Вы находитесь на странице: 1из 70

MARCH 2013

VI SI ON AND AUTOMATI ON SOLUTI ONS


FOR ENGINEERS AND INTEGRATORS WORLDWIDE
Vision
Systems
D E S I G N
Vision
Systems

www. vi si on- syst ems. com


q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
____________
MARCH 2013
VI SI ON AND AUTOMATI ON SOLUTI ONS
FOR ENGINEERS AND INTEGRATORS WORLDWIDE
Vision
Systems
D E S I G N
Vision
Systems

www. vi si on- syst ems. com


Contents | Zoom in | Zoom out Search Issue | Next Page For navigation instructions please click here
Contents | Zoom in | Zoom out Search Issue | Next Page For navigation instructions please click here
___________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
_______________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 1
March 2013
VOL.!8
[
NO.3
A P L N N WL L L P U 8 L l C AT l O N
VisionSystems
D E S I G N

Vision and Automation Solutions for


Engineers and Integrators Worldwide
The annual Vision Systems Design Buyers
Guide is a resource for worldwide machine-
vision and image-processing information.
5 Products
5 AncillaryDevices
7 Applicalion-SpecilcSollware
8 AulomalionLquipmenl
8 Cameras
20 Digilizers
20 Displays
20 llluminalionSyslems/Lighling
23 lmage-ProcessingSyslems
26 lmage-ProcessingToolkils
26 lmage-SlorageDevices
26 lnlegraledCircuils
26 Lenses
28 Oll-lhe-ShellSollware
30 OplicalSubsyslems
30 Oplics
33 PosilioningLquipmenl
33 Scanners
33 SecurilySyslems
33 Sensors
34 Syslem8oards
36 Tesl&Measuremenl
Lquipmenl
38 ProduclShowcase
40 System Integrators by Location
41 Manufacturers Reps by Location
43 Company Directory
63 Product Index
3 My View Dynamic information
4 Online at vision-systems.com
64 Ad Index/Sales Offces
col umns
2013 Vision Systems Design Buyer s Gui de
I n thi s i ssue
More Buyers Guide
on vision-systems.com
See expanded vendor information with
listings of available products
Zero in on a camera provider in the
Camera Directory
Find an integrator to help customize a
system for your application
______________
REVOLUTIONARY
PERFORMANCE
FOR THE PRICE
LOW POWER
MINIMUM HEAT
HIGH IMAGE QUALITY
2K, 4K, 6K, 8K, 12K OPTIONS
GIGE AND CAMERA
LINK INTERFACES
ONLY THE RACER PACKS SO MUCH PERFORMANCE INTO SO LITTLE SPACE.
Baslers newest series of line scan cameras shrinks both the space required and the
cost involved in securing superior speed, reliability and image quality. Measuring
a slim 56mm, its a perfect t for most any systemincluding multi-camera
arrangements. It also ts your budget, with its pared down price and by delivering
exceptional performance under low voltage LED lighting.
Sometimes its the smallest things that have the biggest impact.
Learn more about the racer at baslerweb.com.
read more
STANDS OUT.
FITS IN.
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
___________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 3
Susan Smith.Publisher
Tel..(603)89!-9447,e-mail.susans@pennwell.com
Andrew Wilson:LdilorinChiel
Tel..(603)89!-9!!5,e-mail.andyw@pennwell.com
Dave Wilson:SeniorLdilor
Tel..+44-(0)-!234-35740!
e-mail.dwilson@pennwell.com
Carrie Meadows:ManagingLdilor
Tel..(603)89!-9382,e-mail.carriem@pennwell.com
Joni Montemagno:MarkelingManager
Suzanne Heiser:ArlDireclor
Mari Rodriguez:ProduclionDireclor
Dan Rodd:Seniorllluslralor
Debbie Bouley:AudienceDevelopmenlManager
Marcella Hanson:AdServicesManager
BUYERS GUIDE STAFF:
Sue McAdam: Director, 8uyersCuide
Jessica Ross: 8uyersCuideOperalionsManager
Lisa Hollis: Produclion/DalabaseSpecialisl
Tammy Croft: DalabaseProduclionSupervisor
Sandy Taylor: CuslomerServiceSpecialisl
Linda Smith-Quinn: CuslomerServiceSpecialisl
Christine Algie:CuslomerServiceSpecialisl
EDITORIAL OFFICES:
PennWell
VisionSyslemsDesign
98Spil8rookPoad,LL-!,Nashua,NH03062-5737
Tel.(603)89!-0!23,lAX.(603)89!-9328
www.vision-syslems.com
CORPORATE OFFICERS:
Frank T. Lauinger:Chairman
Robert F. Biolchini:PresidenlandCLO
Mark Wilmoth:ChiellinancialOllcer
TECHNOLOGY GROUP:
Christine A. Shaw: SeniorVicePresidenl/
CroupPublishingDireclor
lorsubscriplioninquiries.Tel..(847)559-7520,
lax.(847)29!-48!6,e-mail.vsd@omeda.com,
web.www.vsd-subscribe.com
Wemakeporlionsoloursubscriberlislavailable
locarelullyscreenedcompanieslhalollerproducls
andserviceslhalmaybeimporlanlloryourwork.
llyoudonolwanlloreceivelhoseollersand/or
inlormalion,pleaselelusknowbyconlacling
usalLislServices/VisionSyslemsDesign,
98Spil8rookPoad,LL-!,Nashua,NH03062-5737.
Vision Systems Design,Vol.!8,No.3,
Copyrighl20!3(lSSN-!089-3709)ispublished
!!limesayear,January,lebruary,March,April,May,June,
July/Augusl,Seplember,Oclober,NovemberandDecember,by
PennWellCorp.,!42!S.Sheridan,TulsaOK74!!2.Periodicals
poslagepaidalTulsa,OK74!!2andaddilionalmailingollces.
Subscription rates: USA.!yr.$!20,2yr.$!80,3yr.$234,
singlecopy$!5,8uyersCuide$30,Canada.!yr.$!38,2yr.
$207,3yr.$270,singlecopy$25,8uyersCuide$35,
elsewherevialnllAir.!yr.$!50,2yr.$225,3yr.$295,
8uyersCuide$40.Digilaledilion$66yr.,singledigilalcopy$5.
Subscription inquiries:
(847)559-75207.30AM6PMCST.
Postmaster:
SendchangeoladdresslormloVisionSyslemsDesign,
PO8ox3425,Norlhbrook,lL,USA60065-3425.
PelurnundeliverableCanadianaddressesloPO8ox!22,
Niagaralalls,ON,CanadaL2L6S4.
PPlNTLDlNTHLUSA
CSTNO.!268!3!53
PublicalionsMailAgreemenlNo.!42!727
Andy Wilson,LDlTOPlNCHlLl
ANDYW@PLNNWLLL.COM
view
my
Developing machine-vision and image-processing systems requires expert
knowledge of disciplines such as physics, optics, computer science, and mechan-
ical engineering. In many companies, this expert knowledge is shared by the
team tasked with developing the machine-vision system. To build such systems,
these engineers must keep abreast of the latest technologies, standards, and
products available from hundreds of companies located worldwide.
Even with numerous trade shows and conferences now dedicated to machine vision and image
processing, coordinating this information is not an easy task. Thats why, the staff of Vision Sys-
tems Design magazine is proud to bring you our annual Buyers Guide issue. The result of many
months of effort by our Buyers Guide department, this issue contains the most up-to-date infor-
mation on more than 700 global suppliers of machine-vision and image-processing equipment.
Companies are listed in more than 50 product categories, including solid-state cameras, optics,
lighting, add-in boards, automation equipment, and software. Readers who prefer to search online
can fnd the complete Buyers Guide at http://buyersguide.vision-systems.com/search/index.html,
where you can search by category, company, or keyword. You will fnd all the data published in our
print version as well as additional information about vendors, distributors, and system integrators.
This Buyers Guide contains four sections: a Product Guide, a System Integrators listing, a
Manufacturers Reps listing, and a Company Directory. The table of contents provides an over-
view of these sections; the Product Index on page 63 contains a detailed list of product categories.
While the print issue of our Buyers Guide provides a snapshot of the machine-vision and
image-processing industry, our online Guide is dynamic, allowing manufacturers to manage
their information in real time. This provides you, our readers, with a continuously updated
reference to the numerous companies involved in machine vision and image processing.
On our web site, you will fnd additional resources to help you in the task of choosing the
technologies, products, and manufacturers for your next project. Our online Industrial Camera
Directory, for example, lists more than 200 camera vendors, their products, and key camera
specifcations. Our updated Machine Vision News & Technology and New Machine Vision
Products, tutorial-based webcasts, white papers, and editorial digests provide an unmatched
knowledge base for both experienced system developers and newcomers to the feld.
Developing machine-vision and image-processing systems requires an interdisciplinary
engineering approach; we hope that the resources you will fnd in this Buyers Guide and on
our web site will help in bridging these disciplines. Should you have any suggestions of how
we may continue to improve our magazine, web site, and newsletters, we would like to hear
from you. I hope you fnd this issue useful and look forward to your continued loyalty as a
reader of Vision Systems Design.
Dynamicinlormalion
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
TRY OUT OUR
MACHINE VISION CONFIGURATOR
www.machine-vision-assemblies.com
www.alysium.com
Kinect system tracks defects on cars
Pesearchersallhelraunholerlnslilulelor
Oplronics,SyslemTechnologiesandlmage
Lxploilalionhavebuillaninlelligenlgeslure
deleclionsyslemusinglwoMicrosollKinecl
camerasandaPConbehallollhe8MW
Crouplolracklheposlureolanindividualas
wellaslhebodyolacaronaproduclionline.
http://bit.ly/15vtCbh
Rover goes rock hunting on Mars
NASAsMarsScienceLaboraloryprojeclisusing
lheCuriosilyroverloinvesligaleanareawilhin
CaleCraler,andhasusedlhecameraonilsarm
lolakenighllimepholosolarockonlhesurlace
olMars. http://bit.ly/WR2Q8H
Imaging sensors paint a picture
of hurricane damage
Usingacombinalionolimageslromsalellilesand
remoleconlrolledaircrallandcamerasequipped
wilhinlraredandullraviolelsensors,researchers
alDrexelUniversilyarehopinglopainladelailed
piclureolHurricaneSandyspalholdeslruclion
lhalcouldhelpemergencyworkersrespondlo
lhenexlnaluraldisasler. http://bit.ly/ZrSEHU
CT scanner reconstructs Richard IIIs likeness
Alacialreconslruclioncommissionedbylhe
PichardlllSocielyhasbeenmadelromlhe
humanremainsolLnglandsKingPichardlllby
aleamlromDundeeUniversily.Todigilallysculpl
lhelaciallealures,prolessorCarolineWilkinsons
leamusedCTscansollhemonarchsskulland
Ceomagiclreelormsollware.
http://bit.ly/11VvF9q
Live tissue imaged in three tiny dimensions
LPlLresearchersYannColleandlalihToy
designedanimage-processingsyslemlo
observelivingbiologicallissuesallhenanoscale,
oblaining3-Dimagesollivingcellsinjuslalew
minulesalaresolulionollesslhan!00nm.
http://bit.ly/13gVXOu
onl i ne @
www.vision-systems.com
_____________________________________
F O R E V E R Y C A ME R A
Available for both:
Digital & Analog
Configurations
Components Express, Inc. 10330 Argonne Woods Drive Suite 100 Woodridge, IL 60517-4995
630.257.0605 800.578.6695
www.componentsexpress.com
C
A M
E
R
A
L
I
N
K
F I
R
E
W
I
R
E
CAMERA
LINK
FIREWIRE
B
I
T
M
A
X
X
I
N
T
E
R N
A
L
C
A
M
E
R
A
L I
N
K
M
1
2
BITMAXX
EXTENDED DISTANCE
CAMERA LINK &
FIREWIRE B CABLES
INTERNAL
CAMERA LINK
CABLES
M12
INDUSTRIAL
G
i
g
E
GIGABIT
ETHERNET
CABLES
C
o
a X
P
R
E
S
S
C
A
B
L
E
S
CoaXPress
CABLES
Ancillary Devices
Cables and Connectors
Alysium-Tech GmbH
(see ad p 4)
Amphenol Industrial Operations
Aries Electronics Inc
Components Express Inc
(see ad p 5)
EDT
(see ad p 6)
FiberTech Optica
Fujikura Ltd
Icron Technologies Corp
Intercon 1
(see ad p 4)
Phoenix Contact
Phrontier Technologies LLC
(see ad p 39)
Resolution Technology Inc
40 System Integrators
by Location
41 Manufacturers Reps
by Location
43 Company Directory
63 Product Index
2013
Buyers Guide
Products
H
S
L I
N
K
C
A
B
L
E
S
HSLink
CABLES
Environments/Applications:
Harsh, Static, Highly Flexible,
Industrial, Robotics, Security, Medical
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Two boards in one.
Framegrabber Simulator
PCIe x8 PCIe x8
See how
it works
Cliff Hayes
info@edt.com
503-690-1234
www.edt.com/vision
FEATURES
2NP (84Ofps, 4NP (18Ofps, 12NP (87.5fps, Color, Nono, hlR
SFP+ interface. foer direct options for canera to PC
Fioer 0ptions to 8OOn (SR and to 1Okn+ (lR
Software solution providing <87 CPU overhead for windows and linux
Built-in inage processing
CN0SlS sensors for CCD-like perfornance
eCapture Viewer and eSDK availaole
Introducing the HS-2000, HS-4000, and HS-12000
The industrys FIRST 10 GIGE Cameras from Emergent Vision Technologies
deliver exceptional performance that is very cost-efective
ULTRA FAST
ULTRA FLEXIBLE
ULTRA SMART
Website: www.emergentvisiontec.com
Email : info@emergentvisiontec.com
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 6
P
r
o
d
u
c
t
s
Ancillary Devices: Camera and Lighting Enclosures
Sensoray Co Inc
(see ad p 35)
Technical Cable Concepts Inc
Thinklogical
Unibrain Inc
(see ad p 39)
Vivid Engineering
(see ad p 39)
Camera and Lighting
Enclosures
Allison Park Group Inc
(see ad p 38)
autoVimation
Components Express Inc
(see ad p 5)
Tecscan Electronics Ltd
Tectivity Inc
Camera and Lighting Mounts
Allison Park Group Inc
(see ad p 38)
Alysium-Tech GmbH
(see ad p 4)
autoVimation
Opto GmbH
(see ad p 24)
Polytec GmbH
Camera Desiccants and
Moldings
Multisorb Technologies Inc
Camera Extenders and
Repeaters
Alysium-Tech GmbH
(see ad p 4)
EDT
(see ad p 6)
Intercon 1
(see ad p 4)
Phrontier Technologies LLC
(see ad p 39)
Vivid Engineering
(see ad p 39)
Enclosures
Allison Park Group Inc
(see ad p 38)
Curtiss-Wright Controls Defense Solutions
LCR Electronics
Power Supplies
Alysium-Tech GmbH
(see ad p 4)
Components Express Inc
(see ad p 5)
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
www.microscan.com
info@microscan.com | 1.425.226.5700 | 800.762.1149
SIMPLE JUST GOT SMARTER.

VERIFICATION OF PRINTED TEXT (OCV)

EASY CONNECTIVITY WITH MICROSCAN LINK

MULTI JOB SUPPORT


Microscan makes it simple to incorporate automated
inspection and identification into production lines with
minimal time, effort, and training. With our award-
winning AutoVISION suite of machine vision software
and smart cameras, users can simplify the set-up and
deployment of machine vision applications.
SCAN QR CODE or visit
info.microscan.com/autovision
for more information
THE NEXT GENERATION OF AUTOVISION
MACHINE VISION SOFTWARE IS NOW AVAILABLE!
P
r
o
d
u
c
t
s
Application-Specific Software: Semiconductor-Inspection Software
EnerSys
Gardasoft Vision Ltd
Intercon 1
(see ad p 4)
Phoenix Contact
Phrontier Technologies LLC
(see ad p 39)
Voltage Multipliers Inc
Wavelength Electronics Inc
Application-Specific
Software
Industrial-Inspection
Software
3DM Devices Inc
AICOM
Alacron Inc
Alliance Vision
Alta Vision Systems LLC
AQSENSE SL
AT - Automation Technology GmbH
Coleman Technologies Inc
Compar AG Vision Systems & Robotics
Controlled Capture Systems LLC
e-con Systems India Pvt Ltd
EVT - Eye Vision Technology GmbH
FiberVision GmbH
GOEPEL Electronics LLC
Hamey Vision Systems Pty Ltd
HiTech Control Systems Inc
Industrial Vision Systems Ltd
INFAIMON SL
INFAIMON do Brasil
INFAIMON Mxico SA de CV
InfraTec GmbH
JasVisio
Label Vision Systems Inc
Lambda Photometrics Ltd
Lucid Imaging Pvt Ltd
Microscan Systems Inc
(see ad p 7)
MVTec Software GmbH
OptoNova AB
QualiVision AG
Seidenader Maschinenbau GmbH
Soliton Technologies Pvt Ltd
Tattile Srl
Tecscan Electronics Ltd
Tordivel AS
TST Technological Solutions
Universal Robotics Inc
The Value Engineering Alliance
Vision Components
Vision Machines Inc
VISIONx Inc
Medical-Imaging Software
Diffraction Ltd
EVT - Eye Vision Technology GmbH
Inviso BV
Lambda Research Corp
MVTec Software GmbH
Performance Automation Inc
Scientific-Analysis Software
Analysis of Motion
Coleman Technologies Inc
Diffraction Ltd
InfraTec GmbH
Lambda Research Corp
MVTec Software GmbH
National Instruments
Olympus Industrial
PixeLINK
Xcitex Inc
Semiconductor-Inspection
Software
EVT - Eye Vision Technology GmbH
Inviso BV
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 8
P
r
o
d
u
c
t
s
Automation Equipment: Measurement and Automation Software
Microscan Systems Inc
(see ad p 7)
MVTec Software GmbH
TST Technological Solutions
Automation Equipment
Measurement and
Automation Software
Automated Vision LLC
Bluewrist Inc
Coleman Technologies Inc
Computed Vision Solutions
Dark Field Technologies Inc
DIAS Infrared GmbH
Image Labs International
InfraTec GmbH
International Electronic Machines Corp
JasVisio
Kasalis Inc
METTLER TOLEDO CI-Vision
Ocean Thin Films
Opto System Co Ltd
Performance Automation Inc
Phoenix Contact
Dr Heinrich Schneider Messtechnik GmbH
Seidenader Maschinenbau GmbH
Tecscan Electronics Ltd
Tordivel AS
VISIONx Inc
Yaskawa Motoman Robotics
Zmation Inc
Motion-Control Boards/
Systems
Festo AG & Co KG
LCR Electronics
Mega-Fabs Motion Systems Ltd
Performance Automation Inc
PLCs/PACs
Festo AG & Co KG
H&L Instruments LLC
Phoenix Contact
Robots
ABB Inc
Altair Industries Inc
Bluewrist Inc
DENSO Robotics
HiTech Control Systems Inc
PaR Systems Inc
Recognition Robotics
Saber1 Technologies LLC
Yaskawa Motoman Robotics
Cameras
3-D Cameras
3D3 Solutions
Adept Turnkey
AT - Automation Technology GmbH
Chromasens GmbH
Compar AG Vision Systems & Robotics
EVT - Eye Vision Technology GmbH
GFMesstechnik GmbH
LMI Technologies Inc
(see ad p 9)
Math & Tech Engineering GmbH
Munro Design & Technologies LLC
Numetrix Technologies
Ocean Thin Films
odos imaging Ltd
Pembroke Instruments LLC
Vision Components GmbH
VISIONx Inc
VRmagic GmbH
XIMEA
(see ad p 13)
Area-Array Cameras
Adimec Advanced Image Systems BV
Basler AG
(see ad p 2)
Bock Optronics Inc
CIS Corp
EHD Imaging GmbH
Emergent Vision Technologies Inc
(see ad p 6)
FJW Optical Systems Inc
Hitachi Kokusai Electric Europe GmbH
illunis LLC
Image Teck
Imaging Solutions Group
IMPERX
IO Industries Inc
JAI Inc
(see ad p 19)
JENOPTIK Defense & Civil Systems
Lucid Imaging Pvt Ltd
MATRIX VISION GmbH
(see ad p 31)
Microscan Systems Inc
(see ad p 7)
Mikrotron GmbH
Mosaic Engineering Inc
moviMED
msiVision
Ocean Thin Films
odos imaging Ltd
Photonic Science and Defence Vision Systems
PixeLINK
Princeton Lightwave Inc
RAUSCHER GmbH
STEMMER IMAGING
(see ad p 17)
Teledyne DALSA
(see ad p 39, inside back cover)
Thermo Scientific - CIDTEC
Video Scope International Ltd
Vieworks Co Ltd
(see ad inside front cover)
Webview Inc
XIMEA
(see ad p 13)
Camera Link Cameras
1stVision Inc
(see ad p 25, 38)
_____________
_________
Gocator is the most cost effective 3D solution in the
industry. Gocator delivers 3D scanning, measurement, and
control in a single package with an ease of use suitable for
everyone. Mount it, plug it in, set it up with your web browser
and get results out of the box.
Discover what Gocator can do for you at www.lmi3D.com/vsd
SIMPLE. SMART. COMPLETE. ITS 3D FOR EVERYONE.
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 10
P
r
o
d
u
c
t
s
Cameras: CCD CamerasColor
Adimec Advanced Image Systems BV
Alliance Vision
Allied Vision Technologies GmbH
(see ad back cover)
Aphesa
Basler AG
(see ad p 2)
Baumer Optronic GmbH
CIS Corp
DRS Technologies Inc
e2v
EHD Imaging GmbH
FastVision LLC
Hitachi Kokusai Electric America Ltd
Hitachi Kokusai Electric Europe GmbH
illunis LLC
IMI Technology Co Ltd
IMPERX
IVS Imaging
JAI A/S
Kappa optronics France
Kappa optronics GmbH
Kappa optronics Inc
Mikrotron GmbH
MultiPix Imaging Ltd
Nuvu Cameras Inc
Phase 1 Technology Corp
Phrontier Technologies LLC
(see ad p 39)
Point Grey
(see ad p 15)
Princeton Instruments
QinetiQ North America
Sensor to Image GmbH
Sensor Technologies America Inc
Tattile Srl
Teledyne DALSA
(see ad p 39, inside back cover)
Thinklogical
Toshiba Teli Corp
TVI Vision
Vieworks Co Ltd
(see ad inside front cover)
VMI Inc
CCD CamerasColor
ABS Gesellschaft fr Automatisierung
Bildverarbeitung und Software GmbH
Adimec Advanced Image Systems BV
Aegis Electronic Group Inc
Allied Vision Technologies GmbH
(see ad back cover)
Artemis CCD Ltd
Basler AG
(see ad p 2)
Baumer Optronic GmbH
Chromasens GmbH
CIS Corp
Delta Commercial Vision LLC
e2v
GEViCAM Inc
Hitachi Kokusai Electric America Ltd
Hitachi Kokusai Electric Europe GmbH
IDS Imaging Development Systems
GmbH
(see ad p 11)
Image Teck
Imaging Solutions Group
The Imaging Source Europe GmbH
INFAIMON SL
INFAIMON do Brasil
INFAIMON LDA
INFAIMON Mxico SA de CV
InterTest Inc
JENOPTIK Optical Systems GmbH
Lambda Photometrics Ltd
LHERITIER
LORD Imaging
Lumenera Corp
(see ad p 10)
Mightex Systems
(see ad p 12)
_____________
|asI, owerIul, IeldIesIed, nexI generaIion inIerIace
We are USB. IDS has been the leader in industrial
USB cameras for a decade. We have now incorporated
all of our knowledge into the next generation uEye
cameras with USB 3.0. Experience you can rely on.
www.ids-imaging.com/usb3
Sh||I|NI0uS83.OSPLL0
w|IhuLye
C
CPCAVLPASN0w
N
e
w

m
o
d
e
l
s

w
i
I
h

n
e
w

s
e
n
s
o
r
s
:

e
2
v

2

V
e
g
a

ix
e
l

C
V
0
S
lS

2

V
e
g
a

ix
e
l

C
V
0
S
lS

4

V
e
g
a

ix
e
l
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
USB3.0 Industrial Cameras (from $479/ea*)
Super-speed USB3.0 (5Gb/s)
5MP CMOS, color and B/W
Digital output, no need for frame
grabber
No external power required
Support multi-camera applications
4-pin GPIOs
Full-featured SDK
DirectShow & TWAIN drivers
Linux driver and USB protocol
OEM discount
www.mightex.com or www.mightexsystems.com
TCN-1304-U & TCE-1304-U
3,648 pixels, 8Pmx200Pm
16bit, 138 lines/second
Optimized for optical spectrometers
USB2.0 Line Scan Cameras (from $488/ea*)
Mightex
Tel.: (USA) +1-925-218-1885
email: sales@mightex.com
Order Online, Ship Worldwide, Free Tech Support
TCN-1209-U & TCE-1209-U
2,048 pixels, 14Pmx14Pm
12bit, 3,300 lines/second
TCE-1024-U & TCE-1024-UF
1,024 pixels, 14Pmx14Pm
8 or 12bit (switchable)
up to 25,000 lines/second
* For US shipping addresses only.
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 12
P
r
o
d
u
c
t
s
Cameras: CCD CamerasCooled
Mosaic Engineering Inc
Ocean Thin Films
Optronics
Phase 1 Technology Corp
PHYTEC America LLC
PixeLINK
Point Grey
(see ad p 15)
PPT Vision Canada Inc
QImaging
QinetiQ North America
RMA Electronics Inc
Saber1 Technologies LLC
Sensor Technologies America Inc
Sony Electronics Inc
SphereOptics GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
Toshiba Imaging Systems Div
TVI Vision
Unibrain Inc
(see ad p 39)
Unibrain SA (Europe/Asia)
Vieworks Co Ltd
(see ad inside front cover)
VMI Inc
VRmagic GmbH
XIMEA
(see ad p 13)
CCD CamerasCooled
Acal BFi France Holdings - SAS
Allied Scientific Pro
Allied Vision Technologies GmbH
(see ad back cover)
Artemis CCD Ltd
EHD Imaging GmbH
Hamamatsu Corp
IL Photonics
LOT-QuantumDesign Ltd
Lumenera Corp
(see ad p 10)
Nuvu Cameras Inc
Ocean Thin Films
Optronics
Pacer International
PCO AG
Photonic Science and Defence Vision Systems
Princeton Instruments
QImaging
Sofradir EC Inc
SphereOptics GmbH
Thermo Scientific - CIDTEC
Vieworks Co Ltd
(see ad inside front cover)
XIMEA
(see ad p 13)
CCTV Cameras
Audio Video Supply
Basler AG
(see ad p 2)
Moxa Americas Inc
Tectivity Inc
TeleEye Holdings Ltd
Charge-Injection-Device
Cameras
Thermo Scientific - CIDTEC
CMOS Cameras
ABS Gesellschaft fr Automatisierung
Bildverarbeitung und Software GmbH
Acal BFi France Holdings - SAS
Adimec Advanced Image Systems BV
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
xiQ
easy
powerful
versatile
USB3 Vision cameras
1 CMOS 4Mpix xiQ camera, shown with ultra-compact standard C-mount body and board level, single PCB
easy
todep|oyanduse
US83V|s|onp|ugandp|ay
w|ndows,L|nuxand0SX
supportfor30+v|s|on||brar|es
freeAP|forcustom|ntegrat|ons
US82.0backwardcompat|b|e
powerful
4Np|xw|th90fps
V0Aw|th00fps,andmore
g|oba|shutter
thesma||ests|ze
the|owestpowerconsumpt|on
prec|s|onmach|nedmeta|body
versatile
0,0SandSmounts
h|Rextendedsensors
0ENboard|eve||ns|ng|eP08
most ex|b|e mount|ng opt|ons
upto25mact|vecab|e|ength
X|NEA0orp.USA +1(303}389-9838
X|NEA0mbH0ermany+49(2501}94555-0|nfo@x|mea.com x|mea.com ________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 14
P
r
o
d
u
c
t
s
Cameras: Digital-Output Cameras
Aegis Electronic Group Inc
Allied Scientific Pro
Allied Vision Technologies GmbH
(see ad back cover)
Alternative Vision Corp
AOS Technologies AG
Aphesa
Basler AG
(see ad p 2)
Baumer Optronic GmbH
CIS Corp
e-con Systems India Pvt Ltd
Emergent Vision Technologies Inc
(see ad p 6)
EPIX Inc
(see ad p 38)
FastVision LLC
GEViCAM Inc
Hamamatsu Corp
Hitachi Kokusai Electric Europe GmbH
IDS Imaging Development Systems
GmbH
(see ad p 11)
IL Photonics
Imaging Solutions Group
The Imaging Source Europe GmbH
INFAIMON SL
INFAIMON do Brasil
INFAIMON Mxico SA de CV
InterTest Inc
JAI A/S
JAI Inc
(see ad p 19)
JENOPTIK Optical Systems GmbH
Kappa optronics France
Kappa optronics GmbH
Kappa optronics Inc
Lumenera Corp
(see ad p 10)
Microscan Systems Inc
(see ad p 7)
Mightex Systems
(see ad p 12)
Mikrotron GmbH
Mosaic Engineering Inc
New Imaging Technologies (NIT)
Ocean Thin Films
odos imaging Ltd
Olympus Industrial
Optronis GmbH
PCO AG
Phase 1 Technology Corp
Photron Inc
PHYTEC America LLC
PixeLINK
Point Grey
(see ad p 15)
QImaging
Teledyne DALSA
(see ad p 39, inside back cover)
Toshiba Imaging Systems Div
Toshiba Teli Corp
Vieworks Co Ltd
(see ad inside front cover)
Vision Research
VMI Inc
VRmagic GmbH
XIMEA
(see ad p 13)
X-Scan Imaging Corp
Digital-Output Cameras
ABS Gesellschaft fr Automatisierung
Bildverarbeitung und Software GmbH
Adimec Advanced Image Systems BV
Basler AG
(see ad p 2)
CIS Corp
Cooper Vision Technologies Inc
DRS Technologies Inc
illunis LLC
Microscan Systems Inc
(see ad p 7)
PHYTEC Messtechnik GmbH
PixeLINK
Sensor Technologies America Inc
TVI Vision
Video Scope International Ltd
Vieworks Co Ltd
(see ad inside front cover)
XL Imaging LLC
FireWire (1394) Cameras
1stVision Inc
(see ad p 25, 38)
A&B Software
Acal BFi France Holdings - SAS
Allied Vision Technologies GmbH
(see ad back cover)
ATTIVA Imaging Science & Technology
ATTIVA Visao Imagem Cience e Tecnologia LTDA
Basler AG
(see ad p 2)
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
_______________
_________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 16
P
r
o
d
u
c
t
s
Cameras: Gigabit Ethernet Cameras
Cooper Vision Technologies Inc
G4 Technology Co Ltd
Hitachi Kokusai Electric America Ltd
Image Labs International
Image Teck
Imaging Solutions Group
The Imaging Source Europe GmbH
IMI Technology Co Ltd
Industrial Vision Systems Ltd
IVS Imaging
JENOPTIK Optical Systems GmbH
PHYTEC Messtechnik GmbH
PixeLINK
Point Grey
(see ad p 15)
Princeton Instruments
QImaging
Resonon Inc
RMA Electronics Inc
Soliton Technologies Pvt Ltd
Sony Electronics Inc
Toshiba Teli Corp
Unibrain Inc
(see ad p 39)
Unibrain SA (Europe/Asia)
VMI Inc
XIMEA
(see ad p 13)
XL Imaging LLC
Gigabit Ethernet Cameras
1stVision Inc
(see ad p 25, 38)
A&B Software
Adept Turnkey
Alliance Vision
Allied Vision Technologies GmbH
(see ad back cover)
AOS Technologies AG
AT - Automation Technology GmbH
ATTIVA Imaging Science & Technology
ATTIVA Visao Imagem Cience e Tecnologia LTDA
Audio Video Supply
Basler AG
(see ad p 2)
Baumer Optronic GmbH
Cooper Vision Technologies Inc
Datalogic Automation Inc
e2v
Emergent Vision Technologies Inc
(see ad p 6)
FRAMOS GmbH
GEViCAM Inc
Hitachi Kokusai Electric America Ltd
Hitachi Kokusai Electric Europe GmbH
IDS Imaging Development Systems
GmbH
(see ad p 11)
illunis LLC
Image Labs International
Image Teck
Imaging Solutions Group
The Imaging Source Europe GmbH
IMI Technology Co Ltd
JAI A/S
JAI Inc
(see ad p 19)
JENOPTIK Defense & Civil Systems
Kappa optronics France
Kappa optronics GmbH
Kappa optronics Inc
MATRIX VISION GmbH
(see ad p 31)
Microscan Systems Inc
(see ad p 7)
Mikrotron GmbH
MultiPix Imaging Ltd
NET New Electronic Technology GmbH
Nuvu Cameras Inc
Ocean Thin Films
odos imaging Ltd
Phase 1 Technology Corp
PixeLINK
Point Grey
(see ad p 15)
Princeton Instruments
Schaefter+Kirchhoff GmbH
Sensor to Image GmbH
Sensor Technologies America Inc
Sony Electronics Inc
STEMMER IMAGING
(see ad p 17)
Tattile Srl
Tectivity Inc
Toshiba Teli Corp
Vieworks Co Ltd
(see ad inside front cover)
Vision Projects - AB Controls
Vision Research
XL Imaging LLC
High-Speed Video Cameras
Acal BFi France Holdings - SAS
Adept Turnkey
Analysis of Motion
AOS Technologies AG
Emergent Vision Technologies Inc
(see ad p 6)
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Explore state of the art vision technology from Europes
largest provider. Discover how we combine leading products
with out standing competence and service to make you
stronger! Imaging is our passion.
CAM__SC=839.472
=95,628
CAM__SC=352.893
CAM__SC=538.473
d=26,952mm
CAM__SC=432.576
VI SI ON TECHNOLOGY
FOR YOUR MARKET
I LLUMI NATI ON
OPTI CS
CAMERAS
CABLI NG
ACQUI SI TI ON
SOFTWARE
SYSTEMS
ACCESSORI ES
www.stemmer-imaging.com
PRO2PAC, LONDON,
MARCH 17-20, 2013, BOOTH S2124
VISION CHINA, SHANGHAI,
MARCH 19-21, 2013, HALL W1, BOOTH 1325
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 17
P
r
o
d
u
c
t
s
Cameras: Linescan Cameras
EPIX Inc
(see ad p 38)
Fastec Imaging Corp
FastVision LLC
Festo AG & Co KG
IMPERX
IO Industries Inc
Lumenera Corp
(see ad p 10)
Mikrotron GmbH
NorPix Inc
Olympus Industrial
Olympus NDT
Optronics
Optronis GmbH
PCO AG
Pembroke Instruments LLC
Photron Inc
PixeLINK
Pyramid Imaging LLC
Shimadzu Scientific Instruments
Sony Electronics Inc
Teledyne DALSA
(see ad p 39, inside back cover)
Video Scope International Ltd
Vision Research
Infrared Cameras
Acal BFi France Holdings - SAS
Allied Scientific Pro
Allied Vision Technologies GmbH
(see ad back cover)
Alrad Instruments Ltd
Armstrong Optical Ltd
Cooper Vision Technologies Inc
DIAS Infrared GmbH
DRS Technologies Inc
FJW Optical Systems Inc
FLIR Systems Inc
HGH Systmes Infrarouges
InfraTec GmbH
IR Cameras LLC
IRCAM GmbH
JENOPTIK Defense & Civil Systems
Laser Lines Ltd
LOT-QuantumDesign Ltd
Pembroke Instruments LLC
Photon Etc
Sierra Olympic Technologies Inc (SOTI)
Sofradir EC Inc
Teledyne Judson Technologies
UTC Aerospace Systems (Sensors Unlimited
Products)
Xenics
Linescan Cameras
Alrad Instruments Ltd
Aphesa
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 18
P
r
o
d
u
c
t
s
Cameras: Low-Light-Level Cameras
ATA-Vision
ATTIVA Imaging Science & Technology
ATTIVA Visao Imagem Cience e Tecnologia LTDA
Basler AG
(see ad p 2)
Bock Optronics Inc
Chromasens GmbH
Cooper Vision Technologies Inc
Datalogic Automation Inc
DIAS Infrared GmbH
e2v
Entwicklungsbuero Stresing
EVK DI Kerschhaggl GmbH
Image Labs International
INFAIMON SL
INFAIMON do Brasil
INFAIMON Mxico SA de CV
JAI A/S
JAI Inc
(see ad p 19)
KEYENCE Corp of America
Lambda Photometrics Ltd
LORD Imaging
Lucid Imaging Pvt Ltd
Mightex Systems
(see ad p 12)
msiVision
NET New Electronic Technology GmbH
NorPix Inc
Pacer International
Performance Automation Inc
Phase 1 Technology Corp
Pyramid Imaging LLC
RAUSCHER GmbH
Resolution Technology Inc
Resonon Inc
Schaefter+Kirchhoff GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
TVI Vision
UTC Aerospace Systems (Sensors Unlimited
Products)
Vision Projects - AB Controls
Webview Inc
Xenics
X-Scan Imaging Corp
Low-Light-Level Cameras
Artemis CCD Ltd
DRS Technologies Inc
e2v
e-con Systems India Pvt Ltd
FastVision LLC
Hamamatsu Corp
LHERITIER
Nuvu Cameras Inc
PCO AG
Photonic Science and Defence Vision Systems
QImaging
Sierra Olympic Technologies Inc (SOTI)
Sofradir EC Inc
Stanford Photonics Inc
Teledyne Judson Technologies
Thermo Scientific - CIDTEC
Tichawa Vision GmbH
Toshiba Imaging Systems Div
UTC Aerospace Systems (Sensors Unlimited
Products)
Video Scope International Ltd
Xenics
Multispectral Cameras
4M-Vision
ABS Gesellschaft fr Automatisierung
Bildverarbeitung und Software GmbH
Alternative Vision Corp
Chromasens GmbH
Delta Commercial Vision LLC
EVK DI Kerschhaggl GmbH
JAI A/S
JAI Inc
(see ad p 19)
Nuvu Cameras Inc
Ocean Thin Films
Photon Etc
Photonic Science and Defence Vision Systems
QinetiQ North America
Resonon Inc
Tichawa Vision GmbH
TVI Vision
UTC Aerospace Systems (Sensors Unlimited
Products)
Smart Cameras
Adept Turnkey
Aegis Electronic Group Inc
Alternative Vision Corp
AMD
ATTIVA Imaging Science & Technology
ATTIVA Visao Imagem Cience e Tecnologia LTDA
Cognex Corp
Datalogic Automation Inc
Diaplous Ltd
ELTEC Elektronik AG
Emergent Vision Technologies Inc
(see ad p 6)
EVT - Eye Vision Technology GmbH
FastVision LLC
Festo AG & Co KG
FiberVision GmbH
GEViCAM Inc
INFAIMON LDA
Inviso BV
IVS Imaging
Lambda Photometrics Ltd
LORD Imaging
MATRIX VISION GmbH
(see ad p 31)
Matrox Imaging
Microscan Systems Inc
(see ad p 7)
Mosaic Engineering Inc
MultiPix Imaging Ltd
National Instruments
New Imaging Technologies (NIT)
odos imaging Ltd
Pepperl+Fuchs Inc
PPT Vision Canada Inc
Soliton Technologies Pvt Ltd
Sony Electronics Inc
STEMMER IMAGING
(see ad p 17)
Tattile Srl
Teledyne DALSA
(see ad p 39, inside back cover)
Toshiba Teli Corp
The Value Engineering Alliance
VectorBlox
Videomail Inc
Vision & Control GmbH
Vision Components
Vision Components GmbH
Vision Projects - AB Controls
VMI Inc
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Americas:+18oo-
urope8Middleast:+,8888
AsiaPacific:+81-o-o1
www.jai.cem
- 1.j megapixeIs ceIer hk
- 1z6 x 66 reseIutien
- j. m square pixeIs
- j1 Ips Cig visien
- Fused kC eutput er raw ayer
Ier hest-based hk Iusien

Menechreme medeIs aIse avaiIabIe:
- AD-131 GE (1.3 megapixels)
- AD-081 GE/CL (0.8 megapixels)
z-CC ceIer hk is here
5miIe wideI
CaptureallthedetailsandthecolorsinyourhighcontrastsceneswiththenewAu-1z0
colorhighdynamicrangecamera.|Alsz-CCuprismtechnologysimultaneouslycaptures
zdifferentexposuresettings,enablingin-camerafusionalgorithmstogeneratefull
color,1fpsvideowithnearly1zod8ofdynamicrange.ltstheperfectanswerfordealing
with bright reections and subtle shading in PC8 inspection, glass bottle inspections,
imagingofvehiclesandtheiroccupants,andmuchmore.Foradditionalinformation,visit
www.|ai.comandclickontheRukimageonourhomepage.
A-1jzC
Get more info
/UICM/IE - 2013
see us in
Booth 839
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 20
P
r
o
d
u
c
t
s
Cameras: Time-Delay-and-Integration (TDI) Cameras
VRmagic GmbH
Webview Inc
XIMEA
(see ad p 13)
Time-Delay-and-Integration
(TDI) Cameras
Teledyne DALSA
(see ad p 39, inside back cover)
USB Cameras
1stVision Inc
(see ad p 25, 38)
ABS Gesellschaft fr Automatisierung
Bildverarbeitung und Software GmbH
Acal BFi France Holdings - SAS
Aegis Electronic Group Inc
Allied Vision Technologies GmbH
(see ad back cover)
Artemis CCD Ltd
ATTIVA Imaging Science & Technology
ATTIVA Visao Imagem Cience e Tecnologia LTDA
Basler AG
(see ad p 2)
DRS Technologies Inc
e-con Systems India Pvt Ltd
Edmund Optics
(see ad p 29)
FastVision LLC
FRAMOS GmbH
IDS Imaging Development Systems
GmbH
(see ad p 11)
IL Photonics
Image Labs International
The Imaging Source Europe GmbH
JENOPTIK Optical Systems GmbH
Kappa optronics France
Kappa optronics GmbH
Kappa optronics Inc
Lumenera Corp
(see ad p 10)
MATRIX VISION GmbH
(see ad p 31)
Mightex Systems
(see ad p 12)
NET New Electronic Technology GmbH
PCO AG
PixeLINK
Point Grey
(see ad p 15)
Schaefter+Kirchhoff GmbH
Sensor to Image GmbH
Sensor Technologies America Inc
VRmagic GmbH
Webview Inc
XIMEA
(see ad p 13)
XL Imaging LLC
UV Cameras
Aegis Electronic Group Inc
Delta Commercial Vision LLC
EHD Imaging GmbH
FJW Optical Systems Inc
GEViCAM Inc
Hitachi Kokusai Electric America Ltd
IVS Imaging
LORD Imaging
Photonic Science and Defence Vision Systems
Thermo Scientific - CIDTEC
Video Cameras
Photron Inc
RMA Electronics Inc
Sierra Olympic Technologies Inc (SOTI)
TeleEye Holdings Ltd
Toshiba Imaging Systems Div
XL Imaging LLC
X-ray Cameras
Allied Scientific Pro
Hamamatsu Corp
Photonic Science and Defence Vision Systems
Princeton Instruments
XIMEA
(see ad p 13)
X-Scan Imaging Corp
Digitizers
3D3 Solutions
Computed Vision Solutions
GFMesstechnik GmbH
Hunter Electronics LLC
Numetrix Technologies
Olympus Industrial
Photonex/UK Vision Exhibitions
XIMEA
(see ad p 13)
Displays
Industrial Displays
Audio Video Supply
Computer Dynamics
HOLOEYE Photonics AG
Hunter Electronics LLC
Pacer International
Plasma JSC
LED Displays
Hunter Electronics LLC
Lambda Research Corp
Nitin Bearings
Optics for Hire
OSRAM Opto Semiconductors
Illumination Systems/
Lighting
Backlighting Devices
BMT Industrial Ltd
Buechner Lichtsysteme GmbH
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN
Illumination Systems/Lighting: LED Lighting
Lambda Research Corp
LATAB
LVS Co Ltd
Metaphase Technologies Inc
METTLER TOLEDO CI-Vision
Microscan Systems Inc
(see ad p 7)
Polytec GmbH
Spectrum Illumination
Vision & Control GmbH
Fiber-Optic Illumination
Systems
GiGa Concept Inc
IL Photonics
Lambda Photometrics Ltd
Polytec GmbH
Sav Network
Special Application Products Ltd
Ultrafine Technology Ltd
ViSiTool
Flashlamps
Polytec GmbH
Dr Heinrich Schneider Messtechnik GmbH
Tecscan Electronics Ltd
Fluorescent Illumination
Systems
Epi-Light Ltd
MERCRON Inc
(see ad p 21)
MTD GmbH
Sav Network
Special Application Products Ltd
Sutter Instrument
(see ad p 22)
Infrared Lighting
ANVS Inc
Axton
BMT Industrial Ltd
Buechner Lichtsysteme GmbH
CCS Europe
EFFILUX
Epi-Light Ltd
LATAB
LVS Co Ltd
MERCRON Inc
(see ad p 21)
Metaphase Technologies Inc
Microscan Systems Inc
(see ad p 7)
MTD GmbH
NuLasers Ltd
OSRAM Opto Semiconductors
Polytec GmbH
ProPhotonix
Special Application Products Ltd
Spectrum Illumination
Lasers
4M-Vision
Cemar Electro Inc
FiberTech Optica
FISBA OPTIK AG
(see ad p 32)
Frankfurt Laser Co
Laser Components GmbH
Laser-export Co
Laser Lines Ltd
NuLasers Ltd
OSRAM Opto Semiconductors
Plasma JSC
Polytec GmbH
Princeton Lightwave Inc
ProPhotonix
Qioptiq
(see ad p 27)
Schaefter+Kirchhoff GmbH
Z-LASER Optoelektronik GmbH
(see ad p 23)
LED Lighting
Alliance Vision
AOS Technologies AG
_____________
______________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Lambda
TLED

Transmitted
Light
Source
High-output white light LED!
FEATURES
>10,000 hour lieliue
>2Ssecs ouo liue
JJL coulrol (wilh polarily swilch)
very slable oulpul
Coupacl slaudaloue desigu
Easy iuslallaliou
PHONE: 415. 883. 0128 | FAX: 415. 883. 0572
EMAI L: I NFO@SUTTER. COM | WWW. SUTTER. COM
N
E
W
!
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 22
P
r
o
d
u
c
t
s
Illumination Systems/Lighting: Lighting Controllers
Axton
Balluff GmbH
BMT Industrial Ltd
Bock Optronics Inc
Buechner Lichtsysteme GmbH
CCS Europe
Chromasens GmbH
EFFILUX
Epi-Light Ltd
Falcon Illumination Sdn Bhd
FRAMOS GmbH
G4 Technology Co Ltd
H&L Instruments LLC
INFAIMON SL
INFAIMON do Brasil
INFAIMON LDA
INFAIMON Mxico SA de CV
KEYENCE Corp of America
LATAB
LightGuard
Lightspeed Technologies Inc
LVS Co Ltd
MERCRON Inc
(see ad p 21)
Metaphase Technologies Inc
Microscan Systems Inc
(see ad p 7)
Mightex Systems
(see ad p 12)
moviMED
msiVision
MTD GmbH
MultiPix Imaging Ltd
Navitar Inc
NET New Electronic Technology GmbH
Operations Technology Inc
Optics for Hire
Opto Diode Corp
Opto Engineering
Opto System Co Ltd
Orled
OSRAM Opto Semiconductors
Phoenix Imaging Machine Vision
Polytec GmbH
PPT Vision Canada Inc
ProPhotonix
Qioptiq
(see ad p 27)
Saber1 Technologies LLC
Santa Barbara Imaging
Sav Network
Special Application Products Ltd
Spectrum Illumination
Tectivity Inc
Vision & Control GmbH
ViSiTool
Lighting Controllers
BMT Industrial Ltd
Orled
Qioptiq
(see ad p 27)
Strobe Illumination
Axton
CCS Europe
Lightspeed Technologies Inc
Polytec GmbH
Structured Lighting
BMT Industrial Ltd
Buechner Lichtsysteme GmbH
EFFILUX
Frankfurt Laser Co
Laser Lines Ltd
Metaphase Technologies Inc
Polytec GmbH
ProPhotonix
Z-LASER Optoelektronik GmbH
(see ad p 23)
UV Illumination Systems
Buechner Lichtsysteme GmbH
CCS Europe
Digital Light Lab
EFFILUX
Epi-Light Ltd
_____________
___________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Laser Projections
+ OEM Solutions

ZQ2 - laser sources

< 50mW
404nm-808nm
< 8W
808nm
RS-232, PLC,
USB, Ethernet
< 200mW
404nm-980nm
Z-LASER

Hall 1,
Stand 1837
Hall B2, Stand 101
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 23
P
r
o
d
u
c
t
s
Image-Processing Systems: Digital Imaging Systems
Hellma USA Inc
Lightspeed Technologies Inc
LVS Co Ltd
MERCRON Inc
(see ad p 21)
Metaphase Technologies Inc
MTD GmbH
ProPhotonix
Special Application Products Ltd
Spectrum Illumination
Sutter Instrument
(see ad p 22)
Ultrafine Technology Ltd
White-Light Illumination
Systems
CCS Europe
EFFILUX
Epi-Light Ltd
LVS Co Ltd
MERCRON Inc
(see ad p 21)
MTD GmbH
Sav Network
Spectrum Illumination
SPO Inc
Xenon Illumination Systems
IB/E OPTICS Eckerl GmbH
IL Photonics
LOT-QuantumDesign Ltd
Sutter Instrument
(see ad p 22)
Ultrafine Technology Ltd
Image-Processing Systems
Automation/Robotics
AccuSentry Inc
Altair Industries Inc
Alta Vision Systems LLC
ASC SYSTEMS
Automated Vision LLC
Bi-Ber GmbH & Co Engineering KG
Bluewrist Inc
Compar AG Vision Systems & Robotics
Controlled Capture Systems LLC
CTR Carinthian Tech Research AG
Custom Machines Inc
ELTEC Elektronik AG
Festo AG & Co KG
FiberVision GmbH
FSI Machine Vision
INFAIMON LDA
ISRA VISION AG
ISRA VISION (SHANGHAI) Corp Ltd
JasVisio
Kasalis Inc
CA Litzler Co Inc
LMI Technologies Inc
(see ad p 9)
Machine Vision Technology Ltd
Mercator Robotec Inc
Orion Automation Ltd
Pepperl+Fuchs Inc
Recognition Robotics
SCANLAB AG
SCANLAB America Inc
SensoPart Industriesensorik GmbH
STEMMER IMAGING
(see ad p 17)
TESEO SpA
Thinklogical
Universal Robotics Inc
Vision Automation A/S
Xiris Automation Inc
Yaskawa Motoman Robotics
Zmation Inc
Digital Imaging Systems
1stVision Inc
(see ad p 25, 38)
Active Silicon Inc
Active Silicon Ltd
Analog Way Inc
Complete Inspection Systems Inc
Controlled Capture Systems LLC
_____________
______
_________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Solufonsn0pfcs-PcduccdfoyourNccds www.opfo.dc
0pfcalComponcnfs
Confgurahlc 0gfal Mcroscopcs
Rgh Magnfcafon C-Mounf 0h|ccfvcs
Jclcccnfrc Lcnscs
P
r
o
d
u
c
t
s
Image-Processing Systems: Document-Imaging Systems
Delta Commercial Vision LLC
Epstein Associates-K9APE
Fastec Imaging Corp
Imaging Solutions Group
JENOPTIK Optical Systems GmbH
KEYENCE Corp of America
CA Litzler Co Inc
LMI Technologies Inc
(see ad p 9)
LORD Imaging
Mosaic Engineering Inc
Orion Automation Ltd
Photron Inc
Phrontier Technologies LLC
(see ad p 39)
PHYTEC America LLC
Psychsoftpc
QinetiQ North America
RAM Optical Instrumentation
SPECIM Spectral Imaging Ltd
Stanford Photonics Inc
Tattile Srl
Vision Components GmbH
VisionMOS International Inc
Document-Imaging Systems
Active Silicon Ltd
PC Industries
Guidance/Tracking Systems
ASC SYSTEMS
Norman N Axelrod Associates
Controlled Capture Systems LLC
Diaplous Ltd
HaSoTec GmbH
IRIDA Labs
ISRA VISION AG
ISRA VISION (SHANGHAI) Corp Ltd
LHERITIER
Mercator Robotec Inc
Pepperl+Fuchs Inc
Recognition Robotics
Servo-Robot Inc
Infrared Imaging Systems
1stVision Inc
(see ad p 25, 38)
CTR Carinthian Tech Research AG
DRS Technologies Inc
EVK DI Kerschhaggl GmbH
FJW Optical Systems Inc
HGH Systmes Infrarouges
IRCAM GmbH
JENOPTIK Defense & Civil Systems
LOT-QuantumDesign Ltd
Motion X Corp
Phoenix Imaging Machine Vision
Photon Etc
Pressco Technology Inc
Sofradir EC Inc
SPECIM Spectral Imaging Ltd
Xenics
Inspection/Nondestructive
Testing Systems
AccuSentry Inc
Altair Industries Inc
Alta Vision Systems LLC
ASC SYSTEMS
Automated Vision LLC
Bi-Ber GmbH & Co Engineering KG
Bloomy Controls Inc
Brown & Sharpe
Cognitens
Compar AG Vision Systems & Robotics
Complete Inspection Systems Inc
CTR Carinthian Tech Research AG
Dark Field Technologies Inc
Datalogic Automation SpA
Dunkley International
Epstein Associates-K9APE
EVK DI Kerschhaggl GmbH
Fastec Imaging Corp
FSI Machine Vision
Hamey Vision Systems Pty Ltd
InterTest Inc
IRCAM GmbH
ISRA SURFACE VISION Inc
Label Vision Systems Inc
CA Litzler Co Inc
LOT-QuantumDesign Ltd
Machine Vision Technology Ltd
Max Levy Autograph Inc
Nello Zuech Associates
Neurotech Pte Ltd
Numetrix Technologies
Omron Automation and Safety
Optikos Corp
OptoNova AB
Opto GmbH
(see ad p 24)
Opto System Co Ltd
Orion Automation Ltd
Phoenix Imaging Machine Vision
Pressco Technology Inc
Pyramid Imaging LLC
QualiVision AG
RAM Optical Instrumentation
SAC Sirius Advanced Cybernetics GmbH
Dr Heinrich Schneider Messtechnik GmbH
TESEO SpA
TRICOR Systems Inc
TruColor Vision Systems Inc
________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 25
P
r
o
d
u
c
t
s
Image-Processing Systems: Microscopy Systems
VISIONx Inc
Webview Inc
Xiris Automation Inc
Instrumentation Systems
Bloomy Controls Inc
FiberTech Optica
RAM Optical Instrumentation
TRICOR Systems Inc
Vision Research
Intelligent Transportation
Systems
International Electronic Machines Corp
IRIDA Labs
Medical Diagnostics Systems
Norman N Axelrod Associates
Opto GmbH
(see ad p 24)
Phrontier Technologies LLC
(see ad p 39)
Psychsoftpc
Toshiba Imaging Systems Div
Metrology/Measurement/
Gauging Systems
3DM Devices Inc
Alrad Instruments Ltd
Altair Industries Inc
Norman N Axelrod Associates
Brown & Sharpe
Cognitens
Dark Field Technologies Inc
FiberVision GmbH
FSI Machine Vision
GOEPEL Electronics LLC
Hamey Vision Systems Pty Ltd
International Electronic Machines Corp
Inviso BV
ISRA SURFACE VISION Inc
ISRA VISION AG
ISRA VISION (SHANGHAI) Corp Ltd
LMI Technologies Inc
(see ad p 9)
Lucid Imaging Pvt Ltd
Machine Vision Technology Ltd
Max Levy Autograph Inc
Mercator Robotec Inc
Motion X Corp
msiVision
Nello Zuech Associates
Neurotech Pte Ltd
Numetrix Technologies
Operations Technology Inc
Optical Gaging Products (OGP)
Optikos Corp
OptoNova AB
Opto GmbH
(see ad p 24)
Orion Automation Ltd
PPT Vision Canada Inc
Psychsoftpc
Pyramid Imaging LLC
RAM Optical Instrumentation
SCANLAB AG
SCANLAB America Inc
Dr Heinrich Schneider Messtechnik GmbH
Servo-Robot Inc
Vision Automation A/S
VISIONx Inc
Z-LASER Optoelektronik GmbH
(see ad p 23)
Microscopy Systems
Motion X Corp
Opto GmbH
(see ad p 24)
Photon Etc
Santa Barbara Imaging
Dr Heinrich Schneider Messtechnik GmbH
_____________
________
____________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 26
P
r
o
d
u
c
t
s
Image-Processing Systems: Motion-Analysis Systems
Motion-Analysis Systems
1stVision Inc
(see ad p 25, 38)
Analysis of Motion
AOS Technologies AG
Coleman Technologies Inc
Fastec Imaging Corp
HaSoTec GmbH
Mega-Fabs Motion Systems Ltd
NorPix Inc
Photron Inc
Vision Research
Xcitex Inc
Optical-Character-Recognition/
Optical-Character-Verification
Systems
Alta Vision Systems LLC
Bi-Ber GmbH & Co Engineering KG
e-con Systems India Pvt Ltd
FSI Machine Vision
Machine Vision Technology Ltd
Matrox Imaging
Mercator Robotec Inc
METTLER TOLEDO CI-Vision
Neurotech Pte Ltd
Omron Automation and Safety
PC Industries
Pepperl+Fuchs Inc
Phoenix Imaging Machine Vision
PPT Vision Canada Inc
QualiVision AG
Seidenader Maschinenbau GmbH
TRICOR Systems Inc
The Value Engineering Alliance
Verification Systems Ltd
Vision Automation A/S
Xiris Automation Inc
Zmation Inc
Process-Control Systems
3DM Devices Inc
AccuSentry Inc
AICOM
Norman N Axelrod Associates
Bi-Ber GmbH & Co Engineering KG
Bloomy Controls Inc
CTR Carinthian Tech Research AG
Dunkley International
FiberTech Optica
INFAIMON LDA
ISRA SURFACE VISION Inc
METTLER TOLEDO CI-Vision
Nello Zuech Associates
Pressco Technology Inc
SAC Sirius Advanced Cybernetics GmbH
SCANLAB AG
SCANLAB America Inc
Servo-Robot Inc
SPECIM Spectral Imaging Ltd
Vision Automation A/S
Z-LASER Optoelektronik GmbH
(see ad p 23)
Zmation Inc
Quality-Assurance Systems
AccuSentry Inc
AICOM
AT - Automation Technology GmbH
Norman N Axelrod Associates
Bi-Ber GmbH & Co Engineering KG
Bluewrist Inc
Brown & Sharpe
Cognitens
Complete Inspection Systems Inc
CTR Carinthian Tech Research AG
Digital Light Lab
Dunkley International
Epstein Associates-K9APE
EVK DI Kerschhaggl GmbH
FSI Machine Vision
GOEPEL Electronics LLC
Hamey Vision Systems Pty Ltd
Industrial Vision Systems Ltd
ISRA SURFACE VISION Inc
ISRA VISION AG
ISRA VISION (SHANGHAI) Corp Ltd
KEYENCE Corp of America
Label Vision Systems Inc
METTLER TOLEDO CI-Vision
Nello Zuech Associates
Neurotech Pte Ltd
NorPix Inc
Orion Automation Ltd
Pressco Technology Inc
QualiVision AG
RAM Optical Instrumentation
SAC Sirius Advanced Cybernetics GmbH
Seidenader Maschinenbau GmbH
Servo-Robot Inc
TRICOR Systems Inc
TruColor Vision Systems Inc
Universal Robotics Inc
Verification Systems Ltd
Vision Machines Inc
Remote-Sensing Systems
1stVision Inc
(see ad p 25, 38)
ASC SYSTEMS
FiberTech Optica
SPECIM Spectral Imaging Ltd
Web-Scanning Systems
1stVision Inc
(see ad p 25, 38)
3DM Devices Inc
AccuSentry Inc
Automated Vision LLC
Dark Field Technologies Inc
Dunkley International
Epstein Associates-K9APE
ISRA SURFACE VISION Inc
ISRA VISION AG
ISRA VISION (SHANGHAI) Corp Ltd
CA Litzler Co Inc
Lucid Imaging Pvt Ltd
OptoNova AB
PC Industries
SAC Sirius Advanced Cybernetics GmbH
TruColor Vision Systems Inc
Image-Processing Toolkits
Data-Acquisition Toolkits
AQSENSE SL
Controlled Capture Systems LLC
Development Tools
Amerinex Applied Imaging Inc
EURESYS Inc
EURESYS Pte Ltd
JasVisio
LEAD Technologies Inc
Math & Tech Engineering GmbH
Matrox Imaging
Soliton Technologies Pvt Ltd
Unibrain Inc
(see ad p 39)
Digital-Signal Processor (DSP)
Development Toolkits
Kane Computing Ltd
Vision Components
Windows-Based Toolkits
ADCIS
Amerinex Applied Imaging Inc
Unibrain SA (Europe/Asia)
Image-Storage Devices
AV&R Vision & Robotics
Curtiss-Wright Controls Defense Solutions
IO Industries Inc
NorPix Inc
_____________
The new Optem FUSION Lens System
affords unmatched exibility and
optical performance versatility for
streamlined integration. The user-
congurable modular design delivers
an endless array of micro-imaging
options to meet your
exact needs.
Easily Interchange modules
to modify form, function
and performance
Congure for zoom optical
versatility or xed
magnication economy
Fits most any camera
format or mount
Integrated automation
focus & illumination
options
Magnify...
Resolve...
INSPECT
www.qioptiq.com
!-800-429-0257 +! 585 223-2370
info@us.qioptiq.com
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN
Lenses: High-Resolution Lenses
Olympus Industrial
VisionMOS International Inc
Integrated Circuits
ASICs
AWAIBA GmbH
AWAIBA
Communications Controllers
H&L Instruments LLC
Lenses
Camera Lenses
1stVision Inc
(see ad p 25, 38)
Archer OpTx
Audio Video Supply
Bock Optronics Inc
Edmund Optics
(see ad p 29)
FUJIFILM North America Corp
Kowa Optimed
Kunlun Optics
Lasertec Inc
Lensation GmbH
Light Works LLC
Midwest Optical Systems Inc
moviMED
msiVision
MultiPix Imaging Ltd
New England Optical Systems Inc - NEOS
Optics for Hire
Opto Engineering
Opto GmbH
(see ad p 24)
PENTAX, A Richo Co
Photonex/UK Vision Exhibitions
POG Praezisionsoptik Gera
Qioptiq
(see ad p 27)
RMA Electronics Inc
Saber1 Technologies LLC
SPO Inc
Tectivity Inc
Universe Kogaku (America) Inc
(see ad p 39)
ViSiTool
Westech Optical Corp
(see ad p 39)
Carl Zeiss AG
Enlarging Lenses
Kunlun Optics
Lensation GmbH
Meridian Trade Inc
Myutron Inc
Qioptiq
(see ad p 27)
High-Resolution Lenses
Edmund Optics
(see ad p 29)
FUJIFILM North America Corp
G4 Technology Co Ltd
Goyo Optical Japan Inc
(see ad p 38)
IB/E OPTICS Eckerl GmbH
Kowa Optimed
Lensation GmbH
Myutron Inc
Navitar Inc
NET New Electronic Technology GmbH
New England Optical Systems Inc - NEOS
Opto Engineering
Opto GmbH
(see ad p 24)
PENTAX, A Richo Co
POG Praezisionsoptik Gera
Qioptiq
(see ad p 27)
Resolution Technology Inc
SPO Inc
Universe Kogaku (America) Inc
(see ad p 39)
VST America Inc
Westech Optical Corp
(see ad p 39)
Carl Zeiss AG
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 28
P
r
o
d
u
c
t
s
Lenses: Image-Scanning Lenses
Image-Scanning Lenses
Goyo Optical Japan Inc
(see ad p 38)
Kowa Optimed
Meridian Trade Inc
Myutron Inc
Navitar Inc
PENTAX, A Richo Co
Qioptiq GmbH
Universe Kogaku (America) Inc
(see ad p 39)
VST America Inc
Westech Optical Corp
(see ad p 39)
Carl Zeiss AG
Infrared Lenses
Alternative Vision Corp
Armstrong Optical Ltd
Edmund Optics
(see ad p 29)
IRCAM GmbH
JENOPTIK Optical Systems GmbH
Lensation GmbH
Meridian Trade Inc
New England Optical Systems Inc - NEOS
Optics for Hire
Opto Engineering
Opto GmbH
(see ad p 24)
Universe Kogaku (America) Inc
(see ad p 39)
VST America Inc
Carl Zeiss AG
Projection Lenses
Goyo Optical Japan Inc
(see ad p 38)
IB/E OPTICS Eckerl GmbH
JENOPTIK Optical Systems GmbH
Lasertec Inc
New England Optical Systems Inc - NEOS
Qioptiq GmbH
Telecentric Lenses
Edmund Optics
(see ad p 29)
Goyo Optical Japan Inc
(see ad p 38)
IB/E OPTICS Eckerl GmbH
Kowa Optimed
Kunlun Optics
Lensation GmbH
Light Works LLC
Melles Griot Optical Systems
Myutron Inc
Navitar Inc
New England Optical Systems Inc - NEOS
Opto Engineering
POG Praezisionsoptik Gera
Qioptiq
(see ad p 27)
SPO Inc
Vision & Control GmbH
VST America Inc
Carl Zeiss AG
UV Lenses
Goyo Optical Japan Inc
(see ad p 38)
JENOPTIK Optical Systems GmbH
Myutron Inc
PENTAX, A Richo Co
Universe Kogaku (America) Inc
(see ad p 39)
VST America Inc
Westech Optical Corp
(see ad p 39)
Video Lenses
Edmund Optics
(see ad p 29)
FUJIFILM North America Corp
Kowa Optimed
Light Works LLC
Navitar Inc
PENTAX, A Richo Co
Qioptiq
(see ad p 27)
SPO Inc
Westech Optical Corp
(see ad p 39)
Off-The-Shelf Software
Application-Development
Software
A&B Software
ABB Inc
ADCIS
Datalogic Automation Inc
Dunkley International
IMI Technology Co Ltd
Industrial Vision Systems Ltd
MATRIX VISION GmbH
(see ad p 31)
MVTec Software GmbH
Opticad Corp
Pleora Technologies Inc
RAUSCHER GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
TESEO SpA
Tordivel AS
VectorBlox
Verification Systems Ltd
Vision Components
Color-Analysis Software
AICOM
OPTIS
Teledyne DALSA
(see ad p 39, inside back cover)
Vision Machines Inc
Data-Acquisition Software
3D3 Solutions
Diffraction Ltd
HiTech Control Systems Inc
IO Industries Inc
Microstar Laboratories Inc
Xcitex Inc
Digital-Signal-Processing
Software
Teledyne DALSA
(see ad p 39, inside back cover)
Embedded FPGA Software
Aphesa
AQSENSE SL
Pleora Technologies Inc
Teledyne DALSA
(see ad p 39, inside back cover)
VectorBlox
Image-Analysis Software
3D3 Solutions
A&B Software
ADCIS
Amerinex Applied Imaging Inc
Applied Image Inc
Diffraction Ltd
EURESYS Inc
EURESYS Pte Ltd
EURESYS SA
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Pick Your Sensor. FIND YOUR LENS.
more optics | more technology | more service
www.edmundoptics.com
USA: +1-856-547-3488
EUROPE: +44 (0) 1904 788600
ASIA: +65 6273 6644
JAPAN: +81-3-5800-4751
VOTED #1
PREFERRED SUPPLIER
Of the top 6 suppliers of stock and custom optics,
Edmund Optics, Inc. ranks #1
for 6 years in a row
*
.
*October 2012 Readex Research Survey
%
o
f
r
e
s
p
o
n
d
e
n
t
s
i
n
v
o
l
v
e
d
i
n
p
u
r
c
h
a
s
i
n
g
o
p
t
i
c
a
l
c
o
m
p
o
n
e
n
t
s
Edmund Optics, Inc.
36%
24%
9%
8%
2%
1%
A
B
C
D
E
Instantly nd the right lens for your application
710 imaging lenses to choose from
in-stock for immediate deivery
2D and 3D models for easy integration
READY TO GET STARTED?
www.edmundoptics.com/your-sensor
_________________________________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 30
P
r
o
d
u
c
t
s
Off-The-Shelf Software: Image-Compression Software
Matrox Imaging
MVTec Software GmbH
Opticad Corp
OPTIS
Optronics
Teledyne DALSA
(see ad p 39, inside back cover)
Verification Systems Ltd
Vision Components
Xcitex Inc
Image-Compression Software
Alacron Inc
Kane Computing Ltd
NorPix Inc
Image-Processing Software
ADCIS
Amerinex Applied Imaging Inc
Diffraction Ltd
EPIX Inc
(see ad p 38)
IO Industries Inc
MATRIX VISION GmbH
(see ad p 31)
Matrox Imaging
SAC Sirius Advanced Cybernetics GmbH
Silicon Software GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
Verification Systems Ltd
Xcitex Inc
Machine-Vision Software
ABB Inc
Adept Turnkey
AICOM
Alacron Inc
Alrad Instruments Ltd
AQSENSE SL
BitFlow Inc
Bluewrist Inc
Bock Optronics Inc
Cognex Corp
Computed Vision Solutions
Datalogic Automation Inc
FiberVision GmbH
G4 Technology Co Ltd
HiTech Control Systems Inc
International Electronic Machines Corp
JasVisio
KEYENCE Corp of America
MATRIX VISION GmbH
(see ad p 31)
Matrox Imaging
moviMED
MVTec Software GmbH
National Instruments
OPTIS
Polytec GmbH
Resolution Technology Inc
SCANLAB AG
SCANLAB America Inc
Teledyne DALSA
(see ad p 39, inside back cover)
Tordivel AS
Universal Robotics Inc
The Value Engineering Alliance
Vision & Control GmbH
Vision Components
Vision Components GmbH
Vision Machines Inc
Vision Projects - AB Controls
Xiris Automation Inc
Optical-Character-Recognition
Software
HiTech Control Systems Inc
Tordivel AS
Vision Components
Xiris Automation Inc
Optical Subsystems
Borescopes
Berliner Glas KGaA Herbert Kubatz GmbH & Co
InterTest Inc
Light Works LLC
Endoscopes
Berliner Glas KGaA Herbert Kubatz GmbH & Co
Qioptiq
(see ad p 27)
Ultrafine Technology Ltd
ViSiTool
Microscopes
Max Levy Autograph Inc
Meridian Trade Inc
Opto GmbH
(see ad p 24)
Orled
Qioptiq
(see ad p 27)
Santa Barbara Imaging
Sutter Instrument
(see ad p 22)
ViSiTool
Spectrophotometers
Optics for Hire
Orled
Pacer International
Photon Etc
Resonon Inc
Optics
Autofocus Optics
Kunlun Optics
Motion X Corp
Beamsplitters
Access Optics
Advanced Optics Inc
Armstrong Optical Ltd
Berliner Glas KGaA Herbert Kubatz GmbH &
Co
Deposition Sciences Inc (DSI)
Edmund Optics
(see ad p 29)
FISBA OPTIK AG
(see ad p 32)
G-S PLASTIC OPTICS
Guernsey Coating Laboratories Inc
Hellma USA Inc
Laser Components GmbH
Laser Components USA Inc
Light Works LLC
Meadowlark Optics Inc
Midwest Optical Systems Inc
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
As a consequence the
camera fits perfectly
with all applications
from industrial image process-
ing to medical technology.
Exceptional performance
not only promised. Just try our
USB 3.0 camera, and get more infor-
mation at: www.mv-penny-pincher.com
The best value for your investment:
you dont have to be a penny pincher to
require that. Getting value for money
gives you the good feeling that you
have done everything correctly.
Our smallest camera
mvBlueFOX3 offers resolu-
tions from VGA to 14 Mpixels
and frame rates up to 600 fps.
MATRIX VISION GmbH
Talstr. 16 71570 Oppenweiler Germany Phone: +49 - 71 91- 94 32- 0
info
@
matrix-vision.de www.matrix- vision.com
PENNY PINCHER PENNY PINCHER
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 32
Optics: Filters
Optics Balzers AG
Optics Balzers Jena GmbH
OptoSigma Corp
Photonex/UK Vision Exhibitions
TEMTO Technology Co Ltd
Filters
Access Optics
Applied Image Inc
Archer OpTx
Berliner Glas KGaA Herbert Kubatz GmbH &
Co
Deposition Sciences Inc (DSI)
Edmund Optics
(see ad p 29)
FJW Optical Systems Inc
G-S PLASTIC OPTICS
Guernsey Coating Laboratories Inc
Kunlun Optics
Laser Components GmbH
Laser Components (UK) Ltd
Laser Components USA Inc
Lasertec Inc
Melles Griot Optical Systems
Midwest Optical Systems Inc
Ocean Thin Films
Optics Balzers AG
Optics Balzers Jena GmbH
OptoSigma Corp
PG&O - Precision Glass & Optics
Qioptiq GmbH
TEMTO Technology Co Ltd
Mirrors
Access Optics
Advanced Optics Inc
Archer OpTx
Deposition Sciences Inc (DSI)
Edmund Optics
(see ad p 29)
G-S PLASTIC OPTICS
Guernsey Coating Laboratories Inc
Hellma USA Inc
Laser Components USA Inc
Lasertec Inc
Melles Griot Optical Systems
Midwest Optical Systems Inc
Optics Balzers AG
Optics Balzers Jena GmbH
OptoSigma Corp
PG&O - Precision Glass & Optics
Photonex/UK Vision Exhibitions
Plasma JSC
Optical Coatings
Access Optics
Advanced Optics Inc
Archer OpTx
Deposition Sciences Inc (DSI)
Edmund Optics
(see ad p 29)
G-S PLASTIC OPTICS
Guernsey Coating Laboratories Inc
JENOPTIK Optical Systems GmbH
Laser Components GmbH
Laser Components (UK) Ltd
Laser Components USA Inc
Max Levy Autograph Inc
Meadowlark Optics Inc
Melles Griot Optical Systems
Ocean Thin Films
Optics Balzers AG
Optics Balzers Jena GmbH
OptoSigma Corp
PG&O - Precision Glass & Optics
Photonex/UK Vision Exhibitions
Plasma JSC
TEMTO Technology Co Ltd
Polarizers
Deposition Sciences Inc (DSI)
GiGa Concept Inc
Laser Components GmbH
Laser Components USA Inc
Meadowlark Optics Inc
Midwest Optical Systems Inc
Orled
PG&O - Precision Glass & Optics
TEMTO Technology Co Ltd
Prisms
Access Optics
Allied Scientific Pro
Archer OpTx
FISBA OPTIK AG
(see ad p 32)
Guernsey Coating Laboratories Inc
Hellma USA Inc
Lasertec Inc
Meridian Trade Inc
Optics Balzers AG
Optics Balzers Jena GmbH
OptoSigma Corp
PG&O - Precision Glass & Optics
POG Praezisionsoptik Gera
Qioptiq GmbH
TEMTO Technology Co Ltd
www.fsba.com
Optical microsystems
and miniaturized
measuring sensors
FISBA OPTIK develops and
manufactures customized
and miniaturized optical
microsystems which open
new elds in biophoto-
nics:
- Instruments for new
therapies and diag-
nostics
- Early detection of
diseases
- Instruments for follow-
up care
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 33
P
r
o
d
u
c
t
s
Sensors: Detectors, Infrared
Reticles and Test Targets
Alrad Instruments Ltd
Applied Image Inc
Max Levy Autograph Inc
POG Praezisionsoptik Gera
Shutters
Melles Griot Optical Systems
Sutter Instrument
(see ad p 22)
Vincent Associates
Positioning Equipment
Drives
Maxon Precision Motors Inc
Mega-Fabs Motion Systems Ltd
Nitin Bearings
Omron Automation and Safety
Linear Drives
Mega-Fabs Motion Systems Ltd
Robotic Subsystems
Custom Machines Inc
Diaplous Ltd
Nitin Bearings
PaR Systems Inc
Recognition Robotics
Thinklogical
Yaskawa Motoman Robotics
Servo Controllers
Maxon Precision Motors Inc
Mega-Fabs Motion Systems Ltd
Omron Automation and Safety
Servomotors
Maxon Precision Motors Inc
Stepper Motors
Sutter Instrument
(see ad p 22)
X-Y Positioning Subsystems
Colorado Video Inc
Fabreeka International Inc
Lightspeed Technologies Inc
Motion X Corp
Nitin Bearings
Operations Technology Inc
PaR Systems Inc
SCANLAB AG
SCANLAB America Inc
Sutter Instrument
(see ad p 22)
Z-LASER Optoelektronik GmbH
(see ad p 23)
X-Y Tables
Fabreeka International Inc
Operations Technology Inc
PaR Systems Inc
Sutter Instrument
(see ad p 22)
Scanners
Barcode Scanners
BARCODAT GmbH
Cognex Corp
Datalogic Automation SpA
Dynamic Systems Inc
Label Vision Systems Inc
High-Resolution Scanners
3D3 Solutions
Datalogic Automation SpA
GFMesstechnik GmbH
GOEPEL Electronics LLC
HGH Systmes Infrarouges
Schaefter+Kirchhoff GmbH
Laser-Based Scanners
3DM Devices Inc
AQSENSE SL
Datalogic Automation SpA
Dynamic Systems Inc
Laser Lines Ltd
Optical Gaging Products (OGP)
Optical-Character-Recognition
Scanners
Datalogic Automation SpA
Dynamic Systems Inc
PC Industries
Security Systems
Forensic Systems
IRnova AB
Law-Enforcement Systems
Axton
DRS Technologies Inc
Dynamic Systems Inc
FLIR Systems Inc
Videomail Inc
Surveillance Systems
Active Silicon Inc
AMWEI Thermistor
ASC SYSTEMS
Audio Video Supply
Axton
DIAS Infrared GmbH
DRS Technologies Inc
ELTEC Elektronik AG
FLIR Systems Inc
HGH Systmes Infrarouges
InfraTec GmbH
IRIDA Labs
IRnova AB
JENOPTIK Defense & Civil Systems
Kane Computing Ltd
LHERITIER
Moxa Americas Inc
Sensoray Co Inc
(see ad p 35)
Stanford Photonics Inc
TeleEye Holdings Ltd
Ultrafine Technology Ltd
Videomail Inc
Sensors
Area CCD Solid-State Sensors
Truesense Imaging Inc
Area CMOS Sensors
Alternative Vision Corp
AnaFocus
AWAIBA GmbH
AWAIBA
New Imaging Technologies (NIT)
Teledyne DALSA
(see ad p 39, inside back cover)
Truesense Imaging Inc
VisionMOS International Inc
Detectors, Infrared
DIAS Infrared GmbH
DRS Technologies Inc
FLIR Systems Inc
IR Cameras LLC
IRnova AB
Laser Components (UK) Ltd
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 34
P
r
o
d
u
c
t
s
Sensors: Detectors, Visible
Princeton Lightwave Inc
Sierra Olympic Technologies Inc (SOTI)
Sofradir EC Inc
Teledyne Judson Technologies
ULIS
UTC Aerospace Systems (Sensors Unlimited
Products)
Xenics
Detectors, Visible
ams - TAOS
AMWEI Thermistor
Laser Components (UK) Ltd
New Imaging Technologies (NIT)
Opto Diode Corp
X-Scan Imaging Corp
Detectors, X-ray
Hamamatsu Corp
Stanford Photonics Inc
Teledyne DALSA
(see ad p 39, inside back cover)
X-Scan Imaging Corp
Linescan CCD Sensors
AWAIBA GmbH
AWAIBA
LMI Technologies Inc
(see ad p 9)
Pyramid Imaging LLC
Teledyne DALSA
(see ad p 39, inside back cover)
Truesense Imaging Inc
Linescan CMOS Sensors
ams - TAOS
AnaFocus
AWAIBA GmbH
AWAIBA
Hellma USA Inc
LMI Technologies Inc
(see ad p 9)
X-Scan Imaging Corp
Photoelectric Sensors
ams - TAOS
Balluff GmbH
Opto Diode Corp
Pepperl+Fuchs Inc
Proximity/Positioning Sensors
Balluff GmbH
Laser Components (UK) Ltd
Teledyne DALSA
(see ad p 39, inside back cover)
Time-Delay-and-Integration
(TDI) Sensors
Teledyne DALSA
(see ad p 39, inside back cover)
Vision Sensors
ams - TAOS
AT - Automation Technology GmbH
AWAIBA GmbH
AWAIBA
Balluff GmbH
Baumer Optronic GmbH
Cognex Corp
Diaplous Ltd
FRAMOS GmbH
GFMesstechnik GmbH
International Electronic Machines Corp
LMI Technologies Inc
(see ad p 9)
MATRIX VISION GmbH
(see ad p 31)
New Imaging Technologies (NIT)
Omron Automation and Safety
Opto Diode Corp
SensoPart Industriesensorik GmbH
Servo-Robot Inc
Teledyne DALSA
(see ad p 39, inside back cover)
Truesense Imaging Inc
Vision Components GmbH
System Boards
Analog Input/Output Boards
Aitech Defense Systems Inc
BitFlow Inc
Elma Electronic Inc
IMPERX
MEN Micro Inc
Microstar Laboratories Inc
Sensoray Co Inc
(see ad p 35)
Sundance Multiprocessor Technology Ltd
Camera Link Boards
Active Silicon Inc
Active Silicon Ltd
Alacron Inc
BitFlow Inc
dPict Imaging Inc
(see ad p 38)
EDT
(see ad p 6)
ELTEC Elektronik AG
EPIX Inc
(see ad p 38)
EURESYS Inc
EURESYS Pte Ltd
EURESYS SA
FastVision LLC
IMPERX
MATRIX VISION GmbH
(see ad p 31)
Phrontier Technologies LLC
(see ad p 39)
Pleora Technologies Inc
Silicon Software GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
Vivid Engineering
(see ad p 39)
Central Processing Units
(CPUs)
AMD
IMAGO Technologies GmbH
VectorBlox
Data-Acquisition Boards
4M-Vision
ATA-Vision
BitFlow Inc
EDT
(see ad p 6)
Furaxa Inc
Hellma USA Inc
Microstar Laboratories Inc
Moxa Americas Inc
Phrontier Technologies LLC
(see ad p 39)
_____________
_________
_________
_________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 35
System Boards: Frame Grabbers
Sensoray Co Inc
(see ad p 35)
Sundance Multiprocessor Technology Ltd
Wavelength Electronics Inc
Digital I/O Boards
Aitech Defense Systems Inc
Elma Electronic Inc
Furaxa Inc
H&L Instruments LLC
MEN Micro Inc
Microstar Laboratories Inc
Sensoray Co Inc
(see ad p 35)
Digital-Signal Processors
(DSPs)
AMD
dPict Imaging Inc
(see ad p 38)
IMAGO Technologies GmbH
IRIDA Labs
Kane Computing Ltd
Microstar Laboratories Inc
Phrontier Technologies LLC
(see ad p 39)
Sundance Multiprocessor Technology Ltd
Display Controllers
AMD
VisionMOS International Inc
Wavelength Electronics Inc
Embedded FPGA Hardware
4M-Vision
AMD
ATA-Vision
Diaplous Ltd
Elma Electronic Inc
H&L Instruments LLC
IMAGO Technologies GmbH
Interconnect Systems Inc
Inviso BV
IRIDA Labs
MEN Micro Inc
Pleora Technologies Inc
VectorBlox
FireWire (1394) Boards
IMI Technology Co Ltd
Unibrain Inc
(see ad p 39)
Unibrain SA (Europe/Asia)
Frame Grabbers
4M-Vision
Active Silicon Inc
Active Silicon Ltd
Aitech Defense Systems Inc
Alacron Inc
ATA-Vision
BitFlow Inc
Cognex Corp
dPict Imaging Inc
(see ad p 38)
EDT
(see ad p 6)
ELTEC Elektronik AG
EPIX Inc
(see ad p 38)
EURESYS Inc
EURESYS Pte Ltd
EURESYS SA
FastVision LLC
HaSoTec GmbH
IDS Imaging Development Systems
GmbH
(see ad p 11)
MATRIX VISION GmbH
(see ad p 31)
Matrox Imaging
National Instruments
Phase 1 Technology Corp
PHYTEC Messtechnik GmbH
RAUSCHER GmbH
Saber1 Technologies LLC
Sensoray Co Inc
(see ad p 35)
Silicon Software GmbH
STEMMER IMAGING
(see ad p 17)
Sundance Multiprocessor Technology Ltd
_____________
____________
_________________
_________________
_________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 36
P
r
o
d
u
c
t
s
System Boards: GigE Boards
Teledyne DALSA
(see ad p 39, inside back cover)
Videomail Inc
GigE Boards
IMAGO Technologies GmbH
National Instruments
Pleora Technologies Inc
RAUSCHER GmbH
Sensor to Image GmbH
Silicon Software GmbH
Image-Compression/
Decompression Boards
dPict Imaging Inc
(see ad p 38)
Kane Computing Ltd
Sensoray Co Inc
(see ad p 35)
Image-Processing Boards
ATA-Vision
Colorado Video Inc
Curtiss-Wright Controls Defense Solutions
Delta Commercial Vision LLC
dPict Imaging Inc
(see ad p 38)
EURESYS Inc
EURESYS Pte Ltd
EURESYS SA
FastVision LLC
HaSoTec GmbH
IMAGO Technologies GmbH
PHYTEC Messtechnik GmbH
Sensoray Co Inc
(see ad p 35)
Silicon Software GmbH
Sundance Multiprocessor Technology Ltd
Teledyne DALSA
(see ad p 39, inside back cover)
Reconfigurable Processors
Curtiss-Wright Controls Defense Solutions
Sensor to Image GmbH
Teledyne DALSA
(see ad p 39, inside back cover)
USB Boards
Elma Electronic Inc
Icron Technologies Corp
MEN Micro Inc
Sensoray Co Inc
(see ad p 35)
Wavelength Electronics Inc
Video Overlay Boards
Colorado Video Inc
EURESYS Pte Ltd
EURESYS SA
Sensoray Co Inc
(see ad p 35)
Test and Measurement
Equipment
Camera Test Equipment
Aphesa
Applied Image Inc
Armstrong Optical Ltd
Fastec Imaging Corp
IR Cameras LLC
IRnova AB
Kappa optronics France
Kappa optronics GmbH
Kappa optronics Inc
Kasalis Inc
Display Test Equipment
GOEPEL Electronics LLC
Optikos Corp
Opto System Co Ltd
SphereOptics GmbH
TESEO SpA
TRICOR Systems Inc
Lens Test Equipment
Applied Image Inc
Armstrong Optical Ltd
Kasalis Inc
SphereOptics GmbH
Pattern Generators
Colorado Video Inc
Vivid Engineering
(see ad p 39)
Video Generators
Colorado Video Inc
Vivid Engineering
(see ad p 39)
_____________
_____________
21st International Trade Fair and Congress
for Optical Technologies
Components, Systems and Applications
www.world-of-photonics.net
MAY 1316, 2013
MESSE MNCHEN
DRIVING INNOVATION
LIGHT APPLI ED
YEARS
OPTICAL
THE MEASURE
OF ALL THINGS:
METROLOGY.
Optical metrology and sensor technology are basic pre-
requisites for quality assurance and testing in production. As
the worlds leading trade fair for optical technologies and
the event with the largest share of international participants,
LASER World of PHOTONICS focuses on the entire range of
optical-technology and laser-based sensor solutions. It gives
you access to bundled expertise as well as a concentrated
market overview and concrete solutions for your daily
business. It combines innovation and application,
giving you a key competitive edge. Join us
as we take the lead. Register online at
www.world-of-photonics.net
P
h
o
t
o

m
a
t
e
r
i
a
l
:

F
r
a
u
n
h
o
f
e
r
-
I
n
s
t
i
t
u
t

f

r

L
a
s
e
r
t
e
c
h
n
i
k

I
L
T
,

A
a
c
h
e
n
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
www.epixinc.com
www.apgvision.com
www.falcon-illumination.com www.goyooptical.com
A D V L P T l S L M L N T
Product Showcase
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 38
PIXCI

E4 Frame
Grabber now with
Mode Switch
The updated PIXCI

E4 (Rev 4)
frame grabber now has two
operating modes. In Dual
Base mode, the new PIXCI

E4 provides maximum band-


width support for one or two
base confguration Camera
Link cameras. The new PIXCI

E4 supports one Camera Link


camera in Base/Medium/Full/
Extended mode. PoCL avail-
able. $1,295.00 with XCAP-Lite
imaging program.
Advanced Camera
Protection
The 24C is a small, light-
weight IP67 rated enclosure
that will house cameras up to
30x44mm cross-section. This
aluminum housing provides
tool-less camera access and
can be confgured for air cool-
ing and an air curtain faceplate.
It is shown with the SA-AD
pneumatically driven shutter
assembly.
All In One Lighting
Multi Colours and
Angles
Best solutions for multiple
applications or different
checking criteria. Option
selection in R,G,B,W,IR and UV
for each angle in the lighting.
All colours are separated
control.
Standard
Customized solutions
mail@falcon-illumination.com
Since 1976, Goyo Optical has
produced the widest variety of
lenses available for use in
machine vision and surveillance
applications. These include
5- and 10-Megapixel, 4/3 for-
mat Megapixel, IR Day/Night
Megapixel Zoom, UV, f/0.95,
3CCD and Pinhole lenses.
Also available are F-mount
Line Scan, Telecentric, Macro,
Scanner,Micro Head, and Pro-
jection Zoom lenses.
In the U.S. contact Midwest
Optical Systems at:
Tel: 847-359-3550
www.midopt.com
_____________
___________
______________________
___________________
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
www.westechoptical.com
Camera Interface Adapters
Translators convert camera video between Camera Link,
LVDS, RS-422, HD-SDI. Great for solving camera and frame
grabber obsolescence problems...
sales@vividengineering.com www.vividengineering.com
phone 508-842-0165
Camera Frame Grabber
Powered by the latest image sensors including Teledyne
DALSAs own advanced CMOS devices, the Genie TS family
offers resolutions from VGA up to 12 megapixels with extremely
high quality resolution and frame rates as high as 300 fps.
Watch the video at:
www.teledynedalsa.com/geniets
Powered by the latest image sensors includ
DALSAs own advanced CMOS devices, th
offers resolutions from VGA up to 12 megap
high quality resolution and frame rates as h
Watch the video at:
www.teledynedalsa.com/geniets
www.unibrain.com
www.phrontier-tech.com
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 39
A D V L P T l S L M L N T
Product Showcase
HD Board Lenses for
OEMs
As sensors become more and
more sensitive the optics must
be designed to keep pace.
Westech offers standard OTS
3 and 4 element optics but in
addition also offers 6, 8 and 10
element designs capable for up
to 10 megapixel arrays. M12
and M14 mounts are available.
Focal lengths start at 2.0mm.
Standard formats include up to
. Westech welcomes custom
requirements.
20-100m USB3 Active
Fiber Optic Cables
The new Active Optical Cables
(AOC) are fully compliant with
USB 3.0 electrical specifcations
and highly resistant to EMI/RFI.
With an ultra-thin (3.0mm)
profle, the USB 3.0 AOC
introduces a cost effective, high
performance, long connectivity
solution enabling existing
devices to be used in new
applications such as Security &
Industrial HD cameras, Medical
Imaging & digital signage.
contact: sales@unibrain.com
Camera Link Full
PHOX-F supports 10x8 mode
up to 100MHz the frst in
industry
Provides 10Gb/s or 1250MB/s
transporting bandwidth for
image, GPIO, RS232
Plug-and-play
1-fber simplex or 2-fber
duplex optical interface
Full duplex RS232 for remote
instrument control
OM3 multimode fber - 300m
Single mode fber - 10km
Use with CWDM to link multi-
ple cameras via 1 or 2 fbers
_____________
:0 5*,
F R O M P R O T O T Y P E T O P R O D U C T I O N
THE LENS YOU
NEED AND THE
SUPPORT YOU WANT
Custom Lens Manufacturer. 1000s of Lens
Sizes in Stock. Most Lenses Ship Same Day.
UKAoptics.com
516- 624-2444
info@ukaoptics.com
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 40 40
S
y
s
t
e
m

I
n
t
e
g
r
a
t
o
r
s

b
y

L
o
c
a
t
i
o
n
Australia
Adept Turnkey
Hamey Vision Systems Pty Ltd
Austria
CTR Carinthian Tech Research AG
Belgium
Covan Systems
Canada
3DM Devices Inc
4M-Vision
AV&R Vision & Robotics
Bluewrist Inc
Cemar Electro Inc
Computed Vision Solutions
GiGa Concept Inc
Intense Technologies Inc
Mercator Robotec Inc
NorPix Inc
Orus Integration Inc
Photon Etc
PixeLINK
Xiris Automation Inc
China
Shanghai Kingtek Co Ltd
Denmark
JLI vision A/S
Vision Automation A/S
France
Alliance Vision
HGH Systmes Infrarouges
LHERITIER
OPTIS
Sav Network
Germany
BARCODAT GmbH
Berliner Glas KGaA Herbert Kubatz GmbH &
Co
Bi-Ber GmbH & Co Engineering KG
DIAS Infrared GmbH
Dr Heinrich Schneider Messtechnik GmbH
EHD Imaging GmbH
FiberVision GmbH
FRAMOS GmbH
HaSoTec GmbH
HOLOEYE Photonics AG
IB/E OPTICS Eckerl GmbH
IRCAM GmbH
Jacobsen Rntgentechnik GmbH
JENOPTIK Optical Systems GmbH
Kappa optronics GmbH
Math & Tech Engineering GmbH
MTD GmbH
Opto GmbH
PHYTEC Messtechnik GmbH
Seidenader Maschinenbau GmbH
SphereOptics GmbH
unique vision GmbH
Z-LASER Optoelektronik GmbH
Greece
IRIDA Labs
Unibrain SA (Europe/Asia)
India
e-con Systems India Pvt Ltd
Nitin Bearings
Soliton Technologies Pvt Ltd
Israel
VideoSet Ltd
Italy
TESEO SpA
Vision Srl
Portugal
TST Technological Solutions
Singapore
Neurotech Pte Ltd
Spain
AICOM
AnaFocus
Data Pixel SL
Imagsa Technologies SA
JasVisio
Sweden
OptoNova AB
Switzerland
Compar AG Vision Systems & Robotics
QUALIMATEST SA
QualiVision AG
Taiwan
G4 Technology Co Ltd
The Netherlands
Inviso BV
United Kingdom
Active Silicon Ltd
Alrad Instruments Ltd
Industrial Vision Systems Ltd
Lambda Photometrics Ltd
Machine Vision Technology Ltd
Orion Automation Ltd
Tecscan Electronics Ltd
Vision Projects - AB Controls
United States
Arizona
VisionMOS International Inc
California
Analysis of Motion
Digital West Imaging
Image Teck
Innovation Matrix Inc
Motion X Corp
moviMED
OptoSigma Corp
QinetiQ North America
Schurter Inc
Voltage Multipliers Inc
Webview Inc
Colorado
Altair Industries Inc
Meadowlark Optics Inc
PENTAX, A Richo Co
Connecticut
A&B Software
Alta Vision Systems LLC
Bloomy Controls Inc
Dark Field Technologies Inc
Florida
Altec Vision Equipment
Complete Inspection Systems Inc
Pyramid Imaging LLC
Georgia
Label Vision Systems Inc
Idaho
Controlled Capture Systems LLC
Illinois
Epstein Associates-K9APE
PC Industries
Indiana
The Vision System Doctor LLC
Maryland
Active Silicon Inc
Nello Zuech Associates
Massachusetts
Automation Engineering Inc
Kasalis Inc
Maxon Precision Motors Inc
Olympus NDT
Optics for Hire
Psychsoftpc
RMA Electronics Inc
Saber1 Technologies LLC
The Value Engineering Alliance
Vision Machines Inc
WAY-2C Color Machine Vision
Xcitex Inc
Michigan
ASC SYSTEMS
Custom Machines Inc
Dunkley International
eFlex Systems
Phoenix Imaging Machine Vision
Recognition Robotics
SPOT Imaging Solutions
Minnesota
i4 Solutions LLC
illunis LLC
PaR Systems Inc
Puffin Automation
Vision ICS Inc
Montana
Image Labs International
Resonon Inc
New Jersey
InterTest Inc
IVC Vision Solutions Inc
Vision Research
New York
Melles Griot Optical Systems
msiVision
System Integrators by Location
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 41
M
a
n
u
f
a
c
t
u
r
e
r

s

R
e
p
s

b
y

L
o
c
a
t
i
o
n
Australia
Adept Turnkey
Brazil
ATTIVA Visao Imagem Cience e Tecnologia LTDA
INFAIMON do Brasil
Canada
4M-Vision
Allied Scientific Pro
Bluewrist Inc
BMT Industrial Ltd
Bock Optronics Inc
Computed Vision Solutions
Cooper Vision Technologies Inc
Global Training Solutions Inc
Mercator Robotec Inc
PPT Vision Canada Inc
France
Acal BFi France Holdings - SAS
Alliance Vision
Kappa optronics France
Sav Network
Germany
Carl Zeiss AG
EHD Imaging GmbH
FRAMOS GmbH
HOLOEYE Photonics AG
InfraTec GmbH
Laser Components GmbH
Lensation GmbH
NET New Electronic Technology GmbH
Opto GmbH
Polytec GmbH
RAUSCHER GmbH
SphereOptics GmbH
STEMMER IMAGING
Greece
Unibrain SA (Europe/Asia)
India
Lucid Imaging Pvt Ltd
Nitin Bearings
Israel
IL Photonics
VideoSet Ltd
Italy
TESEO SpA
Japan
AproLink Corp
DHT Corp
Meridian Trade Inc
Toshiba Teli Corp
TUSS Vision Inc
Korea
IMI Technology Co Ltd
YNK Solution Co Ltd
Mexico
INFAIMON Mxico SA de CV
Portugal
INFAIMON LDA
Singapore
EURESYS Pte Ltd
Geldmann Technology Pte Ltd
Neurotech Pte Ltd
Spain
INFAIMON SL
Switzerland
Captiva GmbH
Taiwan
G4 Technology Co Ltd
United Kingdom
Alrad Instruments Ltd
Alto Marketing Ltd
Armstrong Optical Ltd
Kane Computing Ltd
Lambda Photometrics Ltd
Laser Lines Ltd
LOT-QuantumDesign Ltd
Machine Vision Technology Ltd
MultiPix Imaging Ltd
Pacer International
Special Application Products Ltd
Vision Projects - AB Controls
United States
Arizona
Aegis Electronic Group Inc
Alternative Vision Corp
California
Audio Video Supply
Image Ops
Image Teck
Innovation Matrix Inc
Kappa optronics Inc
Lightspeed Technologies Inc
moviMED
Pembroke Instruments LLC
VMI Inc
Florida
Altec Vision Equipment
ATTIVA Imaging Science & Technology
Hunter Electronics LLC
Illinois
Epstein Associates-K9APE
Massachusetts
1stVision Inc
Optics for Hire
Resolution Development Services
RMA Electronics Inc
Saber1 Technologies LLC
Michigan
Tectivity Inc
Minnesota
Machine Vision Store
Montana
Image Labs International
New Hampshire
ProPhotonix
New Jersey
Delta Commercial Vision LLC
InterTest Inc
New Mexico
Opticad Corp
New York
Phase 1 Technology Corp
North Carolina
LEAD Technologies Inc
Ohio
Performance Automation Inc
Resolution Technology Inc
Oregon
Sierra Olympic Technologies Inc (SOTI)
Texas
IVS Imaging
XL Imaging LLC
Washington
Dynamic Systems Inc
PHYTEC America LLC
Manufacturers Reps by Location
North Carolina
Integro Technologies
LEAD Technologies Inc
Ohio
CA Litzler Co Inc
Pepperl+Fuchs Inc
Performance Automation Inc
Pressco Technology Inc
Resolution Technology Inc
Yaskawa Motoman Robotics
Oregon
FLIR Systems Inc
Sierra Olympic Technologies Inc (SOTI)
Zmation Inc
Pennsylvania
Coleman Technologies Inc
Mosaic Engineering Inc
Tennessee
Universal Robotics Inc
Texas
GOEPEL Electronics LLC
IVS Imaging
Virginia
Curtiss-Wright Controls Defense Solutions
Washington
Dynamic Systems Inc
PHYTEC America LLC
Wisconsin
Automated Vision LLC
HiTech Control Systems Inc
_____________
Vision Systems Design
ONLINE BUYERS GUIDE
Visit the Vision Systems Design Online Buyers Guide today
to ensure you are making the most informed purchasing decisions.
www.vision-systems.com
The ultimate resource for vision and image processing decision makers researching
machine vision products and services.
The Vision Systems Design Online Buyers Guide brings you the most comprehensive and
up-to-date information on machine vision companies, products, systems and services so you
can make the most informed purchasing decisions. Use the Online Buyers Guide and you can:
Research machine vision and image processing products and services
Search for machine vision and image processing suppliers
Compare products in a side-by-side table
Contact vendors
so easy.
search.
compare.
buy.
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 43 43
1stVision Inc
2 Dundee Dr, Andover, MA 01810,
978-474-0044, FAX:978-623-7260,
info@1stvision.com, www.1stvision.com,
emp10, 1998
Offers imaging and machine vision products,
including GigE Vision, FireWire, USB 2.0,
USB 3.0, Camera Link, HSLink, EIA analog,
CCD/CMOS (UV-VIS-NIR-SWIR) cameras,
lenses, illumination, frame grabbers, video
recording, cabling, image processing and
analysis.
(see ad p 25, 38)
3D3 Solutions
80!5NlraserWay,2ndll,8urnaby,8CV5J5M8,
Canada,604-628-6!28,
conlacl@3d3solulions.com,
www.3d3solulions.com
3DM Devices Inc
#73347-262Sl,Aldergrove,8CV4W3V9,
Canada,604-856-83!!,lAX.604-856-4442,
inlo@3dm.com,www.3dm.com,emp!8,!996
4M-Vision
!5Howard,Monlreal,QCH9A2L2,Canada,
5!4-684-83!5,lAX.5!4-822-!033,
inlo@4mvision.com,www.4mvision.com,2004
A&B Software
5HollyTer,NewLondon,CT06320,
860-823-830!,lAX.860-777-2506,
sales@ab-soll.com,www.ab-soll.com,emp5,
!999
ABB Inc
PobolicsDiv,!2508rownPd,AuburnHills,Ml
48326,248-39!-9000,sales.inlo@us.abb.com,
www.abb.com/robolics
ABS Gesellschaft fr
Automatisierung Bildverarbeitung
und Software GmbH
LrlangerAllee!03,JenaD-07747Cermany,
49-364!-2226-0,lAX.49-364!-2226-!!,
inlo@abs-jena.de,www.kameras.abs-jena.de,
emp20,!990
Acal BFi France Holdings - SAS
(subolAcalplc),4AlleeduCanlal,CL!834,
Lvry9!0!8lrance,33-!-60-79-59-00,
lAX.33-!-60-79-89-70,inlo@bloplilas.com,
www.bloplilas.com,emp5!0,!973
Access Optics
200!NWillowAve,8rokenArrow,OK
740!2-9!09,9!8-294-!234,lAX.9!8-294-!236,
inlo@accessoplics.com,www.accessoplics.com
AccuSentry Inc
605lranklinPd,Mariella,CA30067,
770-850-!700,lAX.770-850-!705,
inlo@accusenlry.com,www.accusenlry.com,!99!
Active Silicon Inc
479JumpersHolePd,Suile30!,SevernaPark,
MD2!!46,4!0-696-7642,lAX.4!0-696-7643,
inlo@aclivesilicon.com,www.aclivesilicon.com
Active Silicon Ltd
PinewoodMews,8ondClose,lverSL00NAUK,
44-!753-650-600,lAX.44-!753-65!-66!,
inlo@aclivesilicon.com,www.aclivesilicon.com,
!988
ADCIS
3rueMarlinLulherKing,Sl-Conlesl!4280
lrance,33-2-3!-06-23-00,
lAX.33-2-3!-06-23-09,inlo@adcis.nel,
www.adcis.nel,emp!0,!995
Adept Turnkey
Level!,!5DrakeSl,OsbornePark,WA60!7
Auslralia,6!-8-924254!!,lAX.6!-8-920!999!,
adepl@adepl.nel.au,www.adepl.nel.au,emp!5,
!988
2013
Buyers Guide
Company Directory
Company Name (Advertisers will have bullet)
Address, Phone, Fax, Web
Number of Employees, Year Founded
Description
Cross-reference Ad
Vision Systems Design
98 Spit Brook Rd, Nashua, NH 03062;
603-891-0123; FAX 603-891-9328
www.vision-systems.com
emp 11, 1996
Vision Systems Designs global magazine, web site,
e-mail newsletters and research deliver a detailed
understanding of how companies are designing
complex vision systems for applications from the
factory foor to biomedical research, agriculture,
security, transportation, military and more. For
more than 14 years, we have provided engineers,
designers, and systems integration professionals
with the technical information and real-world
examples they need to design the most advanced
systems with greater effciency and fewer costly
errors. To request a free subscription, including our
annual Buyers Guide and Camera Directory issues,
visit www.vsd-subscribe.com.
(see ad p. xx)
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Using the listings in the Company Directory
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 44 44
Adimec Advanced Image Systems BV
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Adimec Advanced Image Systems BV
Luchlhavenweg9!,Lindhoven5657LAThe
Nelherlands,3!-40-2353900,
lAX.3!-40-2353965,markeling@adimec.com,
www.adimec.com,emp!00,!992
Advanced Optics Inc
PO8ox!!7,Pewaukee,Wl53072-0!!7,
262-548-!!55,lAX.262-548-!!53,
sales@advancedoplics.com,
www.advancedoplics.com,emp5,!966
Aegis Electronic Group Inc
!465Nliesla8lvd,#!0!,Cilberl,AZ85233,
480-635-8400,lAX.480-635-9272,
aegis-g2@aegiselecl.com,www.aegis-elec.com,
emp!6,!989
AIA
900ViclorsWay,Suile!40,AnnArbor,Ml48!08,
734-994-6088,lAX.734-994-3338,
kslraighl@visiononline.org,www.visiononline.org,
emp!5,!984
AICOM
8isbeMorgades,45,Vic(8arcelona)08500Spain,
34-9-3-88-32-884,lAX.34-9-3-85-04-0!0,
aicom@aicom.eu,www.aicom.eu,emp3,!993
Aitech Defense Systems Inc
(subolAilechPuggedCrouplnc),!9756Prairie
Sl,Chalsworlh,CA9!3!!,888-248-3248,
lAX.8!8-407-!502,sales@rugged.com,
www.rugged.com,emp!63,!982
Alacron Inc
7!Spil8rookPd,Suile200,Nashua,NH03060,
603-89!-2750,lAX.603-89!-2745,
sales@alacron.com,www.alacron.com,emp!0,
!985
Alliance Vision
PoledaclivilesduMeyrol,7avduMeyrol,
Monlelimar26200lrance,33-4-75-53-!4-00,
lAX.33-4-75-53-!4-04,inlos@alliancevision.com,
www.alliancevision.com,emp8
Allied Scientifc Pro
202-8!58ouldelaCarriere,Calineau,QC
J8Y6T4,Canada,800-253-4!07,
inlo@alliedscienlilcpro.com,
www.alliedscienlilcpro.com
Allied Vision Technologies GmbH
Taschenweg 2a, Stadtroda D-07646
Germany, 49-36428-677-0,
FAX:49-36428-677-28,
info@alliedvisiontec.com,
www.alliedvisiontec.com, emp200, 1989
Offers a wide range of digital machine
vision cameras for industrial inspection,
automation, medical imaging, ITS and more.
The high-quality FireWire cameras, Gigabit
Ethernet cameras, and Camera Link cameras
offer outstanding reliability and a very high
value for money both in the visible and
non-visible spectrum (infrared).
(see ad back cover)
Allison Park Group Inc
4055 Alpha Dr, Allison Park, PA 15101,
412-487-8211, FAX:412-486-3157,
sales@apgvision.com,
www.apgvision.com, emp6, 1990
Manufactures camera and lighting enclosures
for harsh environments, including explosion
proof, food (FDA), and corrosive washdown.
Additionally, the company manufactures
several lines of pan and tilt mounts.
(see ad p 38)
Almeco SpA
ViadellaLiberazione!5,SanCiulianoMilanese,
(Ml)20098llaly,39-02-988-963-!,
lAX.39-02-988-963-99,
inlo.il@almecogroup.com,
www.almecogroup.com,emp250,!965
Alrad Instruments Ltd
AlderHouse,TurnpikePd,lnduslrialLslale,
Newbury,8erkshirePC!42NSUK,
44-!635-303-450,lAX.44-!635-326-300,
sales@alrad.co.uk,www.alrad.co.uk,emp!0,
!970
Altair Industries Inc
2!7PacquelleDr,#5,llCollins,CO80524,
970-2!7-!623,lAX.970-224-2786,
sales@allairinduslriesinc.com,
www.allairinduslriesinc.com,emp6,!998
Alta Vision Systems LLC
!0!OldClinlonPd,Weslbrook,CT06498,
860-604-5808,inlo@allavisionsyslems.com,
www.allavisionsyslems.com,emp3,!998
Altec Vision Equipment
5030Champion8lvd,C!!-!!2,8ocaPalon,lL
33496,56!-988-9385,lAX.56!-423-9278,
allec@allecvision.com,www.allecvision.com,
emp5,!995
Alternative Vision Corp
4729LSunriseDr,#33!,Tucson,AZ857!8,
520-6!5-4073,lAX.520-844-6332,
inlo@all-vision.com,www.all-vision.com,emp4,
2002
Alto Marketing Ltd
Ollce3,UniversalMarina,CrableckLn,Sarisbury
Creen,SoulhamplonSO!37ALUK,
44-!489-557-672,lAX.44-!489-559-246,
davidr@allo-markeling.com,
www.allo-markeling.com,2002
Alysium-Tech GmbH
Kuehnertsgasse 5, Nuremberg 90402
Germany, 49-911-937878-0,
FAX:49-911-937878-93,
sales@alysium-tech.com,
www.alysium.com, emp52, 2004
Partners with companies for high-
performance interconnect solutions. With
signifcant experience in the felds of cables
and cable assemblies, the company ensures
highly professional support for projects.
(see ad p 4)
AMD
2950LHarmonyPd,Suile300,llCollins,CO
80528,970-226-9668,www.amd.com
Amerinex Applied Imaging Inc
PO8ox6473,MonroeTownship,NJ0883!,
609-944-8855,lAX.609-944-8855,
inlo@amerineximaging.com,
www.amerineximaging.com,emp5,!986
Amphenol Industrial Operations
40-60DelawareAve,Sidney,NY!3838-!395,
800-678-0!4!,lAX.607-563-5!57,
mcleary@amphenol-aio.com,
www.amphenol-induslrial.com
ams - TAOS
(subolamsAC),!00!KleinSl,Suile300,Plano,
TX75074-3762,972-673-0759,
lAX.972-943-06!0,sales@laosinc.com,
www.laosinc.com,!998
AMWEI Thermistor
!!-502Songpingshan,LangshanPdNanshan,
Shenzhen,Cuangdong5!8057China,
86-755-2657-0!!!,lAX.86-755-2657-!!22,
sales@amwei.com,www.amwei.com,emp350,
!999
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 45 45
AWTI 3rd Eye MobileVision
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
AnaFocus
AvlsaacNewlon,4,Pabellondellalia,7alsladela
Carluja,Seville4!092Spain,34-954-8!26!,
lAX.34-954-8!242,ralael.romay@analocus.com,
www.analocus.com,emp45,2003
Analog Way Inc
2998roadway,Suile!620,NewYork,NY!0007,
2!2-269-!902,lAX.2!2-269-!943,
salesusa@analogway.com,www.analogway.com,
!989
Analysis of Motion
2295LmmellAve,SimiValley,CA93063,
805-624-!086,al@analysisolmolion.com,
www.analysisolmolion.com,2007
ANVS Inc
80!WPobinsonDr,Suile500,NorlhSallLake,
UT84054,80!-5!9-0500,lAX.80!-5!9-0500,
nvsupporl@anvsinc.com,www.anvsinc.com,
emp5,!998
AOS Technologies AG
Taefernstr 20, Baden-Daettwil CH-5405
Switzerland, 41-56-483-3488,
FAX:41-56-483-3489,
info@aostechnologies.com,
www.aostechnologies.com, emp12, 2002
Designs and manufactures high-speed
cameras, high-speed camera systems, and
high-speed image streaming systems.
Provides high-speed imaging systems for
industrial, automotive, research and defense
applications. Offers turnkey solutions with its
cameras.
Aphesa
PuedeLorce,39,Harze49208elgium,
32-4-366-!8-70,lAX.32-4-366-08-!0,
inlo@aphesa.com,www.aphesa.com,emp3,
2008
Applied Image Inc
!653LMainSl,Pochesler,NY!4609,
585-482-0300,lAX.585-288-5989,
inlo@appliedimage.com,www.appliedimage.com,
!978
AproLink Corp
568-!-2lnnai-cho,lunabashi,Chiba273-0025
Japan,8!-47-495-0206,lAX.8!-47-495-0270,
sales@aprolink.jp,www.aprolink.jp
AQSENSE SL
ParcCienlilciTecnologicdelaUdC,LdJaume,
Casademonl,PorlaADespalx23C/PicdePeguera
!5,Cirona!7003Spain,34-972-!83-2!5,
lAX.34-972-487-487,inlo@aqsense.com,
www.aqsense.com,emp8,2004
Archer OpTx
!208SigmaCl,Pockwall,TX75087,
972-722-!064,lAX.972-722-!063,
kevin.milchell@archeroplx.com,
www.archeroplx.com,emp33,2003
Aries Electronics Inc
26098arlramPd,8rislol,PA08825,
2!5-78!-9956,lAX.2!5-78!-9845,
www.arieselec.com
Armstrong Optical Ltd
3!CaxlonHouse,NorlhamplonSciencePk,
Norlhamplon,NorlhanlsNN36LCUK,
44-!604-654-220,lAX.44-!604-654-22!,
inlo@armslrongoplical.co.uk,
www.armslrongoplical.co.uk,!997
Artemis CCD Ltd
8Lodgelarm8arns,NewPd,8awburgh,Norwich
NP93LZUK,44-!603-740-397,
lAX.44-!603-340-600,sales@arlemisccd.com,
www.arlemisccd.com
ASC SYSTEMS
MackPl,PO8ox566,SlClairShores,Ml48080,
3!3-882-!!33,ascsyslems@live.com,
www.via.ipixir.com,!984
AT - Automation Technology GmbH
Hermann-8ossow-Slr6-8,8adOldesloe23843
Cermany,49-453!-880!!-0,
lAX.49-453!-880!!-20,
inlo@aulomalionlechnology.de,
www.aulomalionlechnology.de,!998
ATA-Vision
PuedeLibul,!0,SlCermain8-53!08elgium,
32-8!-58!-83!,lAX.32-8!-354-538,
inlo@ala-vision.com,www.ala-vision.com,emp!,
20!0
ATG Electronics Corp
!82!5PasadenaAve,SuileA-!02,LakeLlsinore,
CA,95!-245-6222,sales@algeleclronics.com,
www.algeleclronics.com
ATS Automation Tooling Systems Inc
730lounlainSlN,8ldg2,Cambridge,ON
N3H4P7,Canada,5!9-653-6500,
lAX.5!9-650-6545,inlo@alsaulomalion.com,
www.alsaulomalion.com
ATTIVA Imaging Science &
Technology
(divolAllecVisionLquipmenllnc),!4545S
MililaryTrail,#!85,Delray8each,lL33484,
56!-989-824!,lAX.56!-2!4-4036,
alliva@allivaimaging.com,
www.allivaimaging.com,emp5,!995
ATTIVA Visao Imagem Cience e
Tecnologia LTDA
MachineVisionComponenlsDiv,(divolAllec
VisionLquipmenllnc),AvSaoJose,298,
2Andar,Cenlro,Diadema,SaoPaulo09930-270
8razil,55-!!-4055-5095,lAX.55-!!-4053-29!2,
alliva@allivabrasil.com.br,
www.allivabrasil.com.br,emp5,!995
Audio Video Supply
4575PullnerSl,SanDiego,CA92!!!-22!5,
858-565-!!0!,lAX.858-565-7845,
sales@avsupply.com,www.avsupply.com,emp!4
Automated Vision LLC
!!!!DemingWay,Suile!02,Madison,Wl
537!7,608-836-9393,lAX.608-836-5!5!,
sales@aulomaledvision.com,
www.aulomaledvision.com,emp6,!987
Automation Engineering Inc
2998allardvaleSl,Wilminglon,MA0!887,
978-658-!000,lAX.978-658-!050,
aby@aeiboslon.com,www.aeiboslon.com,
emp50,!990
autoVimation
Haid-und-Neu-Slr7,Karlsruhe76!3!Cermany,
49-72!-6276756,lAX.49-72!-6276759,
sales@aulovimalion.com,www.aulovimalion.com,
emp!,2008
AV&R Vision & Robotics
269PrinceSl,Monlreal,QCH3C2N4,Canada,
5!4-788-!420,lAX.5!4-866-5830,
inlo@avr-vr.com,www.avr-vr.com,emp55,2005
AWAIBA GmbH
Pollnerslr!!0A,Nrnberg90408Cermany,
49-9!!-2!-52-!78-0,lAX.49-9!!-2!-52-!78-9,
sales@awaiba.com,www.awaiba.com,emp!4,
2004
AWAIBA
MadeiraTecnopolo,lunchal,Madeiralsland
9020-!05Porlugal,35!-29!-723-!24,
lAX.35!-29!-723-!74,sales@awaiba.com,
www.awaiba.com,emp22,2004
AWTI 3rd Eye MobileVision
9940WSamHouslonPkwy,Houslon,TX77099,
866-804-2984,inlo@awli.nel,www.awli.nel,
emp!50,2000
_____________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 46 46
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Norman N Axelrod Associates
Norman N Axelrod Associates
445L86lhSl,NewYork,NY!0028,
2!2-74!-6302,naxelrod@axelrodassociales.com,
www.axelrodassociales.com
Axton
(divolANVSlnc),80!WPobinsonDr,Suile500,
NorlhSallLake,UT84054,80!-5!9-0500,
lAX.80!-5!9-050!,dmilryp@axlonlech.com,
www.nighlvisionweb.com/inlrared_illuminalors,
emp5,!998
Balluff GmbH
Schurwaldslr9,NeuhausenD-73765Cermany,
49-7!58-!73-0,lAX.49-7!58-50!0,
ballull@ballull.com,www.ballull.de,emp2!00,
!92!
BAP Image Systems GmbH
AmWeichselgarlen7,Lrlangen9!058Cermany,
49-9!3!-69!540,lAX.49-9!3!-69!542,
inlo@bapimgsys.com,www.bapimgsys.com,2000
BARCODAT GmbH
Poberl8oschSlr!3,DornslellenD-72280
Cermany,49-7443-960!-0,lAX.49-7443-3999,
verlrieb@barcodal.de,www.barcodal.de,emp20,
!986
Basler AG
An der Strusbek 60-62, Ahrensburg 22926
Germany, 49-4102-463-500,
FAX:49-4102-463-599,
sales.europe@baslerweb.com,
www.baslerweb.com, emp300, 1988
Manufactures digital cameras for industrial
applications, medical devices, traffc systems,
and the video surveillance market. Products
offer easy integration, compact size, and a
very strong price/performance ratio.
(see ad p 2)
Baumer Optronic GmbH
VisionTechnologiesDiv,(subol8aumerCroup
Swilzerland),8adslr30,PadebergD-0!454
Cermany,49-3528-43-86-0,
lAX.49-3528-43-86-86,
sales@baumeroplronic.com,
www.baumer.com/cameras,emp!20,!997
Beijing Jimingyuan Technology Co
80Xueyuannanlu,Pm2!!,S8ldg,8eijing!0008!
China,86-!0-62!8-9583,lAX.86-!0-62!7-0357,
www.jiming.com.cn
Benteler Maschinenbau GmbH
lrachlslr!0-!6,8ieleleldD-33602Cermany,
49-52!-542-22!,lAX.49-52!-542-!99,
oplical-syslems@benleler.com,www.benleler.com
Berliner Glas KGaA Herbert Kubatz
GmbH & Co
WaldkraiburgerSlr5,8erlinD-!2347Cermany,
49-30-6090-50,lAX.49-30-6090-5!00,
pholonics@berlinerglas.de,www.berlinerglas.com,
emp!000,!952
Bi-Ber GmbH & Co Engineering KG
Oslendslr25,8erlinD-!2459Cermany,
49-30-5304-!253,lAX.49-30-5304-!254,
inlo@bilderkennung.de,www.bilderkennung.de
BitFlow Inc
400WCummingsPk,Suile5050,Woburn,MA
0!80!,78!-932-2900,lAX.78!-933-9965,
sales@billow.com,www.billow.com,emp!0,
!993
Bloomy Controls Inc
839MarshallPhelpsPd,Windsor,CT06095-2!70,
860-298-9925,lAX.860-298-9535,
inlo@bloomy.com,www.bloomy.com,emp40,
!99!
Blue Sky Research
!537CenlrePoinleDr,Milpilas,CA95035,
408-94!-6068,sales@blueskyresearch.com,
www.blueskyresearch.com,!989
Bluewrist Inc
40ShieldsCl,Unil!02,Markham,ONL3P0M5,
Canada,289-475-52!!,
ira.greenberg@bluewrisl.com,
www.bluewrisl.com,emp!2,2006
BMT Industrial Ltd
MachineVisionDiv,802603!62ndSl,Surrey,8C
V3S2L4,Canada,604-227-!!49,
lAX.604-560-!!!6,sales@bmlca.com,
www.bmlca.com,20!!
BNC Scientifc
(subol8erkeleyNucleonics),!425McDowell8lvd,
Pelaluma,CA94954,866-276-6!88,
inlo@bncscienlilc.com,www.bncscienlilc.com
Bock Optronics Inc
!4Sleinway8lvd,Unil7,Toronlo,ONM9W6M6,
Canada,4!6-674-2804,lAX.4!6-674-!827,
sales@bockoplronics.ca,www.bockoplronics.ca,
emp9,!987
BoXin Photoelectric Co Ltd
!472NSlallionSl,Orange,CA92869,
408-3!6-33!!,henry@bxoplic.com,
www.bxoplic.com,emp204,2004
Brown & Sharpe
(subolHexagonMelrologylnc),250CircuilDr,
NorlhKingslown,Pl02852,40!-886-2000,
lAX.40!-886-2727,inlo@hexagonmelrology.us,
www.hexagonmelrology.us
Buechner Lichtsysteme GmbH
Uzslr2,WeldenD-86465Cermany,
49-8293-909!!2,lAX.49-8293-909!!!,
markeling@buechner-lichlsysleme.de,
www.buechner-lichlsysleme.de,emp9
Canyonwest Cases LLC
PO8ox!9827,lounlainHills,AZ85269,
480-8!6-9652,lAX.206-203-0674,
sales@canyonweslcases.com,
www.canyonweslcases.com
Captiva GmbH
Niederrohrdorlerslr5,OberrohrdorlCH-5452
Swilzerland,4!-56-496-8844,
erlrischend@capliva.ch,www.capliva.ch
CCS Europe
8ergensesleenweg423,8us!3,
Sinl-Pielers-Leeuw!6008elgium,32-2-333-0080,
lAX.32-2-333-008!,inlo@ccseu.com,
www.ccs-grp.com
Cemar Electro Inc
!37055lhAve,Lachine,QCH8T3J8,Canada,
5!4-63!-5807,lAX.5!4-63!-7505,
cemar@cemareleclro.com,
www.cemareleclro.com,emp!7,!983
Chromasens GmbH
Max-Slromeyer-Slr!!6,KonslanzD-78467
Cermany,49-753!-876-0,lAX.49-753!-876-303,
inlo@chromasens.de,www.chromasens.de,
emp48,2004
CIS Corp
9-8Azuma-cho,HachiojiAzumachoCenler,
8ldg6l,Hachioji,Tokyo!92-0082Japan,
8!-42-664-5568,lAX.8!-42-645-044!,
cisinlo@ciscorp.co.jp,www.ciscorp.co.jp,
emp!00,!978
CITI - North America Corona
Inspection Training Institute
!6LinsleingSl,PO8ox40!6,NesZiona74000
lsrael,888-950-5557(US),lAX.888-950-5557
(US),inlo@cili-lraining.com,
www.cili-lraining.com,2009
Cognex Corp
!VisionDr,Nalick,MA0!760,508-650-3000,
lAX.508-650-3344,mklg@cognex.com,
www.cognex.com,emp985,!98!
Cognitens
(subolHexagonMelrologylnc),250CircuilDr,
NorlhKingslown,Pl02852,40!-886-2000,
lAX.40!-886-2727,inlo@hexagonmelrology.us,
www.hexagonmelrology.us
______________
______________
__________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 47 47
Docter Optics GmbH
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Coleman Technologies Inc
5!3!WCheslerPike,NewlownSquare,PA
!9073,6!0-459-9646,lAX.484-428-2020,
sales@colemanlech.com,www.colemanlech.com,
emp7,!995
Colorado Video Inc
PO8ox928,8oulder,CO80306-0928,
303-530-9580,lAX.303-530-9569,
sales@colorado-video.com,
www.colorado-video.com,!965
Compar AG Vision Systems &
Robotics
Pielbrunnen44,PlallkonCH-8808Swilzerland,
4!-55-4!6-!0-60,lAX.4!-55-4!6-!0-6!,
inlo@compar.ch,www.compar.ch,emp!7,!986
Complete Inspection Systems Inc
334lourlhAve,lndialanlic,lL32903,
32!-952-2490,lAX.32!-952-2475,
sales@compleleinspeclionsyslems.com,
www.compleleinspeclionsyslems.com,!993
Components Express Inc
10330 Argonne Woods Dr, Suite 100,
Woodridge, IL 60517,
630-257-0605, FAX:630-257-0603,
sales@componentsexpress.com,
www.componentsexpress.com, emp35,
1992
Manufactures cable assemblies serving
vision, robotic and industrial automation
industries, Camera Link, mini Camera Link,
PoCL, CoaXPress, HS-Link, FireWire, GigE,
USB 2.0, USB 3.0 power supplies, LVDS along
with BIT-MAXX products, which support all
varieties of digital and analog camera to
frame grabber applications, including static,
high-fex and industrial environments.
(see ad p 5)
Computed Vision Solutions
4!6KilmarnockWay,Nepean,ONK2J0M6,
Canada,6!3-49!-20!2,
inlo@compuledvision.com,
www.compuledvision.com
Computer Dynamics
(divolCimlecAulomalion),3030WhilehallPkDr,
Charlolle,NC28273,704-227-4600,
lAX.704-583-967!,cdi@cimlec.com,
www.cdynamics.com,!98!
Controlled Capture Systems LLC
27!9lhSl,ldaholalls,lD83404-4806,
208-557-0300,sales@conlrolcaplure.com,
www.conlrolcaplure.com,emp!,2002
CoolLED Ltd
Weslmarch8usinessCenlre,Andover,Hampshire
SP!0!NSUK,44-!264-323-040,
lAX.44-!264-723-897,inlo@coolled.com,
www.coolled.com
Cooper Vision Technologies Inc
PO8ox35,Creely,ONK4P!N4,Canada,
6!3-82!-4603,lAX.6!3-82!-4673,
sales@covislech.com,www.covislech.com
Covan Systems
lnduslrielaan6/3,Kuurne85208elgium,
32-56-259-98!,lAX.32-56-257-64!,
inlo@covan.be,www.covan.be
CTR Carinthian Tech Research AG
Luropaslr4/!,Villach/SlMagdalen,Carinlhia
A-9524Auslria,43-4242-56300-0,
lAX.43-4242-56300-400,inlo@clr.al,www.clr.al,
emp50,!997
Curtiss-Wright Controls Defense
Solutions
(subolCurliss-WrighlConlrols),20!30Lakeview
CenlerPlaza,Suile200,Ashburn,VA
20!47,703-779-7800,lAX.703-779-7805,
delensesales@curlisswrighl.com,
www.cwcdelense.com
Custom Machines Inc
!44!LnlerpriseDr,Adrian,Ml4922!,
5!7-265-5759,lAX.5!7-264-577!,
cmi@cuslommachinesinc.com,
www.cuslommachinesinc.com,emp45,!979
Dark Field Technologies Inc
70Pobinson8lvd,Orange,CT06477-3622,
203-298-073!,lAX.203-298-0732,
lapolls@darkleld.com,www.darkleld.com,
emp!5,!997
Datalogic Automation SpA
ViaLavinoN265,MonleSanPielro,(8O)40050
llaly,39-05!-676-56!!,lAX.39-05!-675-9324,
inlo.aulomalion@dalalogic.com,
www.dalalogic.com,emp469,!972
Datalogic Automation Inc
630!WOldShakopeePd,SuileA,Minneapolis,
MN55438,952-996-9500,lAX.952-996-950!,
inlo.vision.ia@dalalogic.com,www.dalalogic.com,
emp40,!982
Data Pixel SL
PondaSlaLulalia,37,Nave!3,Parquelnduslrial
Palleja!,8arcelonaL-08780Spain,
34-936-633-043,lAX.34-936-63!-838,
inlo@dalapixel.com,www.dalapixel.com
Davin Optronics Ltd
CreycainePd,Wallord,HerlsWD247CWUK,
44-!92-320-6800,lAX.44-!92-322-8335,
sales@davinoplronics.com,
www.davinoplronics.com,emp65,!973
Delta Commercial Vision LLC
2!MapleClennPd,MlLaurel,NJ08054,
609-969-!483,jc@dellaimager.com,
www.dellaimager.com,emp5,2008
DENSO Robotics
3900ViaOroAve,Long8each,CA908!0,
3!0-834-6352,lAX.3!0-952-7502,
inlo@densorobolics.com,www.densorobolics.com
Deposition Sciences Inc (DSI)
3300ColleyLn,SanlaPosa,CA95403,
707-573-6700,lAX.707-573-6748,
solulions@depsci.com,www.depsci.com,emp90,
!985
DHT Corp
!-636Maruko-doriNakahara-ku,Kawasaki-shi,
Kanagawa-ken2!!-0006Japan,8!-44-455-025!,
lAX.8!-44-434-3679,inlo@dhl.co.jp,
www.dhl.co.jp,emp32,!989
Diaplous Ltd
PalrasSciencePk,8!2,Planlani,Palras26500
Creece,30-26!0-9!!573,lAX.30-26!0-9!!573,
inlo@diaplous.com,www.diaplous.com,2005
DIAS Infrared GmbH
CoslrilzerSlr65,DresdenD-0!2!7Cermany,
49-35!-87!7-228,lAX.39-35!-87!7-230,
inlo@dias-inlrared.de,www.dias-inlrared.de,!992
Diffraction Ltd
!00CraigHenryDr,Suile202,Ollawa,
ONK2C5W3,Canada,6!3-225-2732,
lAX.6!3-225-9688,www.dillraclionlimiled.com,
!993
Digital Light Lab
904!LxeculivePkDr,Suile!00,Knoxville,TN
37923,865-694-7892,sales@digilallighllab.com,
www.digilallighllab.com
Digital West Imaging
450MounlainViewDr,LlCajon,CA9202!,
6!9-593-!900,lAX.6!9-593-!90!,
mark@digilalweslimaging.com,
www.digilalweslimaging.com,2000
Docter Optics GmbH
Millelweg29,NeusladlanderOrla07806
Cermany,49-364-8!-27-0,
lAX.49-364-8!-27-270,inlo@docleroplics.com,
www.docleroplics.com,!996
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 48 48
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
dPict Imaging Inc
dPict Imaging Inc
7400 N Shadeland Ave, Suite 255,
Indianapolis, IN 46250,
317-436-8411, FAX:317-436-8414,
dpictsales@dpictimaging.com,
www.dpictimaging.com, 2004
Designs and manufactures high-performance
image acquisition hardware and software
development tools, including PCI and PCI
Express frame grabbers. Products support
many video standards, including HDTV, VGA,
and Camera Link.
(see ad p 38)
DRS Technologies Inc
NelworkandlmagingSyslemsDiv,!3532N
CenlralLxpwy,Dallas,TX75243,855-230-2372,
sales@drs-rsla.com,www.drsinlrared.com
Dunkley International
!9!0LakeSl,Kalamazoo,Ml4900!,
269-343-5583,lAX.269-343-56!4,
inlo@dunkleyinll.com,
www.dunkleymachinevision.com,emp50,!885
Dynamic Systems Inc
8arcodeTrackingSyslemsDiv,!533!NL90lhSl,
Pedmond,WA98052,425-2!6-!204,
robl@dsisales.com,www.a-barcode.com,emp20,
!98!
e2v
!06WalerhouseLn,Chelmslord,LssexCM!2QU
UK,44-!245-4934-93,lAX.44-!245-49-2492,
enquiries@e2v.com,www.e2v.com,emp!500,
!947
e-con Systems India Pvt Ltd
Pishabhlnlopark,PPTower-lV-7lhll,Super
A-!6&A-!7,Thiru-Vi-KalnduslrialLslale,
Chennai,TamilNadu600032lndia,
9!-44-45532052,lAX.9!-44-45532053,
anilha@e-consyslems.com,
www.e-consyslems.com,emp92
Edmund Optics
101 E Gloucester Pike, Barrington, NJ
08007, 856-573-6250, FAX:856-573-6295,
sales@edmundoptics.com,
www.edmundoptics.com/imaging,
emp700, 1942
Produces optics, imaging, and photonics
technology. Machine-vision solutions are used
in a variety of inspection applications from
food to automotive to pharmaceutical. Offers
machine-vision lenses, illumination sources,
and cameras.
(see ad p 29)
EDT
1400 NW Compton Dr, Suite 315,
Beaverton, OR 97006, 503-690-1234,
FAX:503-690-1243, info@edt.com,
www.edt.com
Designs and manufactures high-performance
Camera Link frame grabbers, simulators, and
fber extenders (PCIe, PCI, PMC, and cPCI).
Common API and full SDK for Windows,
Linux, and Mac OS X available.
(see ad p 6)
EFFILUX
7AvedelAllanlique,LesUlis9!940lrance,
lAX.33-9-72-!!-2!-69,sales@elllux.lr,
www.elllux.lr,emp8,2009
eFlex Systems
684!NPocheslerPd,Suile250C,Pochesler,Ml
48306,248-65!-5979,lAX.248-65!-9583,
edbarker@elexsyslems.com,
www.elexsyslems.com
EHD Imaging GmbH
ZumPennplalz!5,Damme,Niedersachsen4940!
Cermany,49-549!-2090,lAX.49-549!-2098,
inlo@ehd.de,www.ehd.de,emp2,!993
Elan Technical Corp
!4!KingsHwyL,lairleld,CT06825,
203-335-2!!5,lAX.203-335-2723,
elanlechnical@sbcglobal.nel,
www.elanlechnical.com,emp!4,!987
Elma Electronic Inc
SyslemsDiv,44350Crimmer8lvd,lremonl,CA
94538,5!0-656-3400,lAX.5!0-656-3783,
sales@elma.com,www.elma.com,emp300,!960
ELTEC Elektronik AG
Calileo-Calilei-Slr!!,MainzD-55!29Cermany,
49-6!3!-9!8-!00,lAX.49-6!3!-9!8-!95,
inlo@ellec.com,www.ellec.com,emp45,!978
Emergent Vision Technologies Inc
552A Clarke Rd, Suite 239, Coquitlam, BC
V3J 0A3, Canada, 866-780-6082,
FAX:866-835-8586,
info@emergentvisiontec.com,
www.emergentvisiontec.com, emp4,
2007
Develops ultra high speed cameras for
industrial imaging and machine-vision
applications and was the frst to market
a 10GigE Vision camera with direct fber
interface.
(see ad p 6)
EMVA European Machine Vision
Association
PondaSanlaLulalia37,Nave!3,8arcelona,
Palleja08780Spain,34-93!-807060,
lAX.34-93!-807060,inlo@emva.org,
www.emva.org,2003
EnerSys
23668ernvillePd,Peading,PA!96!2-4!45,
6!0-208-!837,lAX.6!0-372-86!3,
dana.kowalski@enersys.com,www.enersys.com
Entwicklungsbuero Stresing
Peinholdslr5,8erlinD-!205!Cermany,
49-30-685-4506,lAX.49-30-685-!256,
inlo@slresing.de,www.slresing.de,!985
Epi-Light Ltd
!4UnionQuay,CorkCilylreland,
353-2!-484-0686,sales@epi-lighl.com,
www.epi-lighl.com,2006
EPIX Inc
381 Lexington Dr, Buffalo Grove, IL
60089, 847-465-1818, FAX:847-465-1919,
epix@epixinc.com, www.epixinc.com,
emp9, 1983
Manufactures digital and analog cameras
from VGA to 10 megapixel, analog and digital
frame grabbers, and computer imaging
systems using Windows and Linux image
processing software. Customization for OEM
applications available.
(see ad p 38)
Epstein Associates-K9APE
PO8ox400,Wilmelle,lL6009!-0400,
630-564-9292,shel@k9ape.com,
www.k9ape.com,emp6,!978
EURESYS Inc
(divolLUPLSYSSA),27!26-8PaseoLspada,Suile
704,SanJuanCapislrano,CA92675,
949-743-06!2,lAX.949-743-2790,
sales.americas@euresys.com,www.euresys.com
EURESYS Pte Ltd
(divolLUPLSYSSA),750AChaiCheePd,7-!5
TechnoparkalChaiChee46900!Singapore,
65-6445-4800,lAX.65-6445-8849,
sales.asia@euresys.com,www.euresys.com
EURESYS SA
AveduPreAily,!4,Angleur8-403!8elgium,
32-4-367-72-88,lAX.32-4-367-4-66,
sales.europe@euresys.com,www.euresys.com,
!989
EVK DI Kerschhaggl GmbH
Josel-Krainer-Slr35,Paaba,Craz,Slyria8074
Auslria,43-3!6-46!664,lAX.43-3!6-46!664-!4,
ollce@evk.biz,www.evk.biz,emp33,!987
EVT - Eye Vision Technology GmbH
Haid-und-Neu-Slr7,Karlsruhe76!3!Cermany,
49-72!-626-905-82,lAX.49-72!-626-905-96,
inlo@evl-web.com,www.evl-web.com
_______
______________
__________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 49 49
GFMesstechnik GmbH
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Fabreeka International Inc
!023TurnpikeSl,PO8ox2!0,Sloughlon,MA
02072,78!-34!-3655,lAX.78!-34!-3983,
inlo@labreeka.com,www.labreeka.com,!9!7
Falcon Illumination Sdn Bhd
1-12A-6 SUNTECH at Penang Cybercity,
Lintang Mayang Pasir 3, Bayan Baru,
Bayan Lepas, Penang 11950 Malaysia,
60-4-646-8822, FAX:60-4-643-3388,
mail@led-i.com, www.led-i.com
Offers a wide range of standard and
customized products for machine-vision
applications.
(see ad p 38)
Falcon LED Europe Ltd
lasanenweg7,Ollenau74254Cermany,
49-7!36-9686-0,lAX.49-7!36-9686-!0,
inlo@lalcon-illuminalion.de,
www.lalcon-illuminalion.de,2006
Fastec Imaging Corp
!7!50ViadelCampo,Suile30!,SanDiego,CA
92!27,858-592-2342,lAX.858-592-26!5,
inlo@laslecimaging.com,
www.laslecimaging.com,2003
FastVision LLC
7!Spil8rookPd,Suile200,Nashua,NH03060,
603-89!-43!7,lAX.603-89!-!88!,
sales@lasl-vision.com,www.lasl-vision.com,
emp!0,200!
Festo AG & Co KG
PuilerSlr82,LsslingenD-73734Cermany,
49-7!!-347-4078,lAX.49-7!!-347-2!44,
service_inlernalional@de.leslo.com,
www.leslo.com,emp!5,500,!925
FiberTech Optica
330CageAve,Suile!,Kilchener,ONN2M5C6,
Canada,5!9-745-2763,lAX.5!9-342-0!28,
inlo@llo.ca,www.llo.ca,emp!0,2000
FiberVision GmbH
Jens-Ollo-KragSlr!!,Wuerselen,NPWD-52!46
Cermany,49-2405-4548-0,
lAX.49-2405-4548-!4,inlo@lbervision.de,
www.lbervision.de,emp!2,!995
FISBA OPTIK AG
Optical Solutions Div, Rorschacher Str
268, St Gallen 9016 Switzerland,
41-71-282-31-30, FAX:41-71-282-31-31,
info@fsba.com, www.fsba.com,
emp380, 1957
Manufactures components, optical systems
and microsystems worldwide. Highly
qualifed lens designers and engineers
are always on the lookout for perfectly
tailored solutions to specifc customer needs.
Take advantage of more than 50 years of
counseling, development, manufacturing
and innovative process and manufacturing
technologies.
(see ad p 32)
FJW Optical Systems Inc
322NWoodworkLn,Palaline,lL60067,
847-358-2500,lAX.847-358-2533,
irsales@lndrscope.com,www.lndrscope.com,
emp!0,!945
FlexLink
8ylogdegalan!!,Coleborg4!505Sweden,
46-3!-337-3!-00,inlo@lexlink.com,
www.lexlink.com,emp700,!980
FLIR Systems Inc
27700SWParkwayAve,Wilsonville,OP97070,
877-773-3547,lAX.503-498-3!53,
sales@lir.com,www.lir.com,!978
FRAMOS GmbH
Zugspilzslr5C,Pullach/MunichD-82049Cermany,
49-89-7!0667-0,lAX.49-89-7!0667-66,
inlo@lramos.de,www.lramos.de,emp50,!98!
Frankfurt Laser Co
Anden30Morgen!3,lriedrichsdorlD-6!38!
Cermany,49-6!72-27978-0,
lAX.49-6!72-27978-!0,sales@lrlaserco.com,
www.lrlaserco.com,emp26,!994
FSI Machine Vision
(divollSlTechnologieslnc),668WeslernAve,
Lombard,lL60!48,630-932-9380,
lAX.630-932-00!6,inlo@lsinel.com,
www.lsinel.com,!959
Fujikura Ltd
New Business Development Ctr, 1-5-1,
Kiba, Koto-Ku, Tokyo 135-8152 Japan,
81-3-5606-1473, FAX:81-3-5606-1574,
aoc-info@fujikura.co.jp,
www.fujikura.co.jp, emp44853, 1910
Manufactures active optical Camera Link
cable assemblies which can break the original
limit of 10 m transmission distance specifed
in Camera Link standard and enable 100
m transmission at 85 MHz, clock without
extender/repeater in base, medium and full
confgurations. PoCL and high fex cycles type
cable are also available.
FUJIFILM North America Corp
OplicalDevicesDiv,(subollUJlllLMCorp),!0
HighPoinlDr,Wayne,NJ07470,973-633-5600,
lAX.973-694-8299,kuchida@lujillm.com,
www.lujinon.com,emp35000,!965
Furaxa Inc
808CilmanSl,8erkeley,CA947!0,
925-253-2969,lAX.925-253-4894,
sales@luraxa.com,www.luraxa.com
G4 Technology Co Ltd
5l,No46,Sec3,MinquanLPd,Taipei!0477
Taiwan,886-2-2503!803,lAX.886-2-2503!802,
sales@g4.com.lw,www.g4.com.lw,emp40,200!
Gaia Converter
4038leCorbusier8lvd,Laval,QCH7L5P2,
Canada,5!4-333-3!69,lAX.5!4-333-45!9,
salesus@gaia-converler.com,
www.gaia-converler.com,emp30,!993
Gardasoft Vision Ltd
Unils!&2,CaslleAcres,Llsworlh,Cambridge
C8234JQUK,44-!954-200-343,
lAX.44-!954-204-343,www.gardasoll.com,
emp!9
Geldmann Technology Pte Ltd
!0AnsonPd,!8-!7lnlernalionalPlazaSingapore,
65-6338-6397,lAX.65-6338-63!!,
sean@geldmann.com.sg,www.geldmann.com.sg
GEViCAM Inc
673SMilpilas8lvd,Suile!00,Milpilas,CA
95035,408-945-9900,lAX.408-262-0962,
inlo@gevicam.com,www.gevicam.com,2006
GFMesstechnik GmbH
Warlheslr2!,Tellow/8erlinD-!45!3Cermany,
49-3328-9360-0,sales@glm3d.com,
www.glm3d.com
__________
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 50 50
GiGa Concept Inc
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
GiGa Concept Inc
!!8!!Suzor-Cole,Monlreal,QCH3M2H8,
Canada,5!4-745-8877,lAX.5!4-626-6784,
egirard@gigaconcepl.com,
www.gigaconcepl.com,emp4,2005
Global Training Solutions Inc
3!63WinslonChurchill8lvd,PO8ox26067,
Mississauga,ONL5L5W7,Canada,
4!6-806-5777,inlo@globallrainingsolulions.ca,
www.globallrainingsolulions.ca
GOEPEL Electronics LLC
9737CrealHillsTrail,Suile!70,Auslin,TX
78759,5!2-782-2500,lAX.734-47!-!444,
us-sales@goepel.com,www.goepelusa.com,
emp!90,!99!
Goyo Optical Japan Inc
3-8-31 Hamazaki, Asaka, Saitama
351-0033 Japan, 81-48-474-2235,
FAX:81-48-474-7373,
info@goyooptical.com,
www.goyooptical.com, emp20, 1976
Manufactures different types of industrial
lenses and flters.
(see ad p 38)
G-S PLASTIC OPTICS
408SlPaulSl,Pochesler,NY!4605,
585-295-0200,lAX.585-232-23!4,
inlo@gsoplics.com,www.gsoplics.com,!9!6
Guernsey Coating Laboratories Inc
!788CoodyearAve,Venlura,CA93003,
805-642-!508,lAX.805-642-!554,
sales@gclinc.com,www.gclinc.com,emp20,!982
Hamamatsu Corp
360loolhillPd,PO8ox69!0,8ridgewaler,NJ
08807,908-23!-0960,
lAX.908-23!-0852,usa@hamamalsu.com,
hllp.//sales.hamamalsu.com,!969
Hamey Vision Systems Pty Ltd
5!JoplingSl,PO8ox6!32,NorlhPyde,NSW
2!!3Auslralia,6!-2-88!9-4849,
lAX.6!-2-88!9-4849,
queryvsd@hameyvision.com.au,
www.hameyvision.com.au,emp3,!995
H&L Instruments LLC
34PoslPd,PO8ox580,NorlhHamplon,NH
03862-0580,603-964-!8!8,lAX.603-964-888!,
rlandman@hlinslrumenls.com,
www.hlinslrumenls.com,emp5,!979
HaSoTec GmbH
8urgwall20/2!,PoslockD-!8055Cermany,
49-38!-4909834,lAX.49-38!-4909535,
inlo@hasolec.com,www.hasolec.com,emp!2,
!990
Headwall Photonics Inc
HyperspeclralSensor&PamanlmagingDiv,
60!PiverSl,lilchburg,MA0!420,
978-353-4!00,lAX.978-348-!864,
markeling@headwallpholonics.com,
www.headwallpholonics.com,emp45,2003
Hellma USA Inc
(subolHellmaCmbH&CoKC),80SkylineDr,
Plainview,NY!!803,5!6-939-0888,
lAX.5!6-939-0555,inlo@hellmausa.com,
www.hellmausa.com
HGH Systmes Infrarouges
!0PueMaryse8aslie,lgny9!430lrance,
33-!-69-35-47-70,lAX.33-!-69-35-47-80,
hgh@hgh.lr,www.hgh-inlrared.com
Hitachi Kokusai Electric America Ltd
lnduslrialVideoSyslemsDiv,!33!LaligoLn,
llowerMound,TX75022,8!7-490-5!24,
lAX.8!7-490-6!!6,ivs@hilachikokusai.us,
www.hilachikokusai.com/ivs,emp50,!963
Hitachi Kokusai Electric Europe
GmbH
lnduslrialVideoDiv,Siemensslr9,Neulsenburg
D-63263Cermany,49-6!02-8332-0,
lAX.49-6!02-8332-499,inlo@hilachi-keu.com,
www.hilachi-keu.com,emp58,!967
HiTech Control Systems Inc
825OnlarioPd,Creen8ay,Wl543!!-80!7,
920-465-4600,lAX.920-465-460!,
hilech@hilech-inc.com,www.hilech-inc.com,
emp60,!985
HOLOEYE Photonics AG
Alberl-Linslein-Slr!4,8erlin!2489Cermany,
49-30-63923660,lAX.49-30-6392-3662,
sales@holoeye.com,www.holoeye.com
Hunter Electronics LLC
7553LakeHarborTer,LakeWorlh,lL33467,
56!-568-2063,lAX.56!-49!-8030,
hunlereleclronics20!@gmail.com,
www.hunlereleclronicsllc.com,emp5,2003
i4 Solutions LLC
!385MendolaHeighlsPd,Suile400,Mendola
Heighls,MN55!20,65!-452-5882,
sales@i4solulions.us,www.i4solulions.us
IB/E OPTICS Eckerl GmbH
PassauerSlr!3,lreyungD-94078Cermany,
49-855!-9!76505,lAX.49-855!-9!76506,
ibe@ibe-oplics.com,www.ibe-oplics.com
Icron Technologies Corp
4664LougheedHwy,Suile22!,8urnaby,8C
V5C5T5,Canada,604-638-3920,
lAX.604-638-3930,www.icron.com
IDS Imaging Development
Systems GmbH
Dimbacher Str 6-8, Obersulm D-74182
Germany, 49-7134-96196-0,
FAX:49-7134-96196-99,
info@ids-imaging.com,
http://en.ids-imaging.com, emp120, 1997
Manufactures industrial cameras with USB
2.0, USB 3.0 and GigE interface as well as
analog frame grabbers for machine-vision,
industrial imaging, visualization,
instrumentation, medical, security and
non-industrial systems.
(see ad p 11)
illunis LLC
!4700Lxcelsior8lvd,Minnelonka,MN55345,
952-975-9203,lAX.952-294-8308,
inlo@illunis.com,www.illunis.com,emp7,2000
IL Photonics
5!!Hashila,8eilShemesh99552lsrael,
972-2-992-3532,lAX.972-2-992-!480,
moshe@il-pholonics.com,www.il-pholonics.com,
emp5,2003
Image Labs International
PO8ox!545,8elgrade,MT597!4,
406-585-7225,lAX.406-388-0998,
sharla@imagelabs.com,www.imagelabs.com,
emp23,!993
Image Ops
(divolCompulerModuleslnc),!!409W
8ernardoCl,SanDiego,CA92!27,
858-6!3-!8!8,lAX.858-6!3-!8!5,
mike@imageops.com,www.imageops.com
Image Teck
2!3ViaVillena,Lncinilas,CA92024-53!9,
760-942-9052,lAX.760-942-630!,
imglk@aol.com,www.imageleck.nel,emp3,
!99!
Imaging Solutions Group
!387lairporlPd,Suile890,lairporl,NY!4450,
585-388-5220,lAX.585-388-5223,
sales@isgchips.com,www.isgchips.com,emp!4,
2003
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 51 51
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
ISRA SURFACE VISION Inc
The Imaging Source Europe GmbH
Sommerstr 34-36, Bremen D-28215
Germany, 49-421-3359-10,
FAX:49-421-3359-180,
info@theimagingsource.com,
www.theimagingsource.com, emp50,
1990
Manufactures industrial machine-vision
cameras, frame grabbers and video
converters, serving the following sectors:
factory automation, quality inspection,
medical systems, microscopy systems, life
science projects, and astronomy.
IMAGO Technologies GmbH
SlrassheimerSlr45,lriedberg6!!97Cermany,
49-603!-68426-!!,lAX.49-603!-68426-!2,
inlo.ill@imago-lechnologies.com,
www.imago-lechnologies.com,!994
Imagsa Technologies SA
NavasdeTolosa270,8arcelona8027Spain,
34-934-869-345,lAX.34-934-856-776,
inlo@imagsa.com,www.imagsa.com
IMI Technology Co Ltd
6!6MegaValley,Cwanyang2-dong,Dongan-gu,
Anyang-si,Cyeonggi-do43!-767Korea,
82-3!-423-980!,lAX.82-3!-423-9803,
brian@imi-lech.com,www.imi-lech.com,2000
IMPERX
642!CongressAve,8ocaPalon,lL33487,
56!-989-0006,lAX.56!-989-0045,
sales@imperx.com,www.imperx.com,emp33,
200!
Industrial Training Consultants Inc
2969Hwy!!,Pelham,AL35!24,205-663-4960,
conlacl@ilclrng.com,www.ilclrng.com,emp30,
!985
Industrial Vision Systems Ltd
Kingslon8usinessPk,Kingslon8agpuize,
OxlordshireOX!35lLUK,
44-!865-823-322,lAX.44-!865-823-393,
sales@induslrialvision.co.uk,
www.induslrialvision.co.uk,2000
INFAIMON SL
Vergos55,8arcelonaL-080!7Spain,
34-93-252-5757,lAX.34-93-252-5758,
inlaimon@inlaimon.com,www.inlaimon.com,
emp50,!994
INFAIMON do Brasil
(divollNlAlMONSL),PuaAnlonioAlvaresLobo
n660,Sala33,LdilicioComercialPalladio,
8olalogo,Campinas,SP!3020-!!08razil,
55-!9-25!3-0450,lAX.55-!9-25!3-023!,
inlaimon.br@inlaimon.com,www.inlaimon.com,
emp50,!994
INFAIMON LDA
(divollNlAlMONSL),PuadeViseu,43P/c,
Lsgueira,Aveiro3800-262Porlugal,
35!-234-3!2-034,lAX.35!-234-3!2-035,
inlaimon.pl@inlaimon.com,www.inlaimon.com,
emp50,2003
INFAIMON Mxico SA de CV
(divollNlAlMONSL),!!0HaciendaChinlepec,
ColLlJacal,Querelaro,QPO76!80Mexico,
52-442-2!5!4!5,lAX.52-442-2!535!5,
inlaimon.mx@inlaimon.com,www.inlaimon.com,
emp50,2007
InfraTec GmbH
CoslrilzerSlr6!-63,DresdenDL0!2!7Cermany,
49-35!-87!-8630,lAX.49-35!-87!-8727,
lhermo@inlralec.de,www.inlralec.de,emp!60,
!99!
Innovation Matrix Inc
3080OlcollSl,Suile8!05,SanlaClara,CA
95054-322!,408-329-4422,lAX.408-7!6-2553,
sales@innovalion-malrix.com,
www.innovalion-malrix.com,2004
Integro Technologies
305NLeeSl,Salisbury,NC28!44,704-636-9666,
lAX.704-63!-4786,sales@inlegro-lech.com,
www.inlegro-lech.com,emp2!,200!
IntelLiDrives Inc
85!08usllelonAve,Philadelphia,PA!9!52,
2!5-728-6804,lAX.2!5-745-9459,
admin@inlellidrives.com,www.inlellidrives.com,
emp90,!999
Intense Technologies Inc
373!PeesPd,Pichmond,8CV6X2S4,Canada,
604-270-2780,inlo@inlense.ca,www.inlense.ca,
emp2,!99!
Intercon 1
(div of Nortech Systems Inc), 7746
Goedderz Rd, Suite 110, Baxter, MN
56425, 218-828-3157, FAX:218-828-1096,
intercon@nortechsys.com,
www.intercon-1.com, emp125, 1978
Supplies standard and custom machine-vision
cables. Products include high-fex Camera
Link, CoaXPress, Camera Link HS, FireWire,
USB, GigE, analog, custom assemblies, bulk
cable, and camera power supplies.
(see ad p 4)
Interconnect Systems Inc
759llynnPd,Camarillo,CA930!2-8056,
805-482-2870,lAX.805-482-8470,
inlo@isipkg.com,www.isipkg.com,!988
International Electronic Machines
Corp
850PiverSl,Troy,NY!2!80,5!8-268-!636,
lAX.5!8-268-!639,markeling@iem.nel,
www.iem.nel,!987
InterTest Inc
303SlalePl94,Columbia,NJ07832,
908-496-8008,lAX.908-496-8004,
bginlo@inlerlesl.com,www.inlerlesl.com,!98!
Inviso BV
Kouler!06,Cemerl5422ADTheNelherlands,
3!-6-!5!20326,lAX.3!-84-8359!40,
inlo@inviso.eu,www.inviso.eu,emp!,2005
IO Industries Inc
!2-!5!0WoodcockSl,London,ONN6H5S!,
Canada,5!9-663-9570,lAX.5!9-663-957!,
inlo@ioinduslries.com,www.ioinduslries.com,
emp!6,!99!
IR Cameras LLC
30SCalleCesarChavez,Sanla8arbara,CA
93!03-5652,877-472-2637,
sales@ircameras.com,www.ircameras.com,!999
IRCAM GmbH
NrnbergerSlr7!,LrlangenD-9!052Cermany,
49-9!3!-9700980,lAX.49-9!3!-97009899,
inlo@ircam.de,www.ircam.de
IRIDA Labs
LmbeddedVisionSollwareDiv,(subollPlDALabs
Lld),PalrasSciencePk,Sladiou!Slr,Plalani,
Palras26504Creece,30-26!0-9!!568,
lAX.30-26!0-9!!569,inlo@iridalabs.gr,
www.iridalabs.gr,emp!0,2007
Iridian Spectral Technologies
2700SwanseaCrescenl,Ollawa,ONK!C6P8,
Canada,6!3-74!-45!3,lAX.6!3-74!-9986,
inquiries@iridian.ca,www.iridian.ca,emp!35,
!998
IRnova AB
Lleclrum236,KislaSL-!6440Sweden,
46-8-793-66-00,lAX.46-8-750-54-30,
inlo@irnova.se,www.irnova.se
ISRA SURFACE VISION Inc
(divollSPAVlSlONAC),4470PeachlreeLakesDr,
Dululh,CA30096,770-449-7776,
lAX.770-449-0399,inlo.surlace@isravision.com,
www.isravision.com
______________
__________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 52 52
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
ISRA VISION AG
ISRA VISION AG
lnduslrieslr!4,DarmsladlD-64297Cermany,
49-6!5!-948-0,lAX.49-6!5!-948-!40,
inlo@isravision.com,www.isravision.com,
emp500,!985
ISRA VISION (SHANGHAI) Corp Ltd
(divollSPAVlSlONAC),Croundll,8ldg4,
ZoneA,38DongshengPd,Pudong,Shanghai
20!20!China,86-2!-689!-6286-0,
lAX.86-2!-689!-6286-888,
inlo.china@isravision.com,www.isravision.com
ISVI Corp
3MorsePd,2A,Oxlord,CT06478,
203-592-8723,lAX.203-88!-3322,
sales@isvi-corp.com,www.isvi-corp.com,20!!
IVC Vision Solutions Inc
!6HydePd,8loomleld,NJ07003,
973-320-4604,lAX.973-320-4605,
waller.kol@ivcsolulions.com,
www.ivcsolulions.com,emp5,2004
IVS Imaging
!0!WranglerDr,#20!,Coppell,TX750!9,
469-635-6800,lAX.469-635-6822,
inlo@ivsimaging.com,www.ivsimaging.com,
emp29,!99!
Jacobsen Rntgentechnik GmbH
HagenowerSlr73,Schwerin!906!Cermany,
49-385-3993-470,lAX.49-385-3993-47!,
inlo@jacobsenxray.de,www.jacobsenxray.de,
emp5,!989
JAI A/S
ValbyTorvegade!7,!slll,ValbyDK-2500
Denmark,45-4457-8888,lAX.45-449!-3252,
camerasales.emea@jai.com,www.jai.com,!963
JAI Inc
(div of JAI A/S), 625 River Oaks Pkwy,
San Jose, CA 95134,
408-383-0300, FAX:408-383-0301,
camerasales.americas@jai.com,
www.jai.com
Manufactures high-performance CCD/CMOS
cameras for machine vision, medical, traffc
systems, and surveillance. Products range
from VGA to 20 megapixels with multiple
interface options.
(see ad p 19)
JasVisio
Olivera,3,Olius25286Spain,34-973-!00-602,
inlo@jasvisio.com,www.jasvisio.com
JENOPTIK Defense & Civil Systems
Sensor Systems/ESW GmbH Div,
(sub of JENOPTIK), Pruessingstr 41,
Jena, Thuringia 07745 Germany,
49-3641-65-3041, FAX:49-3641-65-3573,
infraredtechnology.dcs@jenoptik.com,
www.jenoptik.com/infraredtechnology
Offers high-resolution thermography
cameras and IR imaging modules for
industrial and security applications, offering
high-resolution, real-time imaging, and easy
integration. Applications include industrial
R&D, inspection, testing and more.
JENOPTIK Optical Systems GmbH
OploeleclronicSyslems8usinessUnil,
CoeschwilzerSlr25,Jena07745Cermany,
49-364!-65-3083,lAX.49-364!-65-2!44,
digilalimaging.os@jenoplik.com,
www.jenoplik.com/digilalimaging
JENOPTIK Optical Systems GmbH
Oplics8usinessUnil,CoeschwilzerSlr25,Jena
07745Cermany,49-364!-65-3!48,
lAX.49-364!-65-3677,oplics.os@jenoplik.com,
www.jenoplik.com/os
JLI vision A/S
Poppelgaardvej7-9,Soeborg2860Denmark,
45-39-66-0809,lAX.45-39-56-08!2,inlo@jli.dk,
www.jli.dk,emp!5,!985
Jonat Automation BV
Lindeslraal!29A,NaDongen5!05NA
TheNelherlands,3!-!3-57!!626,
lAX.3!-!3-57!5588,inlo@jonal.com,
www.jonal.com
Kane Computing Ltd
Suilel,AscolCl,7!-73MiddlewichPd,
Norlhwich,CheshireCW978PUK,
44-!606-35!-006,lAX.44-!606-35!-007,
sales@kanecompuling.com,
www.kanecompuling.co.uk,emp4,200!
Kappa optronics France
(divolKappaoplronicsCmbH),84ChePuisseau
lonlbazy,Donneville3!450lrance,
33-5-6!-27-82-8!,lAX.33-9-58-63-66-3!,
inlo@kappa-oplronics.lr,www.kappa-oplronics.lr
Kappa optronics GmbH
Kleinesleld6,Cleichen,NiedersachsenD-37!30
Cermany,49-5508-974-0,lAX.49-5508-974-!09,
inlo@kappa.de,www.kappa.de,emp!00,!978
Kappa optronics Inc
(divolKappaoplronicsCmbH),825SPrimrose
Ave,Suilel,Monrovia,CA9!0!6,626-256-4343,
lAX.626-256-6484,inlo@kappa-oplronics.com,
www.kappa-oplronics.com,!99!
Kasalis Inc
!NorlhAve,SuileC,8urlinglon,MA0!803,
78!-273-6200,inlo@kasalis.com,
www.kasalis.com
KEYENCE Corp of America
669PiverDr,Suile403,LlmwoodPark,NJ07407,
888-539-3623,lAX.20!-930-0099,
keyence@keyence.com,www.keyence.com/usa
Kidger Optics Associates
!7SlAnnsPd,Malvern,Worceslershire
WP!44PCUK,44-!684-575-003,
lina@kidger.com,www.kidger.com,emp4,!982
KiloLambda Technologies Ltd
22aPaoulWallenbergSl,Pamal-Hachayal
lnduslrialPk,TelAviv697!9lsrael,
972-3-649-7662,lAX.972-3-649-7665,
inlo@kilolambda.com,www.kilolambda.com,
emp!7,200!
Kowa Optimed
2000!SVermonlAve,Torrance,CA90502,
3!0-327-!9!3,lAX.3!0-327-4!77,
kowa-usa-inlo@kowa.com,www.kowa-usa.com,
!980
K-Sun Corp
370SMCDr,PO8ox309,Somersel,Wl54025,
7!5-247-4440,lAX.7!5-247-4003,
inlo@ksun.com,www.ksun.com,!978
Kunlun Optics
67SongmuchangHexi,Hangzhou,Zhejiang
3!0007China,86-57!-852!6836,
sales@kunlunoplics.com,www.kunlunoplics.com,
emp20,2005
Label Vision Systems Inc
!0!AuburnCl,PeachlreeCily,CA30269,
770-487-64!4,lAX.770-487-0860,
inlo@lvs-inc.com,www.lvs-inc.com,emp25,!975
Labsphere Inc
PholonicsDiv,(subolHalmaplc),23!ShakerSl,
PO8ox70,NorlhSullon,NH03260,
603-927-4266,lAX.603-927-4694,
labsphere@labsphere.com,www.labsphere.com,
emp!!0,!979
Lambda Photometrics Ltd
LambdaHouse,8allordMill,Harpenden,
HerllordshireAL558ZUK,44-!582-764-334,
lAX.44-!582-7!2-084,inlo@lambdapholo.co.uk,
www.lambdapholo.co.uk,emp20,!977
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 53 53
Math & Tech Engineering GmbH
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Lambda Research Corp
25PorlerPd,2ndll,Lilllelon,MA0!460-!434,
978-486-0766,lAX.978-486-0755,
sales@lambdares.com,www.lambdares.com,
emp!5,!992
Landesmesse Stuttgart GmbH
Messepiazza!,SlullgarlD-70629Cermany,
49-7!!-!8560-2444,lAX.49-7!!-!8560-2366,
inlo@messe-slullgarl.de,www.messe-slullgarl.de
Laser Components GmbH
Werner-von-SiemensSlr!5,OlchingD-82!40
Cermany,49-8!42-2864-0,
lAX.49-8!42-2864-!!,
inlo@lasercomponenls.com,
www.lasercomponenls.com,emp!20,!982
Laser Components (UK) Ltd
ColdlayHouse,!!4Pkwy,Chelmslord,Lssex
CM27PPUK,44-!245-49!-499,
lAX.44-!245-49!-80!,
cvarney@lasercomponenls.co.uk,
www.lasercomponenls.co.uk,emp8,!993
Laser Components USA Inc
9PiverPd,Hudson,NH0305!,603-82!-7040,
lAX.603-82!-704!,inlo@laser-componenls.com,
www.laser-componenls.com,emp!0,2000
Laser-export Co
(divolLaser-compacl),3VvedenskySl,Moscow
!!7342Pussianlederalion,7-495-720-54-50,
lAX.7-495-720-54-5!,sales@laser-exporl.com,
www.laser-exporl.com,emp72,2002
Laser Lines Ltd
8eaumonlClose,8anbury,OxonOX!6!THUK,
44-!295-672-500,lAX.44-!295-672-550,
inlo@laserlines.co.uk,www.laserlines.co.uk,
emp27,!975
Lasertec Inc
3CuanQianPd,JinAn,luzhou,lujian3500!4
China,86-59!-88056805,
lAX.86-59!-87595!52,sales@lcoplical.com,
www.lcoplical.com,emp80,2004
LATAB
(memberollhePolylecOrganizalion),
Krossgalan!8,VallingbySL-!6250Sweden,
49-7243-604!800,lAX.49-7243-69944,
inlo@lalab.nel,www.lalab.nel
LCR Electronics
9SloreslAve,Norrislown,PA!940!,
6!0-278-0840,lAX.6!0-278-0935,
sales@lcr-inc.com,www.lcr-inc.com,!984
LEAD Technologies Inc
!927STryonSl,Suile200,Charlolle,NC28203,
704-332-5532,lAX.704-372-8!6!,
sales@leadlools.com,www.leadlools.com,!990
Leds Vision Co Ltd
LangxinPd,Luocun,Nanhai,loshan,Cuangdong
China,lAX.86-757-22398968,
jonada@leds-vision.com,www.leds-vision.com,
2007
Lensation GmbH
UnlererDammweg!2,KarlsruheD-76!49
Cermany,49-72!-754045-0,
lAX.49-72!-6054339-3,inlo@lensalion.de,
www.lensalion.de
LHERITIER
(subolALCLN),ParcSlChrislophe,PoleMagellan
2-Niveau!,!0avedelLnlreprise,Cergy
PonloiseCedex95862lrance,33-!-34-24-38-20,
lAX.33-!-34-24-38-2!,inlo@lherilier-alcen.com,
www.lherilier-alcen.com,emp34,!98!
LightGuard
272WSlagPkServicePd,8urgaw,NC28425,
9!0-259-!!3!,www.lighlguard.com
Lightspeed Technologies Inc
PO8ox!!0!6!,Campbell,CA950!!,
408-76!-0062,lAX.408-378-3629,
sales@lighl-speed-lech.com,
www.lighl-speed-lech.com,2005
Light Works LLC
4750W8ancrollSl,Toledo,OH436!5,
4!9-534-37!8,lAX.4!9-534-37!7,
slusler@lw4u.com,www.lw4u.com,!999
LiPPERT ADLINK Technology GmbH
(subolADLlNKTechnologylnc),Hans-Thoma-Slr
!!,MannheimD-68!63Cermany,
49-62!-432!4-0,lAX.49-62!-432!4-30,
emea@adlinklech.com,www.adlinklech.com,
20!2
CA Litzler Co Inc
4800W!60lhSl,Cleveland,OH44!35,
2!6-267-8020,lAX.2!6-267-9856,
www.lilzleraulomalion.com,!953
LMI Technologies Inc
1673 Cliveden Ave, Delta, BC V3M 6V5,
Canada, 604-636-1011, FAX:604-516-8368,
info@lmi3d.com, www.lmi3d.com,
emp100, 1975
Specializes in 3-D measurement sensors for
production optimization and quality control
used in factory automation. Designing and
manufacturing for over 30 years, producing
60,000+ LMI sensors and over 100 patents.
(see ad p 9)
LORD Imaging
ZAdeMarly8P!!0,2ruelresnel,Corbreuse
9!4!0lrance,33-!-64-55-!5-5!,
lAX.33-!-64-59-55-95,sales@lord-ing.com,
www.lord-imaging.com,emp33,!985
LOT-QuantumDesign Ltd
!Mole8usinessPk,Lealherhead,Surrey
KT2278AUK,44-!372-378-822,
lAX.44-!372-375-353,inlo@loloriel.co.uk,
www.lol-qd.co.uk
Lucid Imaging Pvt Ltd
3!5A2ndll,9lhMain,5lh8lock,Jaynagar,
8angalore56004!lndia,9!-80-22448252,
lAX.9!-80-22448254,sales@lucidimaging.in,
www.lucidimaging.in,emp20,2005
Lumenera Corp
(div of Roper Industries), 7 Capella Ct,
Ottawa, ON K2E 8A7, Canada,
613-736-4077, FAX:613-736-4071,
info@lumenera.com, www.lumenera.com,
emp85, 2002
Manufactures high-quality, cost-effective
digital cameras and custom imaging
solutions. Unique USB3, USB2, GigE and
Ethernet cameras satisfy demanding
industrial, scientifc and surveillance
imaging requirements with superior
price-to-performance ratios.
(see ad p 10)
LVS Co Ltd
889-!48oyoung,8ldg3l,Mansu-Dong,
Namdong-Cu,lncheonCilyKorea,
82-3246!-!800,lAX.82-32-46!-!00!,
lvs@all-vision.com,www.lvs.co.kr
Machine Vision Store
!385MendolaHeighlsPd,Suile400,SlPaul,MN
55!20,65!-452-5882,
sales@machinevisionslore.com,
www.machinevisionslore.com,2005
Machine Vision Technology Ltd
8lackdownMill,KenilworlhPd,PoyalLeaminglon
SpaCV326QTUK,44-!926-422-043,
lAX.44-!926-339-538,
sales@machine-vision-lechnology.co.uk,
www.machine-vision-lechnology.co.uk,!997
Maryn International Ltd
8ay5,42!6-54lhAveSL,Calgary,A8T2C2L3,
Canada,403-252-2239,
lAX.403-253-579!,inlo@maryngroup.com,
www.maryninlernalional.com
Math & Tech Engineering GmbH
Poberl-8osch-Slr6/!,NeckarlenzlingenD-72654
Cermany,49-7!27-958-350,
lAX.49-32!2!-2!0-89!,sales@malhlech.de,
www.malhlech.eu,emp8,200!
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 54 54
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
MATRIX VISION GmbH
MATRIX VISION GmbH
Talstr 16, Oppenweiler D-71570 Germany,
49-7191-9432-0, FAX:49-7191-9432-288,
info@matrix-vision.de,
www.matrix-vision.de, emp60, 1986
Manufactures high-quality cameras and
customized solutions for machine-vision,
industrial imaging, medical, safety and traffc
applications. Product range includes digital
cameras from USB 2.0, USB 3.0, GigE with
PoE, and smart cameras to 3-D cameras for
static and moving objects.
(see ad p 31)
Matrox Imaging
!055Sl-Pegis8lvd,Dorval,QCH9P2T4,Canada,
800-804-6243,lAX.5!4-822-6273,
imaging.inlo@malrox.com,
www.malroximaging.com,emp600,!976
Max Levy Autograph Inc
(subolllVllnc),27!0CommerceWay,
Philadelphia,PA!9!44,2!5-842-3675,
lAX.2!5-842-3637,sales@maxlevy.com,
www.maxlevy.com,emp35,!872
Maxon Precision Motors Inc
!0!WaldronPd,lallPiver,MA02720,
508-677-0520,lAX.508-677-0530,
inlo@maxonmolorusa.com,
www.maxonmolorusa.com,!980
Meadowlark Optics Inc
PO8ox!000,5964lrisPkwy,lrederick,CO
80530,303-833-4333,lAX.303-833-4335,
sales@meadowlark.com,www.meadowlark.com,
emp25,!979
Mega-Fabs Motion Systems Ltd
8ldg!3lnduslrialPk,PO8ox540,Yokneam
20692lsrael,972-4-989-!050,
lAX.972-4-989-!080,inlo@mega-labs.com,
www.mega-labs.com,emp!2,2000
Melles Griot Optical Systems
(subolldexOplicsandPholonics),55Science
Pkwy,Pochesler,NY!4620,585-244-7220,
lAX.585-244-6292,lgoundry@idexcorp.com,
www.cvimellesgriol.com,emp!00,!969
MEN Micro Inc
24NMainSl,Ambler,PA!9002,2!5-542-9575,
lAX.2!5-542-9577,
slephen.cunha@menmicro.com,
www.menmicro.com,emp200,!982
Mercator Robotec Inc
330CageAve,Unil!!,Kilchener,ONN2M5C6,
Canada,5!9-884-7880,lAX.5!9-884-36!!,
inlo@mercalorrobolec.com,
www.mercalorrobolec.com,emp!0,!996
MERCRON Inc
Corporate Pk, 1203 E Executive Dr,
Richardson, TX 75081, 972-690-6565,
FAX:972-690-1150, info@mercron.com,
www.mercron.com, 1986
Manufactures high-frequency light controllers
(lamp ballasts) regulating fuorescent,
UV, IR, metal halide, tungsten, HP sodium
and now LED light sources for high-speed
machine-vision, color imaging, and
high-resolution QC/QA inspection systems.
(see ad p 21)
Meridian Trade Inc
!-!006Tsulsujigaoka3-2,Akishima-Cily,Tokyo
!96-00!2Japan,8!-42-543-7!85,
lAX.8!-42-543-7!85,
meridian@mva.biglobe.ne.jp,meridian.b-inlo.jp,
emp2,200!
Metaphase Technologies Inc
34!2ProgressDr,SuileC,8ensalem,PA!9020,
2!5-639-8699,lAX.2!5-639-0977,
sales@melaphase-lech.com,
www.melaphase-lech.com,emp50,!993
METTLER TOLEDO CI-Vision
ProducllnspeclionDiv,2640WhileOakCir,
UnilA,Aurora,lL60504,630-446-7727,
lAX.630-446-77!0,inlo.ci-vision@ml.com,
www.us.ml.com
Microscan Systems Inc
700 SW 39th St, Renton, WA 98057,
425-226-5700, FAX:425-226-8250,
info@microscan.com,
www.microscan.com, emp150, 1982
Develops barcode and machine-vision
products that help manufacturers reduce
costs, increase yields, improve product
quality, and comply with industry regulations.
Designed for precision applications, the line
of barcode readers, machine-vision systems,
and machine-vision lighting is backed by one
of the worlds most robust patent portfolios.
(see ad p 7)
Microscan Technology Center
486AmherslSl,Nashua,NH03063,
603-598-8400,inlo@microscan.com,
www.microscan.com,emp!50,!982
Microstar Laboratories Inc
2265!!6lhAveNL,8ellevue,WA98004,
425-453-2345,lAX.425-453-3!99,
inlo@mslarlabs.com,www.mslarlabs.com,!982
Midwest Optical Systems Inc
322WoodworkLn,Palaline,lL60067,
847-359-3550,lAX.847-359-3567,
inlo@midopl.com,www.midopl.com,emp!2,
!988
Mightex Systems
2343 Brimley Rd, Suite 868, Toronto, ON
M1S 3L6, Canada, 416-840-4991,
FAX:416-840-6541, mli@mightex.com,
www.mightex.com
Supplies photonic products and services for
a broad spectrum of applications including
industrial imaging, biophotonic solutions,
LED illumination, machine vision, life and
health sciences, and industrial test and
measurement.
(see ad p 12)
Mikrotron GmbH
Landshuter Str 20-22, Unterschleissheim
D-85716 Germany, 49-89-72-63-42-00,
FAX:49-89-72-63-42-99,
info@mikrotron.de, www.mikrotron.de,
emp30, 1977
Manufactures high-speed cameras and
machine-vision components for industrial
and technical applications. Develops,
manufactures, and distributes a range of
machine-vision domain. Provides cameras,
frame grabbers, software, and additional
equipment from one source.
Mosaic Engineering Inc
2!0WHamillonAve,Suile290,SlaleCollege,PA
!680!,8!4-359-6290,
conlacl@mosaicengineering.com,
www.mosaicengineering.com,emp9,!997
Motion X Corp
!39AeroCamino,Sanla8arbara,CA93!!7,
805-968-200!,lAX.805-968-2007,
jvandyke@molionx.org,www.molionx.org,emp6,
2002
moviMED
!5540Pockleld8lvd,SuileC-!!0,lrvine,CA
926!8,949-699-6600,lAX.949-699-660!,
inlo@movimed.com,www.movimed.com,emp7,
!999
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 55 55
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Optics for Hire
Moxa Americas Inc
60!ValenciaSl,Suile!00,8rea,CA92823-6357,
7!4-528-6777,lAX.7!4-528-6778,
usa@moxa.com,www.moxa.com,!987
msiVision
(subolMeasuremenlSolulionslnlernalionallnc),
!65lreemans8ridgePd,Suile200,Scolia,NY
!2302-35!!,5!8-346-7!36,lAX.5!8-346-4!34,
inlo@msivision.com,www.msivision.com,!989
MTD GmbH
LLDandLine-LighlDiv,8ahnholslr24,Ullng
D-82449Cermany,49-8846-9!40-9!,
lAX.49-8846-9!40-92,inlo@mld-gmbh.de,
www.mld-gmbh.de,2000
MultiPix Imaging Ltd
LnlerpriseHouse,!PidgewayOllcePk,8edlord
Pd,Pelersleld,HampshireCU323QlUK,
44-!730-233-332,lAX.44-!730-23!-062,
www.mullipix.com,emp!2,!997
Multisorb Technologies Inc
325HarlemPd,8ullalo,NY!4224,
7!6-824-8900,lAX.7!6-824-4!28,
inlo@mullisorb.com,www.mullisorb.com,
emp600,!96!
Munro Design & Technologies LLC
PO8ox!377,Websler,NY!4580,585-503-5!80,
jlmunro@munrodandl.com,
www.munrodandl.com,emp4,2003
MVTec Software GmbH
Neherslr!,MunichD-8!675Cermany,
49-89-4576-950,lAX.49-89-4576-9555,
inlo@mvlec.com,www.mvlec.com
Myutron Inc
3-3!-!4Nishikoiwa,Ldogawa-Ku,Tokyo
!33-0057Japan,8!-3-56!2-!884,
lAX.8!-3-56!2-!890,opl@myulroncom,
www.myulron.com,emp30,200!
National Instruments
!!500NMopacLxpwy,8ldg8,Auslin,TX
78759-3504,5!2-683-58!3,www.ni.com
Navitar Inc
200CommerceDr,Pochesler,NY!4623,
585-359-4000,lAX.585-359-4999,
inlo@navilar.com,www.navilar.com,emp50,
!972
Nello Zuech Associates
!28!CambriaPd,Weslminsler,MD2!!57,
4!0-75!-282!,vsii@aol.com,
www.vision!.com/vsi,emp!,2008
NET New Electronic Technology
GmbH
Lerchenberg7,linningD-86923Cermany,
49-8806-9234-0,lAX.49-8806-9234-77,
inlo@nel-gmbh.com,www.nel-gmbh.com,
emp50,!996
Neurotech Pte Ltd
379!Jalan8ukilMerah,6-!0,L-Cenlre!5947!
Singapore,65-6272-2766,lAX.65-6272-9577,
sales@neurolech.com.sg,www.neurolech.com.sg,
emp!0,!992
New England Optical Systems Inc -
NEOS
237CedarHillSl,Marlborough,MA0!752,
508-460-00!9,sales@neos-inc.com,
www.neoplicalsyslems.com,2008
New Imaging Technologies (NIT)
!-4lmpassedelanoiselle,8alD-!erelage,
Verrieresle8uisson9!370lrance,
33-!-64-47-88-58,
inlo@new-imaging-lechnologies.com,
www.new-imaging-lechnologies.com,!99!
Nitin Bearings
lnduslrialAulomalionDiv,!35/283Thambu
ChellySl,Chennai,TamilNadu60000!lndia,
9!-44-23456363,lAX.9!-44-23456363,
sales@nilinbearings.in,www.nilinbearings.in,
emp7,!986
NorPix Inc
!75!PichardsonSl,Suile6!!7,Monlreal,QC
H3K!C6,Canada,5!4-846-0009,
lAX.5!4-846-0!!7,sales@norpix.com,
www.norpix.com
NuLasers Ltd
7aShazarSlr,PO8ox59,Mazkerel8alia76804
lsrael,972-8-934-0764,lAX.972-8-934-9637,
sales@nulasers.com,www.nulasers.com,2005
Numetrix Technologies
906KingSlW,Suile20!,Sherbrooke,QC
J!H!S2,Canada,8!9-943-3422,
inlo@numelrix.ca,www.numelrix.ca,2007
Nuvu Cameras Inc
5!55aveDecelles,PavillionJA8ombardier,
Monlreal,QCH3T28!,Canada,5!4-733-8666,
www.nuvucameras.com,20!0
Ocean Thin Films
80608ryanDairyPd,Largo,lL33777,
727-545-074!,lAX.727-544-224!,
inlo@oceanlhinllms.com,
www.oceanlhinllms.com,emp200,!998
odos imaging Ltd
ScollishMicroeleclronicsCenlre,WMainsPd,
LdinburghLH93JlUK,44-!3!-650-7756,
inlo@odos-imaging.com,www.odos-imaging.com,
emp5,20!0
Ofl - Corona Detection Systems
!6LinsleinSl,PO8ox40!6,NesZiona74!40
lsrael,972-8-9407-953,lAX.888-950-5557(US),
oll@ollsyslems.com,www.ollsyslems.com,!993
Olympus Industrial
SlockPd,SoulhendonSea,LssexSS25QHUK,
44-!702-6!6-333,lAX.44-!702-465-677,
induslrial@olympus.co.uk,www.olympus-ims.com
Olympus NDT
48WoerdAve,Wallham,MA02453,
78!-4!9-3900,lAX.78!-4!9-3980,
inlo@olympusndl.com,www.olympusndl.com
Omron Automation and Safety
!CommerceDr,Schaumburg,lL60!73,
847-843-7900,lAX.847-843-826!,
inlo@omron.com,www.omron247.com,
emp35992,!973
ON Semiconductor Belgium BVBA
ClSP-lmageSensors,Schalienhoevedreel208,
Mechelen28008elgium,32-!5-446333,
lAX.32-!5-446344,kris.coslers@onsemi.com,
www.onsemi.com/imagesensors
Operations Technology Inc
30LamberlPd,PO8ox408,8lairslown,NJ
07825,908-362-6200,lAX.908-362-5966,
inlo@oplek.nel,www.oplek.nel,emp26,!978
Opticad Corp
5!!JuniperDr,Sanlale,NM8750!,
505-995-!999,lAX.208-567-5425,
supporl@oplicad.com,www.oplicad.com,emp3,
!986
Optical Gaging Products (OGP)
(divolQualilyVisionlnlernalionallnc),850
HudsonAve,Pochesler,NY!462!,585-544-0400,
lAX.585-544-8092,inlo@ogpnel.com,
www.ogpnel.com,emp200,!945
Optics Balzers AG
Neugruel35,8alzersLl-9496Liechlenslein,
423-388-9200,lAX.423-388-9390,
inlo@oplicsbalzers.com,www.oplicsbalzers.com,
emp!60,2009
Optics Balzers Jena GmbH
(divolOplics8alzersAC),Carl-Zeiss-Promenade
!0,Jena07745Cermany,49-364!-3529-30,
lAX.49-364!-3529-35,inlo@oplicsbalzers.com,
www.oplicsbalzers.com
Optics for Hire
455MassachusellsAve,Suile!,Arlinglon,MA
02474,78!-583-78!0,lAX.78!-583-78!2,
inlo@oplicslorhire.com,www.oplicslorhire.com,
emp20,2002
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 56 56
Optikos Corp
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Optikos Corp
!07AudubonPd,8ldg3,Wakeleld,MA0!880,
6!7-354-7557,lAX.6!7-354-5946,
sales@oplikos.com,www.oplikos.com,emp40,
!982
OPTIS
8P275,ZLLalarlede,Toulon83078lrance,
33-4-94-08-66-90,lAX.33-4-94-08-66-94,
webmasler@oplis-world.com,
www.oplis-world.com,emp!!0,!989
Opto Diode Corp
(memberollhelTWPholonicsCroup),
750MilchellPd,NewburyPark,CA9!320,
805-499-0335,lAX.805-499-8!08,
sales@oplodiode.com,www.oplodiode.com,
emp25,!98!
Opto Engineering
ViaCremona29/2,Manlova46!00llaly,
39-03-762-63525,lAX.39-03-762-62432,
inlo@oplo-engineering.com,
www.oplo-engineering.com,emp!8,2002
OptoMotive Mechatronics Ltd
VMurglah229,LjubljanaSl-!000Slovenia,
386-!-429-29-!4,inlo@oplomolive.si,
www.oplomolive.com,2008
OptoNova AB
SolnaSlrandvag3,SolnaSL-!7!54Sweden,
46-8705-2500,lAX.46-8705-250!,
inlo@oplonova.se,www.oplonova.se,emp28,
2000
OptoSigma Corp
(subolSigmaKokiJapan),32!0SCroddyWay,
SanlaAna,CA92705,949-85!-588!,
lAX.949-85!-5058,sales@oplosigma.com,
www.oplosigma.com,emp23,!995
Opto GmbH
Lochhamer Schlag 14, Grfelfng, Bavaria
D-82166 Germany, 49-89-898055-0,
FAX:49-89-898055-18, info@opto.de,
www.opto.de, emp35, 1980
Develops and manufactures optomechatronic
modules, components, and systems. Delivers
plug-and-play solutions ranging from single
vision components all the way to complex
imaging systems. In-house manufacturing
capability meets any production demand
from rapid single unit prototyping to serial
production.
(see ad p 24)
Opto System Co Ltd
!00Nogami,Miyamaki,Kyolo6!0-03!3Japan,
8!-774-68-4440,lAX.8!-774-68-4444,
oplwesl@gold.ocn.ne.jp,www.oplo-syslem.co.jp,
emp!50,!976
Optris GmbH
lerdinand-8uisson-Slr!4,8erlinD-!3!27
Cermany,49-30-500!970,lAX.49-30-500!97!0,
sales@oplris.com,www.oplris.com
Optronics
!75CremonaDr,Colela,CA93!!7,
805-968-3568,lAX.805-968-0933,
rcrandall@oplronics.com,www.oplronics.com,
emp240,!984
Optronis GmbH
Honsellslr8,KehlD-77694Cermany,
49-785!-9!260,lAX.49-785!-9!26!0,
inlo@oplronis.com,www.oplronis.com,emp!6,
2000
Orion Automation Ltd
2HighSl,AlconburyWeslon,Hunlingdon,Cambs
PL284JPUK,44-!480-89!-80!,
lAX.44-87!7-!42-!30,
sales@orionaulomalion.co.uk,
www.orionaulomalion.co.uk,emp2,2007
Orled
73!3SWTechCenlerDr,Porlland,OP97223,
503-968-!375,lAX.503-684-8!64,
sales@orled.com,www.orled.com,emp29,!982
Orus Integration Inc
(subolACTinc),!!09Auloroule!3,Laval,QC
H7W5J8,Canada,450-688-3!5!,
lAX.5!4-22!-2046,louis.dicaire@agl-group.com,
www.orusinlegralion.com,emp20,2000
OSRAM Opto Semiconductors
OploeleclronicsDiv,!!50KilerPd,Suile!00,
Sunnyvale,CA94086,408-962-3782,
lAX.408-738-9!26,inlo@osram-os.com,
www.osram-os.com,!977
Pacer International
!9-20KinglsherCl,HambridgePd,Newbury,
8erkshirePC!45SJUK,44-!!8-984-5280,
lAX.44-!!8-984-5425,inlo@pacer.co.uk,
www.pacer.co.uk,emp35
Para Tech Coating Inc
35ArgonaulCir,AlisoViejo,CA92656,
949-855-80!0,lAX.949-855-8993,
inlo@parylene.com,www.parylene.com,!968
PaR Systems Inc
707CounlyPdLW,Shoreview,MN55!26-7007,
65!-484-726!,lAX.65!-483-2689,
inlo@par.com,www.par.com,emp474,!96!
PC Industries
(divolPanels&ConlrolsCorp),!76AmbrogioDr,
Curnee,lL6003!,847-336-3300,
lAX.847-336-3232,sales@pcinduslries.com,
www.pcinduslries.com,emp35,!975
PCO AG
Donaupark!!,KelheimD-93309Cermany,
49-944!-2005-0,lAX.49-944!-2005-20,
sales@pco.de,www.pco.de,emp70,!987
Pembroke Instruments LLC
!20SlanlordHeighlsAve,Sanlrancisco,CA
94!27,4!5-860-42!7,lAX.4!5-585-0652,
sales@pembrokeinslrumenls.com,
www.pembrokeinslrumenls.com,emp!0,2008
PENTAX, A Richo Co
600!2lhSl,Suile300,Colden,CO8040!,
303-799-8000,lAX.303-728-0226,
lrank.abram@prac.penlax.com,
www.penlaxcclvus.com,emp5300,!9!5
Pepperl+Fuchs Inc
!600LnlerprisePkwy,Twinsburg,OH44087,
269-823-4650,lAX.330-405-47!0,
vml-inlo@us.pepperl-luchs.com,
www.pepperl-luchs.us,!948
Performance Automation Inc
55WTechneCenlerDr,Suile8,Millord,OH
45!50,5!3-697-2728,lAX.866-573-8507,
llelch@pavision.nel,www.pavision.nel,emp8,
2005
PG&O - Precision Glass & Optics
3600WMooreAve,SanlaAna,CA92704,
7!4-540-0!26,lAX.7!4-540-!482,
inlo@pgo.com,www.pgo.com,emp48,!985
Phase 1 Technology Corp
44YJelryn8lvd,DeerPark,NY!!729,
800-683-0068,lAX.63!-254-2693,
inlo@phase!lech.com,www.phase!lech.com,
!986
Phoenix Contact
PO8ox4!00,Harrisburg,PA!7!!!,
800-888-7388,lAX.7!7-944-!625,
inlo@phoenixcon.com,www.phoenixconlacl.com,
emp600,!98!
Phoenix Imaging Machine Vision
!9045larminglonPd,Livonia,Ml48!52,
248-476-4200,lAX.248-476-5705,
piinlo@phoeniximaging.com,
www.phoeniximaging.com,emp20,!985
Photon Etc
5795avCaspe,#222,Monlreal,QCH2S2X3,
Canada,5!4-385-9555,inlo@pholonelc.com,
www.pholonelc.com,emp2!,2002
Photonex/UK Vision Exhibitions
(divolXmarkMediaLld),OldVillageHall,The
Slreel,Lllngham,SurreyKT245JSUK,
44-!372-750-555,inlo@pholonex.org,
www.pholonex.org,emp4,!984
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 57 57
QinetiQ North America
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Photonic Science and Defence Vision
Systems
Place8ievreToulesAures,8alimenlAmelia
Larharl,SlLliennedeSlCeoirs38590lrance,
33-4-76-93-57-20,lAX.33-4-76-93-57-22,
inlo@pholonic-science.com,
www.pholonic-science.co.uk,emp30,!985
Photron Inc
9520PadgellSl,Suile!!0,SanDiego,CA92!26,
858-684-3555,lAX.858-684-3558,
image@pholron.com,www.pholron.com,emp7,
2000
Phrontier Technologies LLC
26471 Rancho Pkwy S, Suite A, Lake
Forest, CA 92630, 866-389-2829,
FAX:801-998-1855,
info@phrontier-tech.com,
www.phrontier-tech.com, 2003
Develops, manufactures, and sells image
transmission equipment for high-speed,
high-resolution applications. Products include
Camera Link repeaters, splitters, multiplexers,
and 2 x 2 switches.
(see ad p 39)
PHYTEC America LLC
203ParlllWaySW,8ainbridgelsland,WA98!!0,
206-780-9047,lAX.206-780-9!35,
inlo@phylec.com,www.phylec.com,emp!80,
!986
PHYTEC Messtechnik GmbH
Poberl-Koch-Slr39,MainzD-55!29Cermany,
49-6!3!-922!-0,lAX.49-6!3!-922!-33,
inlo@phylec.de,www.phylec.de,emp!80,!986
PixeLINK
!900CilyPkDr,Suile4!0,Ollawa,ONK!J!A3,
Canada,6!3-247-!2!!,lAX.6!3-247-200!,
sales@pixelink.com,www.pixelink.com,emp!4,
!992
Plasma JSC
24TsiolkovskySlr,Pyazan390023Pussian
lederalion,7-49!2-24-90-62,
lAX.7-49!2-44-06-8!,sales@plasmalabs.com,
www.plasmalabs.com,emp!000,!959
Pleora Technologies Inc
359TerryloxDr,Suile230,Kanala,ONK2K2L7,
Canada,6!3-270-0625,lAX.6!3-270-!425,
inlo@pleora.com,www.pleora.com,emp45,
2000
POG Praezisionsoptik Gera
CewerbeparkKeplerslr35,CeraD-07549
Cermany,49-365-77393-0,
lAX.49-365-77393-29,inlo@pog.eu,
www.pog.eu,emp!20,!99!
Point Grey
12051 Riverside Way, Richmond, BC
V6W 1K7, Canada, 604-242-9937,
FAX:604-242-9938, sales@ptgrey.com,
www.ptgrey.com, emp165, 1997
Designs and manufactures innovative,
high-performance digital cameras
for industrial, life science, and traffc
applications. Offers a unique and
comprehensive portfolio of USB 3.0, GigE,
FireWire, USB 2.0 and Camera Link products
known for outstanding quality, ease of use,
and unbeatable price-performance.
(see ad p 15)
Polytec GmbH
Polylec-Plalz!-7,WaldbronnD-76337Cermany,
49-7243-6040,lAX.49-7243-69944,
inlo@polylec.de,www.polylec.com,emp380,
!967
PPT Vision Canada Inc
!!-330CageAve,Kilchener,ONN2M5C6,
Canada,5!9-886-5442,lAX.5!9-884-36!!,
inlo@pplvisioncanada.com,
www.pplvisioncanada.com,emp5,2007
Praxis Optics
!!!27JordanAveNL,Albuquerque,NM87!22,
505-239-9095,oplalix@praxis-oplics.com,
www.praxis-oplics.com,2003
PR Consultants BV
Prinlerweg!8,Amersloorl382!AD
TheNelherlands,3!-33-450-40!0,
lAX.3!-33-455-5024,
supporl@pre-suslainabilily.com,
www.pre-suslainabilily.com,!990
Pressco Technology Inc
29200AuroraPd,Cleveland,OH44!39,
440-498-2600,lAX.440-498-26!5,
sales@pressco.com,www.pressco.com,emp!40,
!982
Princeton Instruments
(subolPoperlnduslries),3660QuakerbridgePd,
Trenlon,NJ086!9,609-587-9797,
lAX.609-587-!970,
inlo@princeloninslrumenls.com,
www.princeloninslrumenls.com,emp!70
Princeton Lightwave Inc
2555USPl!30S,Suile!,Cranbury,NJ085!2,
609-495-2600,lAX.609-395-9!!3,
sales@princelonlighlwave.com,
www.princelonlighlwave.com,2000
Printed Circuits Inc
!200W96lhSl,Minneapolis,MN5543!-2699,
952-888-7900,lAX.952-888-27!9,
bburns@prinledcircuils.com,
www.prinledcircuils.com,emp45,!977
ProPhotonix
(formerly StockerYale), 32 Hampshire Rd,
Salem, NH 03079, 603-893-8778,
sales@prophotonix.com,
www.prophotonix.com, emp100, 1951
Designs and manufactures chip-on-board LED
illumination products, machine-vision laser
modules and a range of laser assemblies
for industrial applications. Additionally,
distributes laser diodes manufactured by
Opnext, Sony, QSI and Ondax as well as
creates custom OEM solutions including
packaging, inspection and alignment,
high-speed scanning and sorting, and others.
Psychsoftpc
PO8ox232,Quincy,MA02!7!,6!7-47!-8733,
sales@psychsollpc.com,www.psychsollpc.com,
emp25,!987
Puffn Automation
6868WashinglonAveS,LdenPrairie,MN55344,
9520-20!-9!2!,lAX.952-224-3629,
www.pullnaulomalion.com,emp3,2007
Pyramid Imaging LLC
495!LAdamoDr,Suile224,Tampa,lL33605,
8!3-984-0!25,lAX.866-874-952!,
inlo@pyramidimaging.com,
www.pyramidimaging.com,emp7,200!
QImaging
(subolPoperlnduslries),!953556lhAve,Unil
!0!,Surrey,8CV3S6K3,Canada,604-530-5800,
lAX.604-539-!825,inlo@qimaging.com,
www.qimaging.com,emp!50,!999
QinetiQ North America
TechnologySolulionsCroupDiv,
7545MelropolilanDr,SanDiego,CA
92!08,32!-6!5-0!58,lAX.6!9-725-37!7,
lsginlo@qineliq-na.com,www.qineliq-na.com,
emp6400,2004
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 58 58
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Qioptiq
Qioptiq
78 Schulyer Baldwin Dr, Fairport, NY
14450, 585-223-2370, FAX:585-223-1999,
info@us.qioptiq.com, www.qioptiq.com,
emp2100, 2005
Offers specialized standard and custom
optical solutions for imaging integrators and
OEMs requiring high-quality components,
modules and assemblies. Provides
micro-imaging, zoom optics, objectives,
automation, high-resolution, large-format,
linescan, microscopes and camera
optimization.
(see ad p 27)
Qioptiq GmbH
lnduslrieslr!0,AsslarD-356!4Cermany,
49-644!-9896-0,lAX.49-644!-9896-33,
inlo@de.qiopliq.com,www.qiopliq.com,emp60,
!952
QUALIMATEST SA
CheminduPonl-du-Cenlenaire!09,Ceneva!228
Swilzerland,4!-22-884-0030,
lAX.4!-22-884-0040,inlo@qml.ch,
www.qml.ch,emp!6,!989
QualiVision AG
MachineVisionSyslemsDiv,(subol8aumer
Croup),Seeslr64,Oberrieden8942Swilzerland,
4!-43-500-5500,lAX.4!-43-500-550!,
qv@qualivision.ch,www.qualivision.ch,emp!0,
!998
RAM Optical Instrumentation
(divolQualilyVisionlnlernalionallnc),!!75
NorlhSl,Pochesler,NY!462!,585-758-!300,
lAX.585-506-4307,inlo@ramoplical.com,
www.ramoplical.com,!98!
Raptor Photonics Ltd
Willowbank8usinessPk,Larne,CoAnlrim
8T402SlUK,44-282-827-0!4!,
lAX.44-282-827-5685,
sales@raplorpholonics.com,
www.raplorpholonics.com,emp!!,2006
RAUSCHER GmbH
Johann-C-Culenberg-Slr20,OlchingD-82!40
Cermany,49-8!42-4484!-0,
lAX.49-8!42-4484!-90,inlo@rauscher.de,
www.rauscher.de,emp!3,!973
Recognition Robotics
294458eckPd,SuileA-!08,Wixom,Ml48393,
248-3!8-!746,inlo@recognilionrobolics.com,
www.recognilionrobolics.com,emp5,2007
Resolution Development Services
200-LlordhamPd,Wilminglon,MA0!887,
978-203-4820,sales@resoluliondev.com,
www.resoluliondev.com
Resolution Technology Inc
5990WilcoxPl,Suile8,Dublin,OH430!6,
6!4-79!-0045,lAX.6!4-79!-0046,
visionsyslems@reslechimage.com,
www.reslechimage.com,emp5,!987
Resonon Inc
6!9NChurchAve,Suile3,8ozeman,MT597!5,
406-586-3356,lAX.406-586-3357,
inquiry@resonon.com,www.resonon.com,emp6,
2002
RMA Electronics Inc
35PondPkPd,Unil!2,Hingham,MA02043,
78!-749-9700,lAX.78!-749-9707,
inlo@rmaeleclronics.com,
www.rmaeleclronics.com,emp5,!986
Saber1 Technologies LLC
225SledmanSl,8ldg!5,Lowell,MA0!85!,
978-244-0490,lAX.978-244-049!,
inlo@saber!.com,www.saber!.com,emp5,2000
SAC Sirius Advanced Cybernetics
GmbH
AmSandleld!5,PO8ox3!!!40,Karlsruhe
D-76!49Cermany,49-72!-60-543-000,
lAX.49-72!-60-543-200,sales@sac-vision.com,
www.sac-vision.nel,emp30,!996
Santa Barbara Imaging
396SSanMarcosPd,Sanla8arbara,CA93!!!,
805-729-0422,sales@sanlabarbaraimaging.com,
www.sanlabarbaraimaging.com,2005
Sav Network
Vision&LighlDepl,4ruedesClycines,8ron
l-69500lrance,33-4-72-48-37-48,
lAX.33-4-72-48-37-49,
lighling@savnelwork.com,www.savnelwork.com,
emp!0,2004
SCANLAB AG
Siemensslr2a,PuchheimD-82!78Cermany,
49-89-800-746-0,lAX.49-89-800-746-!99,
inlo@scanlab.de,www.scanlab.de,emp!50,
!990
SCANLAB America Inc
(divolSCANLA8AC),!00lllinoisSl,Suile200,
SlCharles,lL60!74,
630-797-2044,lAX.630-797-200!,
d.sabo@scanlab-america.com,
www.scanlab-america.com,2003
Schaefter+Kirchhoff GmbH
KielerSlr2!2,Hamburg22525Cermany,
49-40-853997-0,lAX.49-40-853997-79,
inlo@sukhamburg.de,www.sukhamburg.de,
emp30,!99!
Dr Heinrich Schneider Messtechnik
GmbH
PO8ox246!,8adKreuznach,
Phineland-Palalinale555!3Cermany,
49-67!-29!-02,lAX.49-67!-29!-200,
inlo@dr-schneider.de,www.dr-schneider.de,
emp70,!947
Schurter Inc
447Avialion8lvd,SanlaPosa,CA95403,
707-636-3000,lAX.707-636-3033,
inlo@schurlerinc.com,www.schurlerinc.com,
emp2!,!982
Seidenader Maschinenbau GmbH
Lilienlhalslr8,MarklSchwabenD-85570
Cermany,49-8!2!-802-0,lAX.49-8!2!-802-!00,
inlo@seidenader.de,www.seidenader.de,
emp370,!895
SensoPart Industriesensorik GmbH
Nagelsees!6,CollenheimD-79288Cermany,
49-7665-94769-0,lAX.49-7665-94769-765,
inlo@sensoparl.de,www.sensoparl.com,!994
Sensoray Co Inc
7313 SW Tech Center Dr, Tigard, OR 97223,
503-684-8005, FAX:503-684-8164,
sales@sensoray.com, www.sensoray.com,
emp25, 1979
Specializes in the development of OEM
embedded electronics for industrial, medical
and security applications including video
capture, data acquisition and machine control
for platforms such as Ethernet, USB, PC/104,
and PCI/PCI Express.
(see ad p 35)
Sensor to Image GmbH
Lechlorslr20,Schongau,8avaria86956Cermany,
49-886!-2369-0,lAX.49-886!-2369-69,
email@sensor-lo-image.de,
www.sensor-lo-image.de,emp!!,!989
Sensor Technologies America Inc
!345ValwoodPkwy,Suile320,Carrolllon,TX
75006,972-48!-9223,lAX.972-48!-9209,
lomcampbell@senlechamerica.com,
www.senlechamerica.com
______________
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 59 59
Tapeswitch Corp
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Servo-Robot Inc
!370Hocquarl,Sl-8runo,QCJ3V6L!,Canada,
450-653-7868,lAX.450-653-7869,
sales@servorobol.com,www.servorobol.com,
emp80,!983
Shanghai Kingtek Co Ltd
4CKaiyang8ldg,788DingXiPd,Shanghai
200052China,86-2!-6!!694!!,
lAX.86-2!-6!!69222,xialin@kinglek.nel,
www.kinglek.nel,emp20,2000
Shenzhen Top Technology Co Ltd
8ldg5,!0TongluyulnduslrialZone,Heping,
luyongTown,8aoanDislricl,Shenzhen,
Cuangdong5!8!03China,86-755-27696332,
lAX.86-755-27697383,evila@ledlop!68.com,
www.ledlop!68.com,emp400,2005
Shimadzu Scientifc Instruments
7!02PiverwoodDr,Columbia,MD2!046,
4!0-38!-!227,lAX.4!0-38!-!222,
webmasler@shimadzu.com,
www.ssi.shimadzu.com
Sierra Olympic Technologies Inc
(SOTI)
3!00CascadeAve,HoodPiver,OP9703!,
425-445-8884,lAX.54!-387-0443,
chris@sierraolympic.com,www.sierraolympic.com
Silicon Software GmbH
Sleubenslr46,MannheimD-68!63Cermany,
49-62!-789-507-0,lAX.49-62!-789-507-!0,
inlo@silicon-sollware.de,
www.silicon-sollware.com,emp27,!997
Smartray GmbH
8gm-linslerwalder-Ping!2,Wollralshausen,
8avariaD-825!5Cermany,49-8!7!-9683-400,
lAX.49-8!7!-9683-40!,inlo@smarlray.de,
www.smarlray.de,emp38,2005
Sofradir EC Inc
(subolSolradir),373USHwy46,lairleld,NJ
07004,973-882-02!!,lAX.973-882-0997,
inlo@solradir-ec.com,www.solradir-ec.com,
emp40,!969
SOFTHARD Technology Ltd
Lesna52,Marianka90033SlovakPepublic,
42!-2-6545-9327,lAX.42!-2-6545-9329,
inlo@sollhard.com,www.sollhard.com,emp!5
Soliton Technologies Pvt Ltd
683!5lhCrossPd,JPNagar2ndPhase,8angalore
560078lndia,9!-80-4!208600,
lAX.9!-80-4!208700,vision@solilonlech.com,
www.solilonlech.com,emp80,!998
Sony Electronics Inc
!SonyDr,ParkPidge,NJ07656,20!-930-7000,
lAX.20!-358-440!,sony.cameras@am.sony.com,
www.sony.com/videocameras
Sony Europe Ltd,
Zweigniederlassung Deutschland
lmageSensingSolulionsDiv,KemperPlalz!,
8erlinD-!0785Cermany,
49-44!-594-7805,lAX.49-44!-594-7887,
michael.pisch@eu.sony.com,
www.pro.sony.eu/vision,emp500
Special Application Products Ltd
Manorlarm8usinessCenlre,ManorLn,Unil5,
Slullon,Sullolk,lpswichlP92TDUK,
44-!473-327-732,lAX.44-870!-400-!63,
sales@saplld.co.uk,www.saplld.co.uk,emp5,
!992
SPECIM Spectral Imaging Ltd
Teknologianlie!8A,PO8ox!!0,Oulu90590
linland,358-!0-4244-400,lAX.358-8-388-580,
inlo@specim.l,www.specim.l,emp37,!995
Spectrum Illumination
5!!4lnduslrialPkPd,Monlague,Ml49437,
23!-894-4590,lAX.23!-894-4582,
sales@speclrumilluminalion.com,
www.speclrumilluminalion.com,emp8,!999
SphereOptics GmbH
8ergslr36,Uhldingen88690Cermany,
49-7556-9299-666,lAX.49-7556-50!08,
inlo@sphereoplics.de,www.sphereoplics.de,
emp!0,2003
SPO Inc
8!27MigunTechnoworldll533-!,Yongsan-dong
Yuseong-gu,Daejeon305-500Korea,
82-42-673-4400,lAX.82-42-673-4466,
spoinc@spoplics.com,www.spoplics.com
SPOT Imaging Solutions
(divolDiagnosliclnslrumenlslnc),6540
8urroughsSl,SlerlingHeighls,Ml483!4-2!33,
586-73!-6000,lAX.586-73!-6469,
inlo@diaginc.com,www.spolimaging.com,
emp50,!969
S-Products Inc
!4!KingsHwyL,lairleld,CT06825,
203-33!-9546,lAX.203-335-2723,
s-producls@usa.nel,www.s-producls.com,
emp!4,!989
Stanford Photonics Inc
!032LlwellCl,Suile!04,PaloAllo,CA94303,
650-969-599!,lAX.650-969-5993,
inlo@slanlordpholonics.com,
www.slanlordpholonics.com,emp7,!989
STEMMER IMAGING
Gutenbergstr 9-13, Puchheim D-82178
Germany, 49-89-80902-0,
FAX:49-89-80902-116,
info@stemmer-imaging.de,
www.stemmer-imaging.de, emp180,
1987
Provides imaging technology with
subsidiaries in Germany (Puchheim near
Munich), United Kingdom (Tongham near
London), France (Suresnes near Paris),
Switzerland (Pfffkon near Zurich) and The
Netherlands (Gorssel near Deventer).
(see ad p 17)
ST Robotics
!03CarnegieClr,Suile300,Princelon,NJ08540,
609-584-7522,sales!@slrobolics.com,
www.slrobolics.com
Sundance Multiprocessor Technology
Ltd
ChillrenHouseWalerside,Chesham,8ucks
HP5!PSUK,44-!494-793-!67,
lAX.44-!494-793-!68,sales@sundance.com,
www.sundance.com,emp!5,!989
Sutter Instrument
1 Digital Dr, Novato, CA 94949,
415-883-0128, FAX:415-883-0572,
alex@sutter.com, www.sutter.com,
emp75, 1974
Manufactures precision electromechanical
devices for scientifc research and industrial
OEM. Imaging products include motorized
optical flter wheels for wavelength
switching, xenon light source, stepper motor
controlled SmartShutter, and motorized X-Y
translator.
(see ad p 22)
Takenaka System Co Ltd
86-66Nomizo-choOlsukaYamashina-ku,Kyolo
607-8!35Japan,8!-75-593-9300,
lAX.8!-75-593-9790,sales@lakex-syslem.co.jp,
www.lakex-syslem.co.jp,emp30,!975
Tapeswitch Corp
!00Schmill8lvd,larmingdale,NY!!735,
800-234-8273,lAX.63!-630-0454,
markeling@lapeswilch.com,
www.lapeswilch.com,emp!00
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 60 60
Tattile Srl
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
Tattile Srl
viaCaelanoDonizelli!-3-5,Mairano,8rescia
25030llaly,39-030-97000,lAX.39-030-9700!,
sales@lallile.com,www.lallile.com
Technical Cable Concepts Inc
350LearAve,CoslaMesa,CA92626,
7!4-835-!08!,lAX.7!4-835-!595,
sales@lechcable.com,www.lechcable.com,
emp60,!989
Tecscan Electronics Ltd
Unils!0-!!,SlDavidslndLsl,Pengam,
8lackwood,CwenlNP!23SWUK,
44-!443-82!-552,lAX.44-!443-875-569,
sales@lecscan.co.uk,www.lecscan.co.uk,emp!!,
!986
Tectivity Inc
3099TallTimbers,Millord,Ml48380,
248-676-9797,lAX.248-676-9796,
inlo@leclivily.com,www.leclivily.com,!992
Teledyne DALSA
605 McMurray Rd, Waterloo, ON N2V 2E9,
Canada, 519-886-6000, FAX:519-886-8023,
sales.americas@teledynedalsa.com,
www.teledynedalsa.com/mv, emp1000,
1980
Offers OEMs and system integrators a
selection of imaging products and capabilities
for machine vision from image sensors
through cameras, frame grabbers, vision
processors to software and vision appliances.
(see ad p 39, inside back cover)
Teledyne Imaging Sensors
(divolTeledyneScienlilc&lmagingLLC),
52!2VerdugoWay,Camarillo,CA930!2,
805-373-4877,lAX.805-373-4764,
rkoegle@leledyne.com,www.leledyne-si.com,
emp420
Teledyne Judson Technologies
22!CommerceDr,Monlgomeryville,PA!8936,
2!5-368-6900,lAX.2!5-362-6!07,
msediva@leledynejudson.com,
www.judsonlechnologies.com,emp65,!969
TeleEye Holdings Ltd
Unils202-3,2/l,LalordCenlre,838LaiChiKok
Pd,KowloonHongKong,852-29955900,
lAX.852-2995-590!,inlo@leleeye.com,
www.leleeye.com
Telops Inc
!00-2600Sl-Jean-8aplisleAve,Quebec,QC
C2L6J5,Canada,4!8-864-7808,
lAX.4!8-864-7843,conlacl@lelops.com,
www.lelops.com,emp42,2000
TEMTO Technology Co Ltd
28ldg,YangqiaoPk,!45YangqiaozhongPd,
Culou,luzhou,lujian350003China,
86-59!-8787-0640,lAX.86-59!-8787-064!,
sales@lemlo.com,www.lemlo.com,emp!!0,
2004
TESEO SpA
(divolCLLMLSSYCroup),CorsoAlessandro
lleming27,Druenlo!0040llaly,
39-0!!-994!-9!!,lAX.39-0!!-994!-900,
leseosyslems@leseo.nel,www.leseo.nel,emp4!,
!978
Thermo Scientifc - CIDTEC
(divolThermolisherScienlilc),!0!Commerce
8lvd,Liverpool,NY!3088-4507,
3!5-45!-94!0,lAX.3!5-45!-942!,
lony.chapman@lhermolsher.com,
www.lhermoscienlilc.com/cidlec,emp32000
Thinklogical
(subolLogicalSolulions),!00WashinglonSl,
Millord,CT06460,203-647-8700,
lAX.203-783-9949,sales@lhinklogical.com,
www.lhinklogical.com,!99!
Tichawa Vision GmbH
MachineVisionDiv,8urgwallslr!4,lriedberg
D-863!6Cermany,49-82!-45-55-53-0,
lAX.49-82!-45-55-53-20,inlo@lichawa.de,
www.lichawa-vision.com,emp!6,!99!
Tordivel AS
Slorgala20,OsloN-0!84Norway,47-23!5-8700,
lAX.47-23!5-870!,ollce@lordivel.no,
www.scorpionvision.com,emp!5,!992
Toshiba Imaging Systems Div
ToshibaAmericalnlormalionSyslemsDiv,(divol
ToshibaAmerica),9740lrvine8lvd,
lrvine,CA926!8,8!0-357-5022,
lAX.949-470-9390,gary.pilre@lais.loshiba.com,
www.loshibacameras.com,emp700,!965
Toshiba Teli Corp
4-7-!Asahigaoka,Hino,Tokyo!9!-0065Japan,
8!-42-589-877!,lAX.8!-42-589-8774,
leli_glb@loshiba-leli.co.jp,www.loshiba-leli.co.jp,
emp500,!940
TRICOR Systems Inc
!650ToddlarmDr,Llgin,lL60!23,
847-742-5542,lAX.847-742-5574,
sales@lricor-syslems.com,
www.lricor-syslems.com,emp46,!976
TruColor Vision Systems Inc
!603WhilesvilleSl,LaCrange,CA30240,
706-845-6970,lAX.706-845-6972,
sales@lcvs.com,www.lcvs.com,!992
Truesense Imaging Inc
!964LakeAve,Pochesler,NY!46!5,
585-784-5500,inlo@lruesenseimaging.com,
www.lruesenseimaging.com,20!!
TST Technological Solutions
LslradaValeDeMulalasLl!2,Selubal29!0-737
Porlugal,35!-265-545-!!6,
lAX.35!-265-545-!30,conlacl@lsl.pl,
www.lsl.pl,!995
TUSS Vision Inc
2-!5-!3Miyamachi,luchu,Tokyo!83-0023
Japan,8!-42-335-7724,lAX.8!-42-35-7734,
inlo@lussvision.com,www.lussvision.com,!984
TVI Vision
Asenlajankalu3,Helsinki00880linland,
358-207-579-5!8,lAX.358-207-579-5!9,
lvicameras@lvivision.com,www.lvivision.com,
!983
ULIS
(subolSolradir),8P27ZldesilesCordees,Veurey,
Voroize38!!3lrance,33-4-76-53-74-70,
lAX.33-4-76-53-74-80,ulis@ulis-ir.com,
www.ulis-ir.com,emp!!0,2002
Ultrafne Technology Ltd
!48rookLn8usinessCenlre,8rookLnN,
8renllord,MiddlesexTW8OPPUK,
44-20-8569-9920,lAX.44-20-8569-9649,
sales@ullralnelechnology.co.uk,
www.ullralnelechnology.co.uk,emp!0,!985
Unibrain Inc
2420 Camino Ramon, Suite 121,
San Ramon, CA 94583, 925-866-3000,
FAX:925-866-3520, sales@unibrain.com,
www.unibrain.com, emp25, 1990
Develops FireWire and USB 3.0 hardware
and software solutions for the industrial,
vision/imaging, and OEM markets. Flagship
products include development kits and
drivers for controlling industrial FireWire
cameras and devices and long connectivity
solutions.
(see ad p 39)
Unibrain SA (Europe/Asia)
!9KmMarkopoulouAve,Peania,Alhens!9002
Creece,30-2!0-6640600,lAX.30-2!0-6646508,
sales@unibrain.com,www.unibrain.com,emp25,
!990
______________
________________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 61 61
VISIONx Inc
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
unique vision GmbH
Kleine8ahnslr8,HamburgD-22525Cermany,
49-40-278648-50,lAX.49-40-278648-52,
inlo@unique-vision.nel,www.unique-vision.nel
Universal Robotics Inc
PO8ox!7!062,Nashville,TN372!7,
6!5-366-728!,sales@universalrobolics.com,
www.universalrobolics.com,2008
Universe Kogaku (America) Inc
116 Audrey Ave, Oyster Bay, NY 11771,
516-624-2444, FAX:516-624-3109,
info@ukaoptics.com,
www.ukaoptics.com, 1949
Manufactures lenses. Designs
precision-assembled optics, including
high-resolution, UV quartz, infrared,
CCD, CMOS, CCTV and diode laser lenses.
Standard and custom lens assemblies for
medical, industrial, electronic and high-tech
applications available.
(see ad p 39)
UTC Aerospace Systems (Sensors
Unlimited Products)
3490USPl!,8ldg!2,Princelon,NJ08540-59!4,
609-520-06!0,lAX.609-520-0638,
sui_sales@ulas.ulc.com,www.sensorsinc.com,
emp!!7,!99!
The Value Engineering Alliance
478PulnamAve,Suile2,Cambridge,MA
02!39-4772,6!7-492-!252,lAX.6!7-492-!252,
marcelvea@aol.com,www.lhe-v-e-a.com,!987
VectorBlox
!080MainlandSl,Suile4!9,Vancouver,8C
V682T4,Canada,604-566-9733,
inlo@veclorblox.com,www.veclorblox.com
Verifcation Systems Ltd
8asepoinl8usiness&lnnovalionCenlre,
CaxlonClose,LaslporlwaylndLsl,Andover,
HampshireSP!03lCUK,44-!264-326-309,
sales@visionassurancesyslems.com,
www.visionassurancesyslems.com,emp4,2006
Videomail Inc
3!30DeLaCruz8lvd,Suile!20,SanlaClara,CA
95054,408-492-!500,lAX.408-492-!400,
sales@videomail.com,www.videomail.com,!989
Video Scope International Ltd
!05LxeculiveDr,Suile!!0,Dulles,VA
20!66-9558,703-437-5534,
lAX.703-742-8947,inlo@videoscopeinll.com,
www.videoscopeinll.com,emp4,!985
VideoSet Ltd
!5KinerelSl,8nei-8rak5!20!lsrael,
972-3-6!7-6888,lAX.972-3-6!7-6868,
gad@videosel.com,www.videosel.co.il,emp!9,
!994
Viewbits
(divolCompulerModuleslnc),!!409W
8ernardoCl,SanDiego,CA92!27,
858-6!3-!8!8,lAX.858-6!3-!8!5,
inlo@viewbils.com,www.viewbils.com
VIEW Micro-Metrology
(subolQualilyVisionlnlernalionallnc),!7!!W
!7lhSl,Tempe,AZ8528!,480-295-3!50,
lAX.480-889-9059,inlo@viewmm.com,
www.viewmm.com,!976
Vieworks Co Ltd
462806, 6F Suntechcity 2, 307-2
Sangdaewon-dong, Jungwon-gu,
Seongnam-city, Gyeonggi-do 462-806
Korea, 585-627-1609 (US),
sales@visionsystech.com,
www.vieworks.com, emp102, 1999
Develops medical, industrial and scientifc
digital cameras and systems, precision optics,
and optomechanical designs. Industrial
cameras feature Camera Link and GigE Vision
12-bit digital output. Products have high
reliability with excellent image quality.
(see ad inside front cover)
Vincent Associates
803LindenAve,Pochesler,NY!4625,
585-385-5930,lAX.585-385-6004,
vincenlassociales@uniblilz.com,
www.uniblilz.com,emp42,!969
Vision Srl
ViaDeCasperi20,Arcore,M820862llaly,
39-039-60!-482!,lAX.39-039-60!-4822,
vision@visionsys.il,www.visionsys.il,emp6,!988
Vision Academy GmbH
Konrad-Zuse-Slr!5,LrlurlD-99099Cermany,
49-36!-4262!88,lAX.49-36!-4262!89,
www.vision-academy.org,200!
Vision & Control GmbH
Millelbergslr!6,Suhl,ThringenD-98527
Cermany,49-368!-7974-0,
lAX.49-368!-7974-33,sales@vision-conlrol.com,
www.vision-conlrol.com,emp45,!99!
Vision Automation A/S
Hammerbakken!6,8irkerodDK-3460Denmark,
45-45-825-825,lAX.45-45-825-826,
sales@visionaulomalion.dk,
www.visionaulomalion.dk,emp!0,!988
Vision Components
!0HedgerowDr,Hudson,NH0305!,
603-598-2588,elolh@vision-componenls.com,
www.vision-componenls.com,!996
Vision Components GmbH
Olloslr2,LlllingenD-76275Cermany,
49-7243-2!67-0,lAX.49-7243-2!67-!!,
sales@vision-componenls.com,
www.vision-componenls.com,emp!2,!996
Vision ICS Inc
793WinlerberryDraw,Woodbury,MN55!25,
65!-503-0496,jsalls@vision-ics.com,
www.vision-ics.com,emp!,2003
Vision Machines Inc
PO8ox447,8edlord,MA0!730,78!-275-2020,
lAX.78!-275-2028,inlo@vision-machines.com,
www.vision-machines.com,!998
VisionMOS International Inc
540WlronAve,!06,Mesa,AZ852!0,
480-730-7800,lAX.480-49!-0097,
sales@visionmos.com,www.visionmos.com,2004
Vision Projects - AB Controls
(subolA8Tech),SandersonSl,ShelleldS92UA
UK,44-!!4-244-2424,
vpleam@visionprojecls.co.uk,
www.visionprojecls.co.uk,emp!20,!980
Vision Research
(divolAmeleklnc),!00DeyPd,Wayne,NJ
07470,973-696-4500,lAX.973-696-0560,
phanlom@visionresearch.com,
www.visionresearch.com,emp98,!992
The Vision System Doctor LLC
(subolAulomalionDoclorlnc),!9!0LindenAve,
Mishawaka,lN46544,
574-344-7936,lAX.574-850-!!40,
david.wyall@visionsyslemdoclor.com,
www.visionsyslemdoclor.com,emp3,2009
Vision Systems Design
(divolPennWellCorp),98Spil8rookPdLL-!,
Nashua,NH03062-5737,603-89!-0!23,
lAX.603-89!-9328,susans@pennwell.com,
www.vision-syslems.com,!996
Vision Ventures GmbH & Co KG
PO Box 1148, Heppenheim 64629
Germany, 49-178-1755972,
info@vision-ventures.eu,
www.vision-ventures.eu
Operates as an advisory frm for mergers and
acquisitions with thorough industry insight
and years of experience in machine-vision
technologies and optical technologies,
working for sell side and buy side.
(see ad p 36)
VISIONx Inc
2!08runswick,Poinle-Claire,QCH9P!A6,
Canada,5!4-694-9290,lAX.5!4-694-9488,
www.visionxinc.com
______________
__________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 62 62
C
o
m
p
a
n
y

D
i
r
e
c
t
o
r
y
ViSiTool
ViSiTool
H-Poeger-Slr!4,MaulbronnD-75433Cermany,
49-70-43-900000,lAX.49-70-43-90000!,
inlo@visilool.de,www.visilool.de,emp8
Vivid Engineering
159 Memorial Dr, Suite F, Shrewsbury,
MA 01545, 508-842-0165,
FAX:508-842-8930,
info@vividengineering.com,
www.vividengineering.com, emp 5, 2003
Offers a range of supporting devices for
Camera Link applications including video
splitters, multiplexers, repeaters, LVDS and
RS-422 converters, camera simulators, and
debug breakout boxes. Products enable
the development of sophisticated imaging
systems without the need for costly custom
hardware. Also useful for testing, integration,
and debugging.
(see ad p 39)
VMI Inc
VisuallmagingDiv,2!!LWeddellDr,Sunnyvale,
CA94089,408-745-!700,lAX.408-745-672!,
visales@vmivideo.com,www.vi.vmivideo.com,
!975
Voltage Multipliers Inc
87!!WPoosevellAve,Visalia,CA9329!,
559-65!-!402,lAX.559-65!-0740,
kspano@vollagemullipliers.com,
www.vollagemullipliers.com,emp!95,!980
VRmagic GmbH
lmagingDiv,Auguslaanlage32,Mannheim68!65
Cermany,49-62!-4004!6-20,
lAX.49-62!-4004!6-99,
inlo.imaging@vrmagic.com,
www.vrmagic-imaging.com,emp50,200!
VST America Inc
(sub of VS Technology Corp),
2101 S Arlington Heights Rd, Suite 135,
Arlington Heights, IL 60005,
847-952-3800, FAX:847-952-3839,
info@vstamerica.com,
www.vstamerica.com, emp65, 1997
Sells a wide range of high-quality RoHS
compliant machine-vision lenses, accessories,
and lighting manufactured by VS Technology
Corp. Is ISO 14001 and 9001 certifed.
Wavelength Electronics Inc
5!LvergreenDr,8ozeman,MT597!5,
406-587-49!0,lAX.406-587-49!!,
sales@leamwavelenglh.com,
www.leamwavelenglh.com,!992
WAY-2C Color Machine Vision
!4SlevensTer,Arlinglon,MA02476,
78!-64!-0605,lAX.78!-648-5807,
sales@way2c.com,www.way2c.com,!989
Webview Inc
!3!SlonyCir,Suile500,SanlaPosa,CA9540!,
707-588-7982,lAX.707-588-7987,
sales@webspec.com,www.webspec.com,!994
West Coast Tech Ltd
!33TianquanPd,luzhou,lujian350003China,
86-59!-87303536,lAX.86-400-8875666
x456900,sales@weslcoasl-lech.cn,
www.weslcoasl-lech.cn,emp!00,2008
Westech Optical Corp
1387 Fairport Rd, Bldg 900H, Fairport, NY
14450, 585-377-2490, FAX:585-377-2543,
jcarlino@westechoptical.com,
www.westechoptical.com, 1996
Designs and produces stock and custom
precision optics for OEMs. Products include
singlets, achromats, windows, and lens
assemblies for all types of CCD imaging.
Applications include machine vision, laser
scanning, medical instruments, security and
surveillance.
(see ad p 39)
Xcitex Inc
25lirslSl,Suile!05,Cambridge,MA02!4!,
6!7-225-0080,lAX.6!7-225-2529,
sales@xcilex.com,www.xcilex.com,!997
Xenics
Ambachlenlaan44,Leuven8L-300!8elgium,
32-!6-38-99-00,lAX.32-!6-38-99-0!,
sales@xenics.com,www.xenics.com,emp75,
2000
XIMEA
Hansestr 81, Mnster, NRW 48165
Germany, 49-2501-964-555-59,
FAX:49-2501-964-555-99,
info@ximea.com, www.ximea.com,
emp30, 2010
Develops, manufactures and supplies USB3
vision cameras, smart cameras with PC inside,
integrated machine vision systems and CCD,
CMOS, USB, IEEE1394, and GigE cameras
for microscopy, scientifc and industrial
applications.
(see ad p 13)
Xiris Automation Inc
!0!6SullonDr,UnilC5,8urlinglon,ONL7L688,
Canada,905-33!-6660,lAX.905-33!-666!,
sales@xiris.com,www.xiris.com,emp25,!989
XL Imaging LLC
368MimosaDr,Pollsboro,TX75076,
2!4-334-6488,lAX.8!5-550-!893,
bruce@xlimaging.us,www.xlimaging.us,emp!,
2004
X-Scan Imaging Corp
708onavenluraDr,SanJose,CA95!34,
408-432-9888,lAX.408-432-9889,
sales@x-scanimaging.com,
www.x-scanimaging.com,emp!0,2006
Yaskawa Motoman Robotics
(divolYaskawaAmericalnc),!00Aulomalion
Way,Miamisburg,OH45342,937-847-6200,
lAX.937-847-3288,inlo@moloman.com,
www.moloman.com,emp480,!989
YNK Solution Co Ltd
4048/D,3AnyangTechnicalCollege,Anyang
3-dong,Anyang,Cyeonggi-do435-749Korea,
82-3!-342-2076,lAX.82-3!-342-2074,
ykimc@ynksolulion.com,www.ynksolulion.com,
emp!0,2007
Carl Zeiss AG
Carl-Zeiss-Slr22,OberkochenD-73446Cermany,
49-7364-20-5590,lAX.49-7364-20-4045,
lenses4induslry@zeiss.de,
www.zeiss.com/lenses4induslry,emp24,000,
!846
Z-LASER Optoelektronik GmbH
Merzhauser Str 134, Freiburg D-79100
Germany, 49-761-29644-44,
FAX:49-761-29644-55, info@z-laser.de,
www.z-laser.com, emp75, 1985
Provides innovative laser systems in
the sectors of vision, measurement
and positioning. The high-quality laser
sources/modules and projectors are always
adjusted to customers needs. Various
wavelengths, powers and projections
available.
(see ad p 23)
Zmation Inc
!48!!NLAirporlWay,Suile200,Porlland,OP
97230,503-253-887!,lAX.503-253-9068,
sales@zmalion.com,www.zmalion.com,emp9,
!994
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
w w w . v i s i o n - s y s t e m s . c o m VI S I ON S YS T E MS DE S I GN Ma r c h 2 0 1 3 63
#
3-DCameras 8
A
Analoglnpul/Oulpul8oards 34
AncillaryDevices 5
Applicalion-DevelopmenlSollware 28
Applicalion-SpecilcSollware 7
Area-ArrayCameras 8
AreaCCDSolid-SlaleSensors 33
AreaCMOSSensors 33
ASlCs 27
AulolocusOplics 30
AulomalionLquipmenl 8
Aulomalion/Pobolics 23
B
8acklighlingDevices 20
8arcodeScanners 33
8eamsplillers 30
8orescopes 30
C
CablesandConneclors 5
CameraandLighlingLnclosures 6
CameraandLighlingMounls 6
CameraDesiccanlsandMoldings 6
CameraLxlendersandPepealers 6
CameraLenses 27
CameraLink8oards 34
CameraLinkCameras 8
Cameras 8
CameraTeslLquipmenl 36
CCDCamerasColor !0
CCDCamerasCooled !2
CCTVCameras !2
CenlralProcessingUnils(CPUs) 34
Charge-lnjeclion-DeviceCameras !2
CMOSCameras !2
Color-AnalysisSollware 28
CommunicalionsConlrollers 27
D
Dala-Acquisilion8oards 34
Dala-AcquisilionSollware 28
Dala-AcquisilionToolkils 26
Deleclors,lnlrared 33
Deleclors,Visible 34
Deleclors,X-ray 34
DevelopmenlTools 26
DigilallmagingSyslems 23
Digilall/O8oards 35
Digilal-OulpulCameras !4
Digilal-Signal-ProcessingSollware 28
Digilal-SignalProcessor(DSP)Developmenl
Toolkils 26
Digilal-SignalProcessors(DSPs) 35
Digilizers 20
DisplayConlrollers 35
Displays 20
DisplayTeslLquipmenl 36
Documenl-lmagingSyslems 24
Drives 33
E
LmbeddedlPCAHardware 35
LmbeddedlPCASollware 28
Lnclosures 6
Lndoscopes 30
LnlargingLenses 27
F
liber-OplicllluminalionSyslems 2!
lillers 32
lireWire(!394)8oards 35
lireWire(!394)Cameras !4
llashlamps 2!
lluorescenlllluminalionSyslems 2!
lorensicSyslems 33
lrameCrabbers 35
G
CigabilLlhernelCameras !6
CigL8oards 36
Cuidance/ TrackingSyslems 24
H
High-PesolulionLenses 27
High-PesolulionScanners 33
High-SpeedVideoCameras !6
I
llluminalionSyslems/Lighling 20
lmage-AnalysisSollware 28
lmage-Compression/Decompression8oards 36
lmage-CompressionSollware 30
lmage-Processing8oards 36
lmage-ProcessingSollware 30
lmage-ProcessingSyslems 23
lmage-ProcessingToolkils 26
lmage-ScanningLenses 28
lmage-SlorageDevices 26
lnduslrialDisplays 20
lnduslrial-lnspeclionSollware 7
lnlraredCameras !7
lnlraredlmagingSyslems 24
lnlraredLenses 28
lnlraredLighling 2!
lnspeclion/NondeslrucliveTeslingSyslems 24
lnslrumenlalionSyslems 25
lnlegraledCircuils 27
lnlelligenlTransporlalionSyslems 25
L
Laser-8asedScanners 33
Lasers 2!
Law-LnlorcemenlSyslems 33
LLDDisplays 20
LLDLighling 2!
Lenses 27
LensTeslLquipmenl 36
LighlingConlrollers 22
LinearDrives 33
LinescanCameras !7
LinescanCCDSensors 34
LinescanCMOSSensors 34
Low-Lighl-LevelCameras !8
M
Machine-VisionSollware 30
MeasuremenlandAulomalionSollware 8
MedicalDiagnoslicsSyslems 25
Medical-lmagingSollware 7
Melrology/Measuremenl/CaugingSyslems 25
Microscopes 30
MicroscopySyslems 25
Mirrors 32
Molion-AnalysisSyslems 26
Molion-Conlrol8oards/Syslems 8
MullispeclralCameras !8
O
Oll-The-ShellSollware 28
Oplical-Characler-Pecognilion/
Oplical-Characler-VerilcalionSyslems 26
Oplical-Characler-PecognilionScanners 33
Oplical-Characler-PecognilionSollware 30
OplicalCoalings 32
OplicalSubsyslems 30
Oplics 30
P
PallernCeneralors 36
PholoeleclricSensors 34
PLCs/PACs 8
Polarizers 32
PosilioningLquipmenl 33
PowerSupplies 6
Prisms 32
Process-ConlrolSyslems 26
ProjeclionLenses 28
Proximily/PosilioningSensors 34
Q
Qualily-AssuranceSyslems 26
R
PeconlgurableProcessors 36
Pemole-SensingSyslems 26
PeliclesandTeslTargels 33
PobolicSubsyslems 33
Pobols 8
S
Scanners 33
Scienlilc-AnalysisSollware 7
SecurilySyslems 33
Semiconduclor-lnspeclionSollware 7
Sensors 33
ServoConlrollers 33
Servomolors 33
Shullers 33
SmarlCameras !8
Speclropholomelers 30
SlepperMolors 33
Slrobellluminalion 22
SlrucluredLighling 22
SurveillanceSyslems 33
Syslem8oards 34
T
TelecenlricLenses 28
TeslandMeasuremenlLquipmenl 36
Time-Delay-and-lnlegralion(TDl)Cameras 20
Time-Delay-and-lnlegralion(TDl)Sensors 34
U
US88oards 36
US8Cameras 20
UVCameras 20
UVllluminalionSyslems 22
UVLenses 28
V
VideoCameras 20
VideoCeneralors 36
VideoLenses 28
VideoOverlay8oards 36
VisionSensors 34
W
Web-ScanningSyslems 26
While-LighlllluminalionSyslems 23
Windows-8asedToolkils 26
X
XenonllluminalionSyslems 23
X-rayCameras 20
X-YPosilioningSubsyslems 33
X-YTables 33
# lillers 32 Oplical-Characler-Pecognilion Sollware 30
Product Index
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
Sales Offces
Ma r c h 2 0 1 3 VI S I ON S YS T E MS DE S I GN w w w . v i s i o n - s y s t e m s . c o m 64
Thisadindexispublishedasaservice.Thepublisherdoesnolassumeanyliabililylorerrorsoromissions.
Advertisers Index
Main Offce
98 Spit Brook Road, LL-1
Nashua, NH 03062-5737
(603) 891-0123
FAX: (603) 891-9328
Publisher
Susan Smith
(603) 891-9447
FAX: (603) 891-9328
E-mail: susans@pennwell.com
Sales Administrator
Erin Huot
(603) 891-9156
FAX: (603) 891-9328
E-mail: erinh@pennwell.com
Digital Media Sales
Operations Manager
Tom Markley
(603) 891-9307
FAX: (603) 891-9328
E-mail: thomasm@pennwell.com
Ad Services Manager
Marcella Hanson
(918) 832-9352
FAX: (918) 831-9415
E-mail: marcella@pennwell.com
List Rental
Kelli Berry
(918) 831-9782
FAX: (918) 831-9758
E-mail: kellib@pennwell.com
North American Advertising &
Sponsorship Sales
Judy Leger
(603) 891-9113
FAX: (603) 891-9328
E-mail: judyl@pennwell.com
Product Showcase
Advertising & Reprint Sales
Judy Leger
(603) 891-9113
FAX: (603) 891-9328
E-mail: judyl@pennwell.com
International Sales Contacts
Germany, Austria,
Northern Switzerland,
Eastern Europe
Johann Bylek, Munich
49-89-904-80-143
FAX: 49-89-904 -80-145
E-mail: johannb@pennwell.com
Holger Gerisch
49-88-56-802-0228
FAX: 49-88-56-802-0231
E-mail: holgerg@pennwell.com
Hong Kong, China
Adonis Mak
852-2-838-6298
FAX: 852-2-838-2766
E-mail: adonism@actintl.com.hk
Japan
Masaki Mori
81-3-3219-3561
FAX: 81-3-5645-1272
E-mail: mori-masaki@ics-inc.co.jp
Taiwan
Monica Liu
886-2-2396-5128
FAX: 886-2-23967816
E-mail: monica@arco.com.tw
Israel
Dan Aronovic (Tel Aviv)
972-9-899-5813
E-mail: aronovic@actcom.co.il
1st Vision 25,38
Allied Vision Technologies CV4
Allison Park Group 38
Alysium-Tech GmbH 4
Basler AG 2
Components Express Inc. 5
dPict Imaging 38
Edmund Optics 29
EDT 6
Emergent Vision Technologies
Inc. 6
EPIX Inc. 38
Falcon Illumination SDN BHD 38
Fisba Optik AG 32
Goyo Optical 38
IDS Imaging Development Systems
GmbH !!
Intercon 1 4
JAI !9
LMI Technologies 9
Lumenera !0
Matrix Vision GmbH 3!
Mercron Inc. 2!
Messe Munchen GmbH 37
Microscan 7
Mightex !2
OPTO GmbH 24
Phrontier Technologies 39
Point Grey !5
Qioptiq 27
Sensoray 35
Stemmer Imaging GmbH !7
Sutter Instrument 22
Teledyne DALSA 39,CV3
Unibrain Inc. 39
Universe Kogaku America 39
Vieworks CV2
Vision Ventures GmbH & Co KG 36
Vivid Engineering 39
Westech Optical 39
XIMEA GmbH !3
Z-LASER Optoelektronik GmbH 23
Thisadindexispublishedasaservice.Thepublisherdoesnolassumeanyliabililylorerrorsoromissions.
Advertiser / Page no. Advertiser / Page no. Advertiser / Page no.
______________
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
INTRODUCING THE WORLDS
VVGGA > 1.22MM > 1.444M > 2MM > 4MMM>> 5MMM > 88MM > 11222MMM
Genie TS captures up to 12 megapixel images with extremely high quality resolution and can
achieve frame rates as high as 300 fps. Integrated features like multiple exposure, color space
conversion and meta data with acquired image transfer-on-demand are all built into a tough
compact body equipped with a GigE Vision Compliant direct to PC interface.
16 Format Models (VGA-to-12M)
Image-to-Image Variable Exposure
Color Correction
Extended Dynamic Capability
On-board Image compression
Multi-Camera synchronization with 1588
Image Filtering Kernel
Get more vision.
Download our white paper:
4 Critical Factors: Deploying GigE Vision in Real-Time Industrial Imaging
www.teledynedalsa.com/m/v2013
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
q
q
M
M
q
q
M
M
qM
Qmags
THE WORLDS NEWSSTAND
Previous Page | Contents | Zoom in | Zoom out | Front Cover | Search Issue |
Subscribe | Next Page
VisionSystems
D E S I G N
VisionSystems
How will you love the Prosilica GT? Will it be for its rugged endurance? Or maybe
for the highly sensitive high speed sensor that lies within? Or from afar with its
Power over Ethernet? It could be that you will love it for everything it has to
offer. Dont worry about being too demanding. The GT can take the heatup
to 60C. It can take the cold shoulderdown to -20C. And with its remote
monitoring, it will always tell you how its doing. Want to see if the GT is a good
match for you? Visit www.AlliedVisionTec.com/ToughLove S E E I N G I S B E L I E V I N G
Tough love