7. EVACUATING
s Perform a refrigerant leak check using nitrogen gas (airtightness test) with the outdoor unit stop valves
close, to make sure there are no leaks.
For the airtightness test, raise the pressure to the design pressure in the high pressure section. (4.0 MPa)
s Do not forget to perform an air purge of the refrigerant system using a vacuum pump.

Outdoor unit
Stop valve

Pressure
gauge

Indoor unit

Nitrogen
(Refrigerant leak check)

Vacuum pump

NOTE
s After doing an air-purge with a vacuum pump, the refrigerant pressure may not rise even if the stop valve
is opened. This is because the refrigerant piping path is closed off by the outdoor unit electronic expansion
valve, etc.
There are no problems if the unit is run.

19

English
3P281953-1D

196

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

8. REFILLING THE REFRIGERANT


Be sure to use R410A as refrigerant.

8-1 PRECAUTIONS FOR ADDING REFRIGERANT


This unit does not require charging, however, so if the piping length is within the lengths shown in the table
below, no additional refrigerant needs to be charged.
The piping length of the refrigerant piping is determined based on the figure following.
Piping length

30m

50 60 71 100 125 140 type

In cases where the piping length exceeds that shown in the above table or recharging needs to be performed,
charge as described below.
Be sure to write down the additional amount of refrigerant charged or the entire amount re-charged on the
precaution plate on the rear of the front panel, as this information is needed in case of after-sales service.

8-2 ADDING REFRIGERANT


From the table below, select a refrigerant amount that is suitable for a piping length exceeding the length for
which charging is actually needed. Then add the refrigerant from the service port of the liquid side stop valve.
Select the amount of refrigerant to be added from the table below in accordance with the piping length, and add.
(kg)
Length of piping exceeding
the length for which additional charging is not
required
R410A 50 60 71 type
additional
100 125
amount
140 type

+10m or less

+20m or less

+30m or less

+40m or less

+0.50

+1.00

+0.50

+1.00

+1.50

+2.00

8-3 COMPLETE CHARGING OF THE REFRIGERANT (When recharging due to refrigerant


leaks, etc.)
Re-charge the amount of refrigerant selected from the table below.
(kg)
10m or
less
50 60 71 type 1.75

Piping length
R410A
complete
charging
amount

100 125
140 type

English

2.70

20m or
less
2.25

30m or
less
2.75

40m or
less
3.25

50m or
less
3.75

60m or
less
-

70m or
less
-

3.20

3.70

4.20

4.70

5.20

5.70

20
3P281953-1D

Installation of indoor / outdoor unit

197

Installation of outdoor unit

EDMT281512

When re-charging refrigerant, follow the procedure below.


1. Recover refrigerant until the gauge pressure from the refrigerant recovery port drops below 0.09 MPa
(gauge pressure : 0.011 MPa).
2. Perform vacuum drying from the same refrigerant recovery port using a vacuum pump.
3. Charge the refrigerant from the service port of the liquid-side stop valve when re-charging refrigerant.

RZQ100 125 140 type


RZQ50 60 71 type

Refrigerant
recovery port

Refrigerant
recovery port

8-4 PRECAUTIONS WHEN ADDING R410A


s Before filling, check whether the cylinder has a siphon attached or not. (It should have something like liquid
filling siphon attached displayed on it.)

Filling a cylinder with an attached siphon


Stand the cylinder upright
when filling.
(There is a siphon pipe inside,
so the cylinder need not be
upside-down to fill with liquid.)

Filling other cylinders


Stand the tank upsidedown and charge.
(Turn the cylinder upsidedown when filling.)

s To prevent entry of any impurities and insure sufficient pressure resistance, always use the special tools
dedicated for R410A.
s The refrigerant should be charged from the service port of the liquid-side stop valve.
CAUTION
To plumbing persons
s After completing installation, be sure to open the valves.
(Operating the unit with the valve shut will break the compressor.)
s Do not allow refrigerant to escape into the atmosphere recklessly for earth environment protection.

21

English
3P281953-1D

198

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

9. ELECTRICAL WIRING WORK


Attach the earth leakage breaker.
The earth leakage breaker is required in order to prevent electric shock and fires.

CAUTION
To the electrician
Install the earth leakage breaker which can handle harmonics.
(This unit has an inverter, so an interrupter capable of handling harmonics is needed to prevent malfunction
of the interrupter itself.)
Do not run the unit until the refrigerant charging is complete.
(Operating the unit before the completion will break the compressor.)
Do not remove the thermistors or sensors when the power cord and wiring between units are connected.
(Operating the unit with the thermistors and sensors removed will break the compressor.)
The electrical work must be performed using the dedicated circuit by the personnel with qualification
for electrical work, in accordance with the national law and installation manual.
s The wiring between the indoor unit and outdoor unit must be for 220V.
s The electrical wiring work should be done in accordance with the Electrical Wiring Diagram Label.
s When doing the electrical wiring, always shut off the power source before working, and do not turn on the
branch switch until all work is complete.
s By installing the earth leakage breaker, a protective earth resistance value of 500 ohms is applied.
s Do not let the earth wire should come in contact with gas pipes, water pipes, lighting rods, or telephone
earth wires.
Gas piping: there is a hazard of explosion and fire if refrigerant leaks.
Water piping: cannot be grounded if hardened plastic pipes are used.
Telephone earth and lightning rods: the earth potential when struck by lightning gets extremely high.
The earth is needed in order to reduce the noise generated by the units inverter and influence on other
appliances and to release the charge built up in the product box by leaked current.
s Never attach a phase advancing capacitor for improving the power factor. (Not only will this not improve the
power factor, but it might cause abnormal heat.)
s Be sure to use earth leakage breaker dedicated for earth leakage protection in combination with the load
break switch with fuse or breaker for wiring.
s For wiring, use the designated power wire and connect firmly, then secure to prevent outside pressure
being exerted on the terminal board (power supply wiring, transmission wiring, earth wiring).
s The power wiring should be connected in a positive phase.
s Left-over wiring should not be wrapped and stuffed into the unit.
s To prevent the power wiring from being damaged by the knock hole edges, put it in a wiring pipe or use insulated bush to protect it.
s To prevent the wiring from coming in contact with piping (particularly the high-pressure piping), secure it
with the included clamping material as shown next page.
s Arrange the electric wiring to avoid detachment of the front panel, and install the front panel correctly during
wiring.
s Make sure the wiring and the control box lid do not stick up above the structure, and close the cover firmly.

English

22
3P281953-1D

Installation of indoor / outdoor unit

199

Installation of outdoor unit

VLT Model

EDMT281512

Control box
(Terminal strip)

All connection terminals


should be insulated by,
for example, attached
insulating sleeves.

1 2 3 L N

Terminal plate

Earth wiring

Earth wiring

Transmission
wiring
Power supply
wiring

Earth wiring
between units

Stop valve
attachment plate

TLT Model

How to connect the power


supply wiring and transmission
wiring

Earth wiring
Power supply
wiring

Transmission
wiring

Clamp
(accessories)

Secure the power supply wiring and the transmission


wiring to the stop valve attachment plate using the clamping
material so that it does not move.
Control box
(Terminal strip)

All connection terminals


should be insulated by,
for example, attached
insulating sleeves.

How to connect the power


supply wiring and transmission
wiring
1 2 3 R(L) S T(N)

Terminal plate

Earth wiring

Earth wiring

Shield wiring

Earth wiring
between units

Earth wiring
Power supply
Shield wiring wiring
Transmission wiring

Transmission wiring
Power supply wiring
Stop valve
attachment plate

Insulation
vinyl tape
After unravelling the braided shield, braid it
again and attach it to the earth terminal.

Clamp
(accessories)

Secure the power supply wiring and the transmission wiring to the stop valve
attachment plate using the clamping material so that it does not move.
YLT Model

Ground

Control box
(Terminal strip)
1 2 3 L1 L2 L3 N

Attach
an insulation
sleeve

Earth wiring

Earth
wiring

Power supply
wire

Transmission wiring

Earth wiring
between units
Transmission
wiring

Earth wiring
Power supply
wiring

Fix to the stop valve fixing plate not to


move on the power supply wiring and
wiring between units.

Power supply wiring


Stop valve
attachment plate
Clamp material
(accessories)

To use the single core wire as


the earth wire during the conduit
operation, secure the electric wire
and earth wire using the clamps
as shown in the picture right.

Earth wiring
Power supply
wiring

Direction for pulling out the wiring

Clamp
(accessories)

Transmission
wiring

Backward

s Plug the pipe through-hole with putty or


insulating material (procured locally) so
as not to leave any gap and prevent
entry of small animals.

s Use the knock hole on the side and rear


for the conduit (composite) operation.

23

Forward

Sideways
Power supply and
earth wiring
English
3P281953-1D

200

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

Wiring of power supply and the units


Precautions when laying power wiring
s Use sleeve-insulated round crimp-style terminals for connections to the power terminal strip.
If these are not available, see the following section.
When connecting wiring which is the same diameter, do as shown in the figure below.
Wiring of different thicknesses cannot be connected to the power terminal strip.
Stranded wires should be finished with solder and not used.
(Slack in the power wiring may cause abnormal heat.)

Round crimp-style
terminal

Electric wire

Connect wires of
the same gauge
to both side.

Do not connect
wires of the same
gauge to one side.

Do not connect
wires of different
gauges.

Insulating sleeve

s For wiring, use the designated power wire and connect firmly, then secure using the included clamping
material to prevent outside pressure being exerted on the terminal board.
s Use an appropriate screwdriver for tightening the terminal screws.
A screwdriver of small size hurts its screw head, and cannot perform proper bolting.
s Over-tightening the terminal screw may break it.
See the table below for the tightening torque of the terminal screws.
Tightening torque (Nm)
M4 (Terminal strip)

1.2 1.8

M5 (Terminal strip)

2.0 3.0

M4 (Terminal plate)

1.4 1.9

M5 (Terminal plate)

2.4 2.9

Precautions when connecting the earth terminal


When pulling the earth wire out, wire it so that it comes through the cut-out section of the cup washer.
(An improper earth connection may prevent a good earth from being achieved.)

Round crimp-style
terminal

Cup washers

Cut-out section

English

24
3P281953-1D

Installation of indoor / outdoor unit

201

Installation of outdoor unit

EDMT281512

Connection information on power supply wiring, earth wiring, and transmission wiring
For the indoor unit wiring and transmission wiring (dash lines in the drawing), follow the instructions in the
indoor units installation manual.
Use 125 or 140 type shield cable for the transmission wiring, and be sure to earth the shield wire.

VLT

TLT

POWER SUPPLY
220V
60Hz

L
Branch switch,
overcurrent
breaker

N
Branch switch,
overcurrent
breaker

Earth leakage
breaker

YLT

POWER SUPPLY
220V
3
60Hz

POWER SUPPLY
380V
3N~
60Hz

L1 L2 L3

Earth leakage
breaker

Earth leakage
Branch switch, brea
breaker
overcurrent
breaker

L1 L2 L3 N

1 23

1 2 3RS T

1 2 3 LN

OUTDOOR UNIT

OUTDOOR UNIT

OUTDOOR UNIT

1 2 3

1 2 3
INDOOR UNIT

1 23
INDOOR UNIT

INDOOR UNIT

Remote Controller

Remote Controller

Remote Controller

Specification of standard wiring components


VLT

RZQ
50

60

Minimum circuit amps (MCA)

18.8

Recommended field fuse (A)

20

TLT

YLT

71 100 125 140 100 125 140 100 125 140


28.2

26.1
30

16.6

16.7
20

NOTES
1. Order appropriate power wire while following national laws and standards for the insulating sheath, thickness, and length.
2. When installing wiring in a location that can easily come in contact with people, be sure to install an earth
leakage breaker to prevent electric shock.
3. The earth leakage breaker must be a high-speed type breaker of 30mA(<0.1S).
4. Use an earth leakage breaker that can also be used as earth leakage, overload, short-circuit protection.
Be sure to use earth leakage breakers dedicated for earth leakage protection in combination with the load
break switch with fuse or breaker for wiring.
CAUTION
To the electrician
Do not run the unit until the refrigerant piping is complete, as not waiting could break the compressor.

25

English
3P281953-1D

202

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

10. ON SITE SETTING AND CHECK ITEMS BEFORE TEST RUN


10-1 CHECK ITEMS BEFORE THE TEST RUN
What to check

Check
column

Is all wiring laid as instructed?


Is all the wiring connected? Are there no missing or reversed phases?
Is the wiring between units all in the correct order between the units?
Power supply wiring
Transmission wiring
Earth wiring

Is the unit completely grounded?


Are the screws on the wiring attachments all thoroughly in screwed in?
Has the insulation resistance tested to at least 1 M?
s Use a 500V mega-tester for measuring insulation.
s Note: Do not use the mega-tester for currents other than 220V.
Is the piping size correct?

Refrigerant piping

Is the piping insulation applied correctly?


Is the liquid and gas-side piping all insulated?
Are the stop valves for both the liquid and gas sides open completely?
Operating the unit with the valves shut will break the compressor.

Amount of refrigerant

Did you fill in the additional charging and recharging rate, and piping
length on the caution label attached to the rear side of the front panel?

Indoor unit

Is the indoor unit fully installed?


s When the test run is started, the fan automatically begins turning.
If a decoration panel is not attached, make sure that no work is being
done on the indoor unit.
s If you are using the wireless remote controller, do the test run after
attaching the decoration panel to the indoor unit.

English

26
3P281953-1D

Installation of indoor / outdoor unit

203

Installation of outdoor unit

EDMT281512

11. ON SITE SETTINGS


WARNING
Always close the front panel when leaving the outdoor unit with the power on.
The functions of the outdoor unit can be set using the remote controller.
During installation, make the on-site settings according to the description below, after the service inspection
and repair.
Mistakes in the settings could cause malfunctions.
How to make the on-site settings
Make the on-site settings according to How to make the on-site settings which came with the remote controller.
s The settings are set by switching between Mode No., FIRST CODE NO., and SECOND CODE NO..

[Mode switching]
Once

Normal operating mode

ce
On

Once

ce
On

Once
(Press
4 seconds
or more)

*
*
Malfunction code
display
Once

On-site setting

Test run

* After leaving 10 seconds or


more, the mode returns to
the normal operating mode.

Indoor unit type


code display

Once

Outdoor unit type


code display

Measures

Content of settings and setting number


:Factory settings
Mode
No.

FIRST
CODE NO.
0

16 (26)
1

03
Performance
Priority Setting
10 pm - 6 am

Content of settings
Select from Low Night Noise Setting, Performance
Priority Setting.
You can set starting time, and ending time for
the Low Night Noise Setting.
SECOND CODE NO.
04
Low Night Noise
Setting
+
Performance Priority
Setting
10 pm - 8 am

SECOND CODE NO.


01
02
Low Night Noise

Setting

05

8 pm - 8 am

See the technical guide for details on the content of the settings.
NOTES
1. Settings are done in a batch for the group. For this reason, when performing group control* using the
remote controller from one unit to set individual outdoor units, set each unit separately (for each connected
indoor unit NO.) using the mode number in parentheses. Checking after changing settings can also only be
done using the mode numbers in parentheses. (For group batch control, the display will always read 01
even though the settings have been changed.) Furthermore, when performing control with two remote controllers*, on-site settings using a remote controller can only be done using the main remote controller.
* For details on controlling the units using the remote controllers, see applicable technical guides.
2. Do not set any values not shown in the table above.
3. When returning to normal mode, the remote controller may display 88 because it has been initialized.

27

English
3P281953-1D

204

Installation of indoor / outdoor unit

EDMT281512

Installation of outdoor unit

CAUTION
Low Night Noise operation and demand operation using an external command requires a demand adapter PC
board (option). For more details, refer to the manual supplied with the adapter.

2
12. TEST RUNS
WARNING
s Never perform a test run with the discharge piping thermistor (R2T) and suction piping thermistor (R3T)
removed, as this might break the compressor.
s If the technician must leave the outdoor unit for some reason, switch places with another installation technician or close the front panel.
s Do not touch the drain pump or fan during test runs without the decoration panel installed on the indoor unit.
(Doing so could result in an electric shock or other injury.)

12-1 HOW TO TEST OPERATION


After the indoor and outdoor unit installation, be sure to perform the test operation in accordance with the following procedure.
1. Open the front panel and check that the liquid and gas sides of the stop valves are open.
<Be sure to close the front panel before the operation (Risk of electric shock)>
Note: After doing an air-purge with a vacuum pump, the refrigerant pressure may not rise even if the stop
valves are opened.
This is because the refrigerant piping path is closed off by the outdoor unit electronic expansion
valve, etc. There are no problems if the unit is run.

Direction to open
Direction to open

Liquid side

Gas side

Remove the valve lid and turn the valve rod


counterclockwise with a hex wrench until is stops.
2. Turn the power on at least 6 hours before operating the unit to protect the compressor.
3. Set to cooling operation with the remote controller.
4. Push the remote controllers INSPECTION/TEST OPERATION button four times (twice on the wireless
remote controller) to enter test run mode.
Within 10 seconds, press the RUN/STOP button to start the test run. Check the unit, letting it run at least
3 minutes.
Note: In the first operation after installation, the COOL operation is performed for approx. 3 minutes even
when the HEAT operation is set. After that, the operation will be switched to the HEAT operation, but
this is normal. (The remote controller displays HEAT operation.)
Note: When the outside temperature is 24C or more, the HEAT operation is not performed even if it is set,
but this is normal.
5. Push INSPECTION/TEST OPERATION button and operate normally.
6. Confirm function of unit according to the operation manual.
7. If the decoration panel on the indoor unit has not been installed, turn off the power after the test run.

English

28
3P281953-1D

Installation of indoor / outdoor unit

205

Installation of outdoor unit

3.5

Equivalent piping length of joints (reference)


Pipe Size
L Joints

206

EDMT281512

(mm)

6.4

9.5

12.7

15.9

19.1

22.2

25.4

31.8

38.1

0.16

0.18

0.20

0.25

0.35

0.40

0.45

0.55

0.65

(m)

Installation of indoor / outdoor unit

Ask a qualified installer or contractor to install this product. Do not try to install the product yourself.
Improper installation can result in water or refrigerant leakage, electrical shock, fire or explosion.
Use only those parts and accessories supplied or specified by Daikin. Ask a qualified installer or
contractor to install those parts and accessories. Use of unauthorised parts and accessories or
improper installation of parts and accessories can result in water or refrigerant leakage, electrical
shock, fire or explosion.
Read the user's manual carefully before using this product. The user's manual provides important
safety instructions and warnings. Be sure to follow these instructions and warnings.
If you have any enquiries, please contact your local importer, distributor and/or retailer.

Cautions on product corrosion


1. Air conditioners should not be installed in areas where corrosive gases, such as acid gas or alkaline gas, are produced.
2. If the outdoor unit is to be installed close to the sea shore, direct exposure to the sea breeze should be avoided. If you need to install
the outdoor unit close to the sea shore, contact your local distributor.

Specifications, designs and other content appearing in this brochure are current as of August 2015 but subject to change without notice.
c All rights reserved 08/15 FS