Вы находитесь на странице: 1из 238

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

ISPDR.JOAQUNV.GONZLEZ ANTROPOLOGACULTURALYSOCIALCTEDRAMNICADACUNHA2013 AYUDANTEDECTEDRASRITAMELISAAGERO REFERENTEPARACADMICXSRITAMNICABUCETA INTRODUCCION Cuestionesrelativasalaorganizacindelamateria,presentacindelosmateriales,y requisitosdeacreditacin.Pautasparalalecturaacadmica,yelementosdeescritura acadmica.Presentacindelesquemageneraldelamateria.Ejestemticos. EJETEMTICO1:LOSIMBLICO,LOPOLTICOYLOSOCIAL Elhombre como animal racional. Elhombre como animal simblico. Cassirer "Unaclave de la naturaleza del hombre: el smbolo". Modernidad y Colonialismo: Dussel (invenciones ideolgicas de los espacios simblicos). Cultura como dimensin simblica. Las redes de la sujecin.DialcticadelAmoyelEsclavo.Lenguajeyrealidad.Colonizacinpedaggica. EJETEMTICO2:SUBJETIVIDAD,EMPODERAMIENTOYDISCURSO Foucault, Cuatro Conferencias El Sujeto El Poder "Seres de Lenguaje, sujetos de discurso" "DescentramientoySubjetividad"Elpoderylaconfiguracindelespacio.Elpanptico.Redes de poder. Microfsicas y macrofsicas del poder. La gubernamentabilidad. Poder y resistencia (tecnologas del yo y prcticas de s). Vigilar, Castigar y Educar: Ideologa y educacin. La polisemia de la ideologa y de las ideologa(s). Educacin y poltica, Cultura y Civilizacin. La sociedadcarnvora.Elespectrodelaideologa:Zizek.ButlerElgneroendisputa Metodologa,recursosyrequisitosdeacreditacindelamateria SERECOMIENDALEERCONATENCIN

Todaslascomisionesacargodelactedraofrecenenprincipioelrgimendepromocinsin examenfinal. Parapoderaspiraraestergimenlxsalumnxsdeberncontar(alcierredelacursadaregular) conunmnimodel75%deasistenciaaclases,laaprobacindelostrabajosprcticos parciales,ylaaprobacindeUNTRABAJOPRCTICOOBLIGATORIODECARCTERFINAL <TPOF>quesuponelassiguientesinstancias: a) presentacin del trabajo en la fecha asignada por la ctedra sin excepcin (el no cumplimiento de este requisito, supone la NO APROBACIN DE LA CURSADA quedandoasencarcterderecursante) Eltrabajosepresentaentodosloscasos,impresoomanuscritolegible El trabajo, al momento de su entrega, debe estar completo (de lo contrario no contabilizacomoentregado) No se aceptan bajo ningn concepto envos por correo electrnico NO AUTORIZADOS. En caso de hacer el envo por correo electrnico el trabajo se considerar NO entregado. [La ctedra habilitar una casilla especial para la

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

entrega de los TPOF <Trabajo Prctico Obligatorio Final>, siempre y cuando por razonesdefuerzamayorlaentreganopuedahacersedemanerapresencial] La entrega del trabajo en tiempo y forma supone la aprobacin de lo que consideramos la primera instancia de examen parcial. Instancia cuya aprobacin esnecesariaperonosuficienteparalapromocins/edelamateria.

b) Defensa oral del trabajo en la fecha indicada por la ctedra sin excepcin. (al igual que el requisito anterior el no cumplimiento de esta instancia supone la DESAPROBACINAUTOMTICADELACURSADA) Elcoloquio suponeelmanejodetodoslostemasybibliografatrabajadosalo largo del curso. En caso de no aprobarse esta instancia el/la alumno/a podr aspirar a una segunda instancia en carcter de recuperatorio. Si en dicha instancia el/la alumno/a no alcanzara con los requerimientos mnimos de aprobacin,deberpresentarseencarcterdealumnxaexamenfinal. Aquellxs alumnxs que no se presenten al recuperatorio automticamente quedanencondicindealumnxsRECURSANTES. LxsalumnxsquehabiendoentregadoelTPOFnosepresentenalainstanciade coloquio quedan automticamente desaprobados, quedando en carcter de alumnxsrecursantes. c) Lxs Estudiantes que quieran rendir en carcter de libres, debern comunicarse previamenteconlactedra.
Lactedraasuvezcuentaconlossiguientesrecursosdecomunicacin:

a) blogoficialdelactedrahttp://phylosajvg.blogspot.com(Todoslosanunciosurgentes eimportantesseharnporestemedio,demodoquenoseresponderningnmail solicitandoinformacinqueYAFIGUREPREVIAMENTEENELBLOG) b) Correoelectrnico filosofiadac@gmail.com(Paraunusomoderado,ycomorecursodeurgencia.Cabe aclararquelactedranoresponderconsultasquepuedanquedarsatisfechasconslo visitarelblog). c) Correoelectrnicodelxsayudantesoreferentesparesacadmicos: SloparaAntropologasocialycultural:ayuantropodac@gmail.com Elrestodeloscursospuedencomunicarseconsusreferentesparesacademicxsy/o ayudantesa:alum.filodac@gmail.com d) FORODELACTEDRA(funcionacomoaulavirtualencasodesituacionesurgentes) http://filojvg.foroargentina.net/(divididoporcursadas)
Aliniciodelcursotodxslxsalumnxsdeberningresaralblogycompletardemodoobligatorioy segnel departamento de origenel formulario que se encuentraenla seccin correspondiente aPRIMERRegistrodeAlumnxsREGULARES. RECUERDE SIEMPRE CHEQUEAR LA INFORMACIN REFERIDA SLO A LA MATERIA QUE USTED CURSA, ya que la ctedracuenta con otros cursos enotros departamentos aquienes tambin le facilitamosinformacinatravsdelblog.Noconfundalosanunciosquesonparaotroscursos,conlos
anuncios que son para el curso al que usted pertenece. LEA SIEMPRE CON ATENCIN A QU MATERIA SE DIRIGEELINFORME.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

YzurLeopoldoLugones
Comprelmonoenelrematedeuncircoquehabaquebrado. La primera vez que se me ocurri tentar la experiencia a cuyo relato estn dedicadas estas lneas, fue una tarde, leyendo no s dnde, que los naturales de Java atribuan la falta de lenguaje articulado en los monos a la abstencin, no a la incapacidad. "No hablan, decan, para quenoloshagantrabajar". Semejante idea, nada profunda al principio, acab por preocuparme hasta convertirse en este postuladoantropolgico: Los monos fueron hombres que por una u otra razn dejaron de hablar. El hecho produjo la atrofia de sus rganos de fonacin y de los centros cerebrales del lenguaje; debilit casi hasta suprimirlalarelacinentreunosyotros,fijandoelidiomadelaespecieenelgritoinarticulado, yelhumanoprimitivodescendiaseranimal.
AntropologaSocialyCultural Materialesdeusodidctico

Claroesquesillegaraademostrarseestoquedaranexplicadasdesdeluegotodaslasanomalas que hacen del mono un ser tan singular; pero esto no tendra sino una demostracin posible: volverelmonoallenguaje. Entre tanto haba corrido el mundo con el mo, vinculndolo cada vez ms por medio de peripecias y aventuras. En Europa llam la atencin, y de haberlo querido, llego a darle la celebridad de un Cnsul; pero mi seriedad de hombre de negocios mal se avena con tales payasadas. Trabajado por mi idea fija del lenguaje de los monos, agot toda la bibliografa concerniente al problema,sinningnresultadoapreciable.Sabanicamente,conenteraseguridad,quenohay ningunarazncientficaparaqueelmononohable.Estollevabacincoaosdemeditaciones. Yzur (nombre cuyo origen nunca pude descubrir, pues lo ignoraba igualmente su anterior patrn),Yzureraciertamenteunanimalnotable.Laeducacindelcirco,bienquereducidacasi enteramente al mimetismo, haba desarrollado mucho sus facultades; y esto era lo que me incitabamsaensayarsobrelmenaparienciadisparatadateora. Por otra parte, sbese que el chimpanc (Yzur lo era) es entre los monos el mejor provisto de cerebro y uno de los ms dciles, lo cual aumentaba mis probabilidades. Cada vez que lo vea avanzar en dos pies, con las manos a la espalda para conservar el equilibrio, y su aspecto de marineroborracho,laconviccindesuhumanidaddetenidasevigorizabaenm. No hay a la verdad razn alguna para que el mono no articule absolutamente. Su lenguaje natural, es decir, el conjunto de gritos con que se comunica a sus semejantes, es asaz variado; su laringe, por ms distinta que resulte de la humana, nunca lo es tanto como la del loro, que hablasinembargo;yencuantoasucerebro,fueradequelacomparacinconeldeesteltimo animal desvanece todaduda, basta recordarque eldel idiota es tambin rudimentario, a pesar delocualhaycretinosquepronuncianalgunaspalabras.Porloquehacealacircunvolucinde Broca, depende, es claro, del desarrollo total del cerebro; fuera de que no est probado que

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

ella sea fatalmente el sitio de localizacin del lenguaje. Si es el caso de localizacin mejor establecidoenanatoma,loshechoscontradictoriossondesdeluegoincontestables. Felizmentelosmonostienen,entresusmuchasmalascondiciones,elgustoporaprender,como lodemuestrasutendenciaimitativa;lamemoriafeliz,lareflexinquellegahastaunaprofunda facultad de disimulo, y la atencin comparativamente ms desarrollada que en el nio. Es, pues,unsujetopedaggicodelosmsfavorables. El mo era joven adems, y es sabido que la juventud constituye la poca ms intelectual del mono, parecido en esto al negro. La dificultad estribaba solamente en el mtodo que se empleara para comunicarle la palabra. Conoca todas las infructuosas tentativas de mis antecesores; y est de ms decir, que ante la competencia de algunos de ellos y la nulidad de todos sus esfuerzos, mis propsitos fallaron ms de una vez, cuando el tanto pensar sobre aqueltemafuellevndomeaestaconclusin: Loprimeroconsisteendesarrollarelaparatodefonacindelmono. Ases,enefecto,comoseprocedeconlossordomudosantesdellevarlosalaarticulacin;yno bien hube reflexionado sobre esto, cuando las analogas entre el sordomudo y el mono se agolparonenmiespritu. Primero de todo, su extraordinaria movilidad mmica que compensa al lenguaje articulado, demostrando que no por dejar de hablar se deja de pensar, as haya disminucin de esta facultad por la paralizacin de aquella. Despus otros caracteres ms peculiares por ser ms especficos: la diligencia en el trabajo, la fidelidad, el coraje, aumentados hasta la certidumbre por estas dos condiciones cuya comunidad es verdaderamente reveladora; la facilidad para los ejerciciosdeequilibrioylaresistenciaalmarco. Decid, entonces, empezar mi obra con una verdadera gimnasia de los labios y de la lengua de mimono,tratndoloenestocomoaunsordomudo.Enlorestante,mefavoreceraelodopara establecer comunicaciones directas de palabra, sin necesidad de apelar al tacto. El lector ver queenestaparteprejuzgabacondemasiadooptimismo. Felizmente,elchimpancesdetodoslosgrandesmonoselquetienelabiosmsmovibles;yen el caso particular, habiendo padecido Yzur de anginas, saba abrir la boca para que se la examinaran. La primera inspeccin confirm en parte mis sospechas. La lengua permaneca en el fondo de su boca, como una masa inerte, sin otros movimientos que los de la deglucin. La gimnasia produjo luego su efecto, pues a los dos meses ya saba sacar la lengua para burlar. sta fue la primera relacin que conoci entre el movimiento de su lengua y una idea; una relacin perfectamenteacordeconsunaturaleza,porotraparte. Los labios dieron ms trabajo, pues hasta hubo que estirrselos con pinzas; pero apreciaba quiz por mi expresin la importancia de aquella tarea anmala y la acometa con viveza. Mientras yo practicaba los movimientos labiales que deba imitar, permaneca sentado, rascndose la grupa con su brazo vuelto hacia atrs y guiando en una concentracin

phylosajvg - @filodac

AntropologaSocialyCultural Materialesdeusodidctico

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

dubitativa, o alisndose las patillas con todo el aire de un hombre que armoniza sus ideas por mediodeademanesrtmicos.Alfinaprendiamoverloslabios. Pero el ejercicio del lenguaje es un arte difcil, como lo prueban los largos balbuceos del nio, que lo llevan, paralelamente con su desarrollo intelectual, a la adquisicin del hbito. Est demostrado, en efecto, que el centro propio de las inervaciones vocales, se halla asociado con el de la palabra en forma tal, que el desarrollo normal de ambos depende de su ejercicio armnico; y esto ya lo haba presentido en 1785 Heinicke, el inventor del mtodo oral para la enseanza de los sordomudos, como una consecuencia filosfica. Hablaba de una "concatenacin dinmica de las ideas", frase cuya profunda claridad honrara a ms de un psiclogocontemporneo. Yzur se encontraba, respecto al lenguaje, en la misma situacin del nio que antes de hablar entiende ya muchas palabras; pero era mucho ms apto para asociar los juicios que deba poseersobrelascosas,porsumayorexperienciadelavida. Estos juicios, que no deban ser slo de impresin, sino tambin inquisitivos y disquisitivos, a juzgar por el carcter diferencial que asuman, lo cual supone un raciocinio abstracto, le daban ungradosuperiordeinteligenciamuyfavorableporciertoamipropsito. Si mis teoras parecen demasiado audaces, basta con reflexionar que el silogismo, o sea el argumento lgico fundamental, no es extrao a la mente de muchos animales. Como que el silogismo es originariamente una comparacin entre dos sensaciones. Si no, por qu los animalesqueconocenalhombrehuyendel,ynolosquenuncaleconocieron?... Comenc,entonces,laeducacinfonticadeYzur. Tratbasedeensearleprimerolapalabramecnica,parallevarloprogresivamentealapalabra sensata. Poseyendo el mono la voz, es decir, llevando esto de ventaja al sordomudo, con ms ciertas articulaciones rudimentarias, tratbase de ensearle las modificaciones de aquella, que constituyen los fonemas y su articulacin, llamada por los maestros esttica o dinmica, segn queserefieraalasvocalesoalasconsonantes. Dada la glotonera del mono, y siguiendo en esto un mtodo empleado por Heinicke con los sordomudos, decid asociar cada vocal con una golosina: a con papa; e con leche; i con vino; o concoco;u conazcar,haciendodemodoquelavocalestuviesecontenidaenelnombredela golosina, ora con dominio nico y repetido como en papa, coco, leche, ora reuniendo los dos acentos,tnicoyprosdico,esdecir,comofundamental:vino,azcar. Todoanduvobien,mientrassetratdelasvocales,osealossonidosqueseformanconlaboca abierta. Yzur los aprendi en quince das. Slo que a veces, el aire contenido en sus abazones lesdabaunarotundidaddetrueno.Laufueloquemslecostpronunciar. Las consonantesme dieron un trabajo endemoniado, y a poco hube de comprender que nunca llegara a pronunciar aquellas en cuya formacin entran los dientes y las encas. Sus largos colmillosysusabazones,loestorbabanenteramente.

phylosajvg - @filodac

AntropologaSocialyCultural Materialesdeusodidctico

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

Elvocabularioquedabareducido,entoncesalascincovocales,lab,lak,lam,lag,lafylac,es decirtodasaquellasconsonantesencuyaformacinnointervienensinoelpaladarylalengua. Aunparaestonomebastelodo.Hubederecurriraltactocomounsordomudo,apoyandosu manoenmipechoyluegoenelsuyoparaquesintieralasvibracionesdelsonido. Y pasaron tres aos, sin conseguir que formara palabra alguna. Tenda a dar a las cosas, como nombrepropio,eldelaletracuyosonidopredominabaenellas.Estoeratodo. En el circo haba aprendido a ladrar como los perros, sus compaeros de tarea; y cuando me veadesesperarantelasvanastentativasparaarrancarlelapalabra,ladrabafuertementecomo dndome todo lo que saba. Pronunciaba aisladamente las vocales y consonantes, pero no podaasociarlas.Cuandoms,acertabaconunarepeticindepesyemes. Por despacio que fuera, se haba operado un gran cambio en su carcter. Tena menos movilidad en las facciones, la mirada ms profunda, y adoptaba posturas meditativas. Haba adquirido, por ejemplo, la costumbre de contemplar las estrellas. Su sensibilidad se desarrollaba igualmente; basele notando una gran facilidad de lgrimas. Las lecciones continuaban con inquebrantable tesn, aunque sin mayor xito. Aquello haba llegado a convertirseenunaobsesindolorosa,ypocoapocosentameinclinadoaemplearlafuerza.Mi carcter iba agrindose con el fracaso, hasta asumir una sorda animosidad contra Yzur. ste se intelectualizaba ms, en el fondo de su mutismo rebelde, y empezaba a convencerme de que nunca lo sacara de all, cuando supe de golpe que no hablaba porque no quera. El cocinero, horrorizado, vino a decirme una noche que haba sorprendido al mono "hablando verdaderas palabras". Estaba, segn su narracin, acurrucado junto a una higuera de la huerta; pero el terror le impeda recordar lo esencial de esto, es decir, las palabras. Slo crea retener dos: camaypipa.Casiledoydepuntapisporsuimbecilidad. No necesito decir que pas la noche posedo de una gran emocin; y lo que en tres aos no habacometido,elerrorquetodoloechaperder,provinodelenervamientodeaqueldesvelo, tantocomodemiexcesivacuriosidad. Envezdedejarqueelmonollegaranaturalmentealamanifestacindellenguaje,llamlealda siguienteyprocurimponrselaporobediencia. No consegu sino las pes y las emes con que me tena harto, las guiadas hipcritas yDios me perdoneunaciertavislumbredeironaenlaazogadaubicuidaddesusmuecas. Me encoleric, y sin consideracin alguna, le di de azotes. Lo nico que logr fue su llanto y un silencioabsolutoqueexcluahastalosgemidos. Alostresdascayenfermo,enunaespeciedesombrademenciacomplicadaconsntomasde meningitis. Sanguijuelas, afusiones fras, purgantes, revulsivos cutneos, alcoholaturo de brionia,bromurotodalateraputicadelespantosomallefueaplicada.Luchcondesesperado bro,aimpulsosdeunremordimientoydeuntemor.Aqulporcreeralabestiaunavctimade micrueldad;steporlasuertedelsecretoquequizsellevabaalatumba.

phylosajvg - @filodac

AntropologaSocialyCultural Materialesdeusodidctico

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

Mejor al cabo de mucho tiempo, quedando, no obstante, tan dbil, que no poda moverse de su cama. La proximidad de la muerte habalo ennoblecido y humanizado. Sus ojos llenos de gratitud,noseseparabandem,siguindomeportodalahabitacincomodosbolasgiratorias, aunqueestuviesedetrsdel;sumanobuscabalasmasenunaintimidaddeconvalecencia.En migransoledad,ibaadquiriendorpidamentelaimportanciadeunapersona. Eldemoniodelanlisis,quenoessinounaformadelespritudeperversidad,impulsbame,sin embargo, a renovar mis experiencias. En realidad el mono haba hablado. Aquello no poda quedaras. Comenc muy despacio, pidindole las letras que saba pronunciar. Nada! Dejelo solo durante horas, espindolo por un agujerillo del tabique. Nada! Hablele con oraciones breves, procurando tocar su fidelidad o su glotonera. Nada! Cuando aqullas eran patticas, los ojos selehinchabandellanto.Cuandoledecaunafrasehabitual,comoel"yosoytuamo"conque empezaba todas mis lecciones, o el "t eres mi mono" con que completaba mi anterior afirmacin,para llevar a un espritu la certidumbre de una verdad total, l asenta cerrando los prpados;peronoproducasonido,nisiquierallegabaamoverloslabios.
AntropologaSocialyCultural Materialesdeusodidctico

Haba vuelto a la gesticulacin como nico medio de comunicarse conmigo; y este detalle, unido a sus analogas con los sordomudos, haca redoblar mis preocupaciones, pues nadie ignora la gran predisposicin de estos ltimos a las enfermedades mentales. Por momentos deseabaquesevolvieraloco,aversieldeliriorompaalfinsusilencio.Suconvalecenciasegua estacionaria. La misma flacura, la misma tristeza. Era evidente que estaba enfermo de inteligenciaydedolor.Suunidadorgnicahabaserotoalimpulsodeunacerebracinanormal, ydams,damenos,aquleracasoperdido.Ms,apesardelamansedumbrequeelprogreso de la enfermedad aumentaba en l, su silencio, aquel desesperante silencio provocado por mi exasperacin, no ceda. Desde un oscuro fondo de tradicin petrificada en instinto, la raza impona su milenario mutismo al animal, fortalecindose de voluntad atvica en las races mismas de su ser. Los antiguos hombres de la selva, que forz al silencio, es decir, al suicidio intelectual, quin sabe qu brbara injusticia, mantenan su secreto formado por misterios de bosque y abismos de prehistoria, en aquella decisin ya inconsciente, pero formidable con la inmensidad de su tiempo. Infortunios del antropoide retrasado en la evolucin cuya delantera tomaba el humano con un despotismo de sombra barbarie, haban, sin duda, destronado a las grandesfamiliascuadrumanasdeldominioarbreodesusprimitivosedenes,raleandosusfilas, cautivando sus hembras para organizar la esclavitud desde el propio vientre materno, hasta infundirasuimpotenciadevencidaselactodedignidadmortalquelasllevabaaromperconel enemigoelvnculosuperiortambin,peroinfausto,delapalabra,refugindosecomosalvacin supremaenlanochedelaanimalidad. Y qu horrores, qu estupendas sevicias no habran cometido los vencedores con la semibestia en trance de evolucin, para que sta, despus de haber gustado el encanto intelectual que es el fruto paradisaco de las biblias, se resignara a aquella claudicacin de su extirpe en la degradante igualdad de los inferiores; a aquel retroceso que cristalizaba por siempre su inteligencia en los gestos de un automatismo de acrbata; a aquella gran cobarda de la vida que encorvara eternamente, como en distintivo bestial, sus espaldas de dominado, imprimindoleesemelanclicoazoramientoquepermaneceenelfondodesucaricatura.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

Heaquloque,albordemismodelxito,habadespertadomimalhumorenelfondodellimbo atvico. A travs del milln de aos, la palabra, con su conjuro, remova la antigua alma simiana; pero contra esa tentacin que iba a violar las tinieblas de la animalidad protectora, la memoria ancestral, difundida en la especie bajo un instintivo horror, opona tambin edad sobreedadcomounamuralla. Yzur entr en agona sin perder el conocimiento. Una dulce agona a ojos cerrados, con respiracin dbil, pulso vago, quietud absoluta, que slo interrumpa para volver de cuando en cuandohaciam,conunadesgarradoraexpresindeeternidad,sucaradeviejomulatotriste.Y la ltima noche, la tarde de su muerte, fue cuando ocurri la cosa extraordinaria que me ha decididoaemprenderestanarracin. Habame dormitado a su cabecera, vencido por el calor y la quietud del crepsculo que empezaba,cuandosentdeprontoquemeasanporlamueca. Despert sobresaltado. El mono, con los ojos muy abiertos, se mora definitivamente aquella vez,ysuexpresineratanhumana,quemeinfundihorror;perosumano,susojos,meatraan contantaelocuenciahacial,quehubedeinclinarmedeinmediatoasurostro;yentonces,con sultimosuspiro,elltimosuspiroquecoronabaydesvanecaalavezmiesperanza,brotaron estoy seguro, brotaron en un murmullo (cmo explicar el tono de una voz que ha permanecido sin hablar diez mil siglos?) estas palabras cuya humanidad reconciliaba las especies: AMO,AGUA,AMO,MIAMO... ACTIVIDAD Busqueencualquierenciclopedialosdatossobreelautordelcuento.Enqucorrienteliteraria puede ubicrselo, y cules seran las caractersticas relevantes de este moviendo. (Esta actividad puede resolverla con la colaboracin de su docente de Taller de Expresin Oral y Escrita). Marque todas aquellas palabras cuyo significado le resulte desconocido y elabore un glosario decadaunadeellas. Resuma en no ms de cinco renglones cul es, segn su comprensin, el tema central del cuento. Qu cuestiones conceptuales o tericas podran abordarse desde una mirada antropolgica?Porcierto,quesentrminosgeneraleslaantropologa?

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

Texto terico

El salvaje de Aveyron: el caso Vctor, de Mara Elena Dinouchi, en Lodieu, Mara Teresa y Scaglia, Hctor (comps.), Construcciones en Psicologa, Buenos Aires, Proyecto editorial, 2002.

El salvaje de Aveyron: el caso Vctor


"-Amo, agua. Amo, mi amo... " Leopoldo Lugones

INTRODUCCIN El captulo Naturaleza y Cultura del libro Las estructuras elementales del parentesco nos introduce al desarrollo que interesa a Claude Lvi-Strauss llevar a cabo con el fin de aportar una respuesta satisfactoria al interrogante nodular "Dnde termina la naturaleza? Dnde comienza la cultura?" (Lvi-Strauss, 1981: 36). Para ello reflexiona crticamente sobre datos y observaciones que, desde distintos campos del saber, han intentado infructuosamente despejar el enigma. Adelantamos que su anlisis riguroso le permite afirmar que la universalidad de la regla de la prohibicin del incesto es el movimiento fundamental por el cual se cumple el pasaje de la naturaleza a la cultura. "Opera, y por s misma constituye el advenimiento de un nuevo orden (op. cit.: 59), concluye el autor. Uno de esos datos considerados en el desarrollo argumentativo es el estudio de los nios salvajes, cuyos encuentros azarosos -en el siglo XVIII y comienzos del XIX- despertaron l inters y la imaginacin de los cientficos quienes creyeron haberse topado con testimonios vivientes de un estado natural del hombre. En este sentido, la conclusin de Lvi-Strauss es taxativa: el caso de los nios salvajes no testimonia de ningn comportamiento natural de la especie humana porque tal comportamiento natural de la especie, al que el hombre aislado pudiera volver por regresin,

Este material es utilizado con fines exclusivamente educativos.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO ectura sugerida - Dinouchi

10

es inexistente. Es ms, invita a ubicar en algn tipo de anormalidad la causa inicial del abandono y no su resultado. "Los nios salvajes, sean producto del azar o de la experimentacin, pueden ser monstruosidades culturales, pero nunca testigos fieles de un estado anterior (op.cit.: 38), afirma el autor. Por lo que en ella se despeja de una concepcin del hombre y de la naturaleza, tomaremos como referencia la experiencia del encuentro con el salvaje de Aveyron, nio de entre doce y trece aos, hallado en la campia francesa hacia 1800 y a quien su maestro llam por el nombre de Vctor. El nio presentaba un aspecto lamentable: sucio, feroz, impaciente, con el cuerpo cubierto de cicatrices; la mirada errante, indiferente e incapaz de prestar atencin a nada; privado del uso de la palabra slo emita sonidos guturales y uniformes; de movimientos espasmdicos y a menudo convulsos, morda y araaba a quienes se le acercaban y buscaba constantemente la forma de escapar. Quienes con gran expectativa haban credo encontrarse frente al hombre natural de Rousseau, contemplaban con repugnancia y aprensin la suciedad y el salvajismo del muchacho.

EL ENCUENTRO DEL SALVAJE DE AVEYRON CON EL DISCURSO CIENTFICO DE LA POCA No era el salvaje de Aveyron el primer nio que fuera encontrado en tales circunstancias; hallazgos similares se haban producido ya desde el siglo XV. Lo novedoso del caso resida en que no slo despertara la piedad de los aldeanos sino tambin -y he aqu su valor primordialla curiosidad de los cientficos. Ya a lo largo del siglo XVIII, la ciencia afianzaba sus ideales de autonoma al pronunciar su ruptura con la religin y la filosofa; al proclamar la independencia de la investigacin cientfica y la secularizacin de la cultura. Cuando el azar arroja a Vctor, el discurso cientfico presto a leer las consecuencias de su encuentro ya tena dispuestos los trminos de la polmica que le daran acogida. Para las nacientes ciencias del hombre, el caso Vctor constituy una experiencia crucial apropiada para la convalidacin de una concepcin del hombre y de la naturaleza que no deba realizarse por fuera de la observacin positiva de los datos proporcionados por la experiencia. En concordancia con esta postura relativa a la ciencia, todo conocimiento resulta ser principalmente fctico y la ciencia se aplica a sumar y vincular hechos entre s enunciando proposiciones, que no consisten en la aprehensin de la esencia incognoscible de los seres sino en la enumeracin de la suma indefinida de sus propiedades, tal como aparecen a travs de la experiencia sensible. El nio salvaje o el idiota del Aveyron constituy un campo privilegiado de observacin, experimentacin y validacin de hiptesis. Cuando Louis-Franois Jauffret, secretario de la Socit des Observateurs de I'Homme solicita a las autoridades del Hospital de Rodez el envo del nio a Pars para su estudio, lo hace acompaado de la siguiente justificacin: "Sera muy importante para el progreso de los conocimientos humanos que un observador pleno de celo y de buena fe pudiera, apoderndose del muchacho y retrasando su proceso de civilizacin, controlar el conjunto de sus ideas adquiridas, estudiar el modo segn el que las expresa y ver si la condicin humana,

Este material se utiliza exclusivamente con fines didcticos.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

11

abandonada a s misma, es contraria por completo al desarrollo de la inteligencia (Montanari, 1978: 9).

LOS PRESUPUESTOS TERICOS DEL EMPIRISMO Etienne Bonnot de Condillac (1714-1780) retom en Francia los principios del empirismo ingls, principios que fundamentan el origen del conocimiento en la experiencia sensible, a saber: crtica al innatismo cartesiano, sensacionismo, utilitarismo, fenomenismo. El empirismo sensacionista concibe al espritu en su inicio como una hoja en blanco a la que slo la experiencia perceptiva va a dar forma proveyndole la totalidad de su contenido. Su crtica a la concepcin que afirmaba la existencia de ideas innatas supone el esfuerzo por demostrar el origen perceptivo de las mismas. El espritu como tabla rasa de la concepcin sensacionista se materializa en las ideas de Condillac, quien imagina una estatua a la que dota sucesivamente de diferentes sentidos cuyo aporte de sensaciones se transforma y complejiza, a fin de demostrar mediante esta abstraccin que de tal manera se puede reconstruir el conjunto del funcionamiento mental del hombre. Para Condillac, todas las facultades mentales que componen la facultad de pensar, tanto las del entendimiento (comparacin, juicio, reflexin, razonamiento) como las de la voluntad (necesidad, deseo, querer) no son ms que sensaciones transformadas. Mdicos-filsofos, observadores del hombre, los Idelogos discpulos de Condillac, entre fines del siglo XVIII y comienzos del XIX, intentaban confirmar los principios fundamentales del sensismo como teora de la formacin de las ideas pero criticaban, a su vez, lo que consideraban la ausencia de una base fisiolgica en las ideas de su maestro. En esta perspectiva, Pierre-Jean-George Cabanis (1757-1808) niega la existencia de toda sustancia pensante que no se confunda con la organizacin fsico-fisiolgica del hombre; la analoga que propone es elocuente: as como el estmago segrega jugos gstricos, el cerebro segrega el pensamiento a partir de las sensaciones que llegan a l. Al subrayar la unidad orgnica del ser humano, en el lugar de la tablarasa abierta a las inscripciones perceptivas, Cabanis ubica todo el peso del organismo vivo y sus determinaciones somticas e instintivas. Le interesa por sobre todo poner de manifiesto la accin de lo fsico sobre lo moral: la edad, el sexo, el tipo fsico, el temperamento, las enfermedades, el clima, las bebidas, etc. influyen de manera esencial en el alma, la inteligencia o la voluntad. As por ejemplo, sostiene que los hombres robustos de cabello oscuro tienen una mayor predisposicin a los accesos de excitacin y que las mujeres rubias estn ms inclinadas a la melancola. El desarrollo del pensamiento depende en gran medida del cerebro en primer trmino pero tambin del conjunto de los rganos. Su concepcin de una maleabilidad total del psiquismo ante las impresiones externas tena como efecto el conceder una verdadera omnipotencia a la educacin. En el plan de reeducacin que Jean Itard (1774-1838) proyecta para el nio salvaje se encuentran claramente las huellas de esta conceptualizacin. El planteo de la mente como facultad no innata permitir concebir la educacin no slo de Vctor sino que dar lugar adems al surgimiento de una pedagoga cientfica. Si la estatua de Condillac viene al lugar de
Este material se utiliza exclusivamente con fines didcticos. 3

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

12

la tabla rasa de John Locke (1632-1704), Vctor se convertir en su objeto emprico; ser el soporte material de los presupuestos tericos de la Ideologa 1 posibilitando de esta manera la validacin in vivo de la teora sensista y los lmites de su alcance prctico. Las preguntas formulables y a la espera de respuesta eran: Cmo se originan las ideas? Cul es su vnculo con las sensaciones? Cmo se adquiere el lenguaje? Cmo se desarrollan las facultades de la mente? Qu puede dificultar su crecimiento? Cules son las posibilidades que la ciencia -pedagoga o psiquiatra- tiene de incidir sobre las determinaciones naturales? Cul es la influencia del medio y cul el papel de la sociedad?

LOS TRMINOS DE LA POLMICA: PINEL VERSUS TIRAD Podra ser Vctor la expresin del hombre natural no contaminado an por los hbitos de la vida social, con sus sentidos no despiertos frente a los estmulos del mundo exterior? El testimonio de un estado anterior del hombre, manifestacin de la primitiva constitucin del ser humano? Un ser de facultades disminuidas, un idiota acaso? O tal vez un sordomudo? Tales eran los interrogantes abiertos en la polmica que tuvo sus aristas ms representativas en las figuras de Philippe Pinel y de Itard. Pinel, idelogo, mdico-filsofo, amigo ntimo de Cabanis y Desttut de Tracy era director y promotor de reformas en los manicomios de Pars donde se desarrollaban nuevos mtodos para el tratamiento de la locura. Sus observaciones le permitieron hacer una clasificacin de las enfermedades mentales de las que ubica la causa en desequilibrios fsicos y fisiolgicos. Jean Itard era un joven mdico perteneciente a la escuela de Sicard, especialista e innovador en materia de reeducacin de sordomudos y en cuya trayectoria se incluye tambin una vinculacin al hospicio para locos de Pinel. Pinel, ante quien el salvaje ha sido presentado, analiza por separado los sentidos del muchacho concluyendo que en varios y determinados aspectos, Vctor presenta rasgos comunes con los nios deficientes o idiotas. Al carecer de sentidos -levemente desarrollados- y privado del uso de la palabra carece de ideas y afectos y su universo se limita a las formas ms elementales. Vctor no es de ningn modo el prototipo del hombre natural sino un desecho de enfermedad fsica y mental. Acentuando la organicidad del vnculo entre lo fsico y lo moral, estableciendo la superioridad de lo fsico y lo fisiolgico como fundamento del desarrollo intelectual, Pinel descarta la educabilidad del salvaje: Vctor padece de idiotismo incurable, la reeducacin por tanto, no puede restaurarle facultades y sentidos lesionados y la reclusin en un hospicio es todo cuanto puede proponerse la sociedad. Contra el peso de la autoridad de Pinel, ltard sostendr que el salvaje es normal y que slo resta incorporarlo a la cultura pero como las condiciones de su vida han daado su desarrollo, necesita cuidados mdicos. De esta manera el proyecto de ltard, apoyado en su afirmacin de la primaca de lo social sobre lo natural, realiza una conjuncin de medicina y pedagoga. Cree
1

As denomina Condillac a su teora del espritu.


4

Este material se utiliza exclusivamente con fines didcticos.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

13

haber tenido la suerte de toparse con la viva encarnacin de la estatua de Condillac. Considera adems que la sociedad, al atraerlo a su seno, ha contrado con el nio obligaciones ineludibles; deuda que debe ser saldada, la educacin del salvaje se impone como un deber social y moral.

LA PEDAGOGA MDICA DE ITARD: APUESTA Y FRACASO Pasada la momentnea curiosidad, agotada la polmica, declarado imbcil e incurable, el salvaje de Aveyron es enviado al Instituto Nacional de Sordomudos dirigido por Sicard y confiado a los cuidados de Jean ltard quien se propondr la tarea de ser ese investigador que, "...reuniendo con cuidado la historia de un ser tan sorprendente, llegara a determinar qu es y deducira de lo que le falta la suma hasta ahora incalculable de los conocimientos y de las ideas que el hombre debe a la educacin. (ltard, 1978: 55). Durante cerca de diez aos Itard se dedic casi exclusivamente a las experiencias con el nio salvaje, cuyo registro qued fijado en las dos Memorias que redact y de las que relevaremos slo algunos puntos. Dispona de la teora de reeducacin de la disminucin fsica que practicara en la escuela de sordomudos y de los principios que le llegaban de Condillac y Cabanis; con ellos emprendi la difcil tarea de conducir al nio en el trnsito del salvajismo a la cultura. Lo interesante es comprobar hasta qu punto este saber con el que cuenta constituye un verdadero obstculo, no slo al reconocimiento de los probables progresos de Vctor sino fundamentalmente a la posibilidad de extraer de los fracasos que se suceden -tan especialmente en el plano del lenguaje- algn cuestionamiento de los principios mismos en que se sustenta. Itard cree en esos principios y los aplica a fe ciega y, en consecuencia, no tendr acceso a lo que el salvaje bien hubiera tenido para ensearle a l, tal como lo destaca Octave Mannoni (Mannoni, 1969). El plan mdico-pedaggico de reeducacin que elabora Itard consta, tal como lo describe en sus primeras Memorias, de cinco objetivos principales. Si bien el salvaje le es confiado como mudo sucede que Vctor no es sordo y, por lo tanto, se impone la pregunta: por qu no habla? Itard reconoce que hay una diferencia radical entre un individuo sordo de nacimiento pero que ha vivido en una sociedad organizada por el lenguaje y otro no hablante por haber vivido siempre en el interior de la naturaleza muda o en la reunin de la soledad y el silencio. Por lo tanto, el primer objetivo del plan consiste en "Vincularlo a la vida social, hacindosela ms dulce que la que haba conocido, y, sobre todo, ms similar a la vida que haba abandonado (ltard, 1978: 62). El segundo objetivo es "Despertar la sensibilidad nerviosa mediante los estimulantes ms enrgicos y provocar, de vez en cuando, los afectos ms vivaces del espritu (op.cit.: 64). Contrariamente a la opinin de Pinel, Itard considera que an no puede comprobarse que Vctor padezca algn tipo de disminucin congnita o adquirida sino que su sensibilidad est precariamente desarrollada como consecuencia del estado de salvajismo, donde slo unas pocas facultades le fueron necesarias para asegurar su supervivencia. Ampliar su sensibilidad es la va que lo conducir al progreso del resto de sus facultades y a la adquisicin de las primeras ideas y afectos.

Este material se utiliza exclusivamente con fines didcticos.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

14

El maestro ha observado que su alumno no llora; no hay ni llanto ni estornudo como reaccin al tabaco que le introduce en la cavidad exterior de la nariz. Si esto le demuestra la inexistencia de los lazos de simpata que unen el rgano del olfato a los de la respiracin, lo ponen sobre la pista fundamentalmente, de que la secrecin de lgrimas le est an menos relacionado con sentimientos tristes; "...a pesar de las innumerables contrariedades, a pesar del psimo tratamiento al que lo someti en los primeros meses el nuevo gnero de vida, nunca lo vi derramar lgrimas.. (op.cit.: 65).

Adems, Vctor demuestra tener una salud de hierro que es entendida por su maestro como resultado de una escasa sensibilidad de los rganos sensoriales; el muchacho puede permanecer expuesto al viento fro y a la lluvia durante horas, puede tomar con los dedos un carbn encendido y volverlo a colocar sobre el fuego o comer una papa an hirviendo. Valindose de un preconcepto mdico que dice que la sensibilidad es directamente proporcional al grado de civilizacin, Itard har uso de los medios ms enrgicos con el propsito de civilizarlo. A fuerza de baos hirvientes -porque los habitantes de los pases clidos son ms sensibles que los de los pases fros- logra tornado friolento; sensible al fro ya y para obligado a vestirse solo -adquirir nuevos hbitos- lo deja desnudo, cada maana, cerca de su ropa. Por cierto, no consigui el efecto provechoso que esperaba del calor y los baos hirvientes, por cuanto lo deseado hubiera sido que la prdida de fuerza muscular redundara en beneficio de la sensibilidad nerviosa. Finalmente lograr hacerle atrapar un violento resfriado y dos afecciones catarrales que sern interpretadas por Itard como prueba del acceso del salvaje a la civilizacin. Itard argumenta "...las enfermedades, tambin ellas, testimonios irrecusables y desagradables de la sensibilidad predominante en el hombre civilizado. (op.cit.: 68). Tampoco dejaron de presentarse otros hechos que sorprendieron al desprevenido Itard cuando al agregar a los baos, fricciones a lo largo de la columna vertebral, hall que no slo proporcionaban al muchacho momentos de alegra "... sino que -observa- parecieron extenderse tambin a los rganos genitales, amenazando con dar una direccin poco oportuna a los primeros movimientos de una pubertad ya demasiado precoz. (op.cit.: 66). La conviccin que anima a Itard -y es la de su poca- es la de que an los medios ms violentos son benficos; si consigue encolerizarlo o hacerlo llorar esto es buen sntoma y mejor pronstico. Ofrecerle y privarle, darle y frustrarle pedaggicamente; el placer es una recompensa y el dolor un castigo; el objetivo, actuar sobre los afectos del nimo disponiendo la sensibilidad al desarrollo de nuevas funciones. As, cuando en medio de un acceso de rabia, Vctor arroja por el suelo unos cartones con los que su maestro pretenda ensearle el alfabeto, sin dudar del efecto instructivo del castigo, Itard lo toma con fuerza y lo expone fuera de la ventana con la cabeza dirigida hacia el fondo del precipicio. Consigue de esta forma que el alumno coloque todo en su lugar y luego llore abundantemente, juzgando el maestro que si el xito no fue completo al menos fue suficiente. Itard se felicita por los progresos que obtiene, no existen para l problemas irresolubles, pero por otra parte, su autocrtica es nula. Sin embargo -y en honor a su honestidad cientfica- debemos destacar que Itard refiere que si slo hubiera querido exponer los resultados positivos de su programa mdico-pedaggico no hubiera avanzado en la comunicacin de sus Memorias hasta lo relativo al cuarto objetivo:

Este material se utiliza exclusivamente con fines didcticos.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

15

"Inducirlo al uso de la palabra, determinando el ejercicio de la imitacin a travs de la imperiosa ley de la necesidad. (op.cit.: 73). Los medios que instrument para llevado a la prctica y el escaso xito obtenido nos darn la pauta de la insuficiencia -o mejor an del peso- de sus preconceptos en lo que hace al abordaje del lenguaje y de la palabra. En otros trminos, muy lejos de que la experiencia pueda dar lugar a una teora del lenguaje, hay una teora previa de! lenguaje que se pone a prueba en los experimentos diseados stos a su vez, en funcin de los principios de esa teora. Vctor no slo hubiera aprendido un lenguaje sino fundamentalmente una teora del lenguaje, la de Itard. Puntualicemos las notas ms sobresalientes de esta concepcin, legibles en el enunciado mismo del citado objetivo: *El lenguaje es, de manera esencial, un medio de comunicacin. *Destinado ante todo a expresar las necesidades, la funcin del lenguaje es instrumental. *Las palabras son los signos de las cosas, a modo de etiquetas que los objetos llevan pegadas sobre s. *Nombrando los objetos de la realidad, la lengua es una nomenclatura. *El ser humano es exterior al lenguaje y se sirve de l como de una herramienta, a travs de la imitacin de aquel que sabe. En consecuencia, los mtodos de adiestramiento del lenguaje diseados por Itard son solidarios de la teora del lenguaje de que dispone, y es esta misma teora la que har obstculo al reconocimiento del autntico sentido de lo que al alumno le acontece. No sabemos si Vctor hubiese podido alcanzar la palabra y ello, no tanto por incompetencia mdica de su maestro, sino porque a ste le falta una teora del lenguaje ms ajustada que la de su poca. De todos modos, las Memorias de Itard refieren en este punto uno de los momentos ms dramticos del encuentro imposible entre maestro y discpulo. Un modo de activar la laringe -necesaria para el aprendizaje de la voz, segn entiende el maestro- por el apremio de la necesidad consista en acercarle un vaso lleno de agua gritando agua (en francs, eau) cuando el nio estaba sediento o en hacer circular el vaso con otra persona con la que se pronunciaba la misma palabra en cada intercambio. Pero todo fue en vano, "...el infeliz se atormentaba, agitaba losbrazos alrededor del vaso de manera casi convulsa, emita una especie de chiflido, pero no articulaba ningn sonido. Hubiera sido inhumano insistir. Por lo tanto, informa cambi de objeto pero mantuve el mismo mtodo." (op.cit:78). Ser el turno de la palabra leche (en francs, lait) de la que Itard espera su emergencia, cuando por la privacin del objeto leche, sirva de expresin a la necesidad. Sin embargo, Vctor sabe dar a entender, an sin palabras, que l quiere ese objeto del que se lo frustra, dado lo cual Itard bien podra haber concluido que si la comunicacin es posible sin el lenguaje es porque comunicar es slo una dimensin del lenguaje y no precisamente, la esencial. El maestro terminar por ceder y le acercar el objeto apetecido. Y es entonces cuando Vctor, contrariamente a lo previsto, pronuncia la palabra leche y la repite como jugando. Itard concluye que el nio hace un uso defectuoso del lenguaje, todo hubiera sido perfecto de
Este material se utiliza exclusivamente con fines didcticos. 7

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

16

haberla dicho antes de que le fuera concedida, as el objetivo se hubiera cumplido; de este modo se ha convertido en una vana exclamacin de alegra en lugar de ser el signo de una necesidad. "Vctor -plantea Itard- hubiera captado finalmente el significado verdadero de la palabra; se hubiera establecido entre nosotros un medio de comunicacin y a este primer xito le hubieran seguido una serie de rpidos progresos. En lugar de todo esto, slo haba obtenido una expresin, insignificante para l e intil para ambos, del placer que senta. Los resultados sucesivos que obtuve en esta falsa direccin confirmaron lo que tema. La mayora de !asveces, la palabra 'lait' slo era pronunciada mientras gozaba de ella. Algunas veces la pronunciaba antes, otras veces un poco despus, pero siempre sin intencin... Tampoco le adjudico un valor mayor al hecho de que tenda a repetir espontneamente la palabra y todava lo hace, en el curso de la noche cuando suele despertarse. (op.cit.: 78-79) (el destacado es nuestro). "Mientras gozaba de ella observa Itard, falto de otra teora del lenguaje y de otra concepcin de la infancia que le permitieran comprender que el nio, como todos los nios, gozaba no del alimento sino del juego con las palabras. Desengaado, considera un fracaso humillante sus esfuerzos de educacin en el habla y ve frustradas sus esperanzas de cumplir con el cuarto objetivo. Proseguir, por otros medios tambin inadecuados, la enseanza del lenguaje escrito. Ahora bien, sucede que paralelamente a las arduas horas de instruccin, acontecen otros hechos de suma importancia a los que Itard no presta inters alguno ya que se dan en tiempo de recreo y nieras. Mme. Gurin, la gobernanta que comparte con Vctor los momentos de juego y recreacin y que no tiene puesto en el nio ningn inters pedaggico, no es ajena a los pequeos pero significativos progresos que ste realiza pese a todo. Ocurre que el sonido lait ha constituido para Vctor la raz de otros dos monoslabos la y li a los que por supuesto Itard entiende, que el nio atribuye an menos sentido. Pero el monoslabo li ha sufrido una modificacin que consiste en el agregado de una segunda l pronunciada como el gli de la lengua italiana. "Se lo escucha repetir con frecuencia lli, lli con una inflexin de voz no privada de dulzura. (op.cit.: 79), anota Itard, quien reconoce en ello el nombre propio Julie, nombre de la hija de Mme. Gurin, nia de once o doce aos que vena los domingos a pasar el da con su madre. Durante ese da las exclamaciones lli, lli se hacan ms frecuentes y las pronunciaba an dormido. Sin embargo, Itard concluye "...que no se puede determinar con exactitud la causa y el valor de este ltimo hecho. Debemos esperar que avance la pubertad para que, con mayor nmero de observaciones podamos clasificarlo y tenerlo en cuenta. (op.cit.: 79). Su reflexin tiene el mismo alcance que las anteriores: sin el apremio de la necesidad sexual es irrelevante la aparicin del nombre propio de una nia; argumenta como si no supiera que los nios usan nombres propios antes de la pubertad. De todos modos, las preocupaciones del maestro relativas al habla cedern su lugar a la consideracin de las primeras manifestaciones de la pubertad en Vctor, manifestaciones que lo sumen en un estado de inquietud y turbacin. No sin turbarse, Itard espera con gran anhelo la emergencia de ese instinto natural pronto a desencadenarse y los fenmenos precursores de esa crisis moral. No ignora que dentro de su sistema, tambin la sexualidad podr ser integrada sin violencia a los dictmenes de la pedagoga y de la moral mdica. Dispone de un saber con el que suplir la ignorancia de la
Este material se utiliza exclusivamente con fines didcticos. 8

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

17

naturaleza, presto a entronizarse toda .vez que se anticipe un ser deseante. En su defecto, siempre quedar el recurso a la sangra. PARA CONCLUIR La ruptura con la Naturaleza y la irremediable prdida de lo natural; el quiebre con el orden biolgico, la anulacin de la particularidad de la necesidad y de las propiedades naturales del objeto son los efectos no contingentes que la captura por el lenguaje opera en el ser hablante. La prohibicin del incesto, universal como el lenguaje -y tambin como l, imperativa en su forma e inconsciente en su estructura- al imponer su reglamentacin, all donde la naturaleza abandona la alianza al azar, sella definitivamente el exilio del hombre del reino natural. En continuidad o en ruptura con la Naturaleza, las prcticas que se ubican bajo uno u otro trmino cargan sobre s -lo sepan o no- la impronta de esta opcin mayor. Ahora bien, si de las Memorias de Itard es posible extraer la enseanza del fracaso de su experiencia, por lo que sta debe a su adhesin en forma arbitraria y acrtica a una doctrina, y cuando ya las teoras en que se apoyaba han perdido su inters, no es menos cierto que sus mtodos continan impregnando las actuales prcticas reeducativas, pedaggicas y psicolgicas. La nocin de desarrollo, los clculos de cociente intelectual, los mtodos ms o menos velados de premio y castigo, la frustracin o la estimulacin con miras pedaggicas no slo han contaminado la educacin misma sino que adems se reactualizan constantemente en funcin del contacto con otros contextos discursivos. "Memorias" como las de Itard se escriben a diario en los protocolos de tests, los informes escolares y las evaluaciones psicofsicas. No sin olvidar, por otra parte, cuntas veces el furor educandis paga generosamente su deuda con la tradicin de los domadores de animales. (En este sentido, el cuento Yzur de Leopoldo Lugones -cuya lectura es por dems recomendableconstituye el contrapunto casi obligado de las Memorias de Itard) 2 . Entendemos que una tal supervivencia del mtodo no encuentra fcilmente su justificacin habida cuenta que la interpretacin del fracaso tcnico ya ha sido realizada por las ciencias educativas y que los preconceptos mdicos que lo sustentaban han sido ampliamente desmentidos. Sucede que la creencia que persiste, con la potencia del mito, por encima de las variantes educativas, es que se contina pensando al nio como el elemento natural y virgen que el Saber y la Cultura deben investir. Ligado su estatuto a la nocin de organismo biolgico y al ideal de crecimiento y maduracin, el nio comienza siendo un menor que gracias a los buenos oficios de la Educacin se convertir en un mayor; bien valen para la comparacin, las metforas botnicas o las zoolgicas que vehiculizan con fluidez los ideales que el adulto ha forjado con el objeto de sostener el mito de la infancia como dato natural. Pues la funcin de este mito de la niez es obturar el lugar que la infancia ocupa en la fantasa de los adultos. Sigmund Freud descubre el papel que el nio desempea en los fantasmas de los padres y en la palabra que presta a la realizacin de un deseo de ellos. La inmortalidad de los padres,
En otro trabajo hemos intentado demostrar que es posible entretejer una trama armoniosa entre la ficcin del relato de Lugones y el informe cientfico de Tirad porque hay congruencia entre los mtodos de adiestramiento del lenguaje que el amo de Yzur concibi para su mono y los que el Dr. Tirad para su alumno.
Este material se utiliza exclusivamente con fines didcticos. 9
2

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO Lectura sugerida - Dinouchi

18

negada por la realidad, se refugia en los hijos; el nio es el juguete ertico del deseo materno, es el soporte de la infancia de los padres y la recuperacin de su omnipotencia. Vctor no slo fue el objeto emprico de una teora sino que tambin ocup -atentos a su testimonio- un lugar en los fantasmas de Itard: la pubertad que anuncia sus signos en el alumno, reaviva en el maestro los sueos de su propia adolescencia y su curiosidad infantil. Pero entonces, lejos de ser una reserva natural y virgen, la infancia que un psicoanlisis permite construir est surcada por la huella del deseo de los padres, por la impronta de sus mandatos y por el peso de sus ideales, es decir, por la Cultura y la prohibicin que la instituye.

BIBLIOGRAFA Itard, Jean (1978): Memoria sobre los primeros progresos de Vctor del Aveyron en El salvaje del Aveyron: psiquiatra y pedagoga en el Iluminismo tardo. Centro Editor de Amrica Latina. Los fundamentos de las ciencias del hombre N 64. Buenos Aires. Lvi-Strauss, Claude (1981): Las estructuras elementales del parentesco. Paids. Barcelona. Mannoni, Octave (1969): ltard y su salvaje en La otra escena. Claves de lo imaginario. Amorrortu. Buenos Aires.

Este material se utiliza exclusivamente con fines didcticos.

10

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

19

CASSIRERUnaclavedelanaturalezadelhombre:elsmbolo En:ANTROPOLOGACULTURALMXICO,FCE,1968

El bilogo Johannes von Uexkll ha escrito un libro en el que emprende una revisin crtica de los principios de la biologa. Segn l es una ciencia natural que tiene que ser desarrollada con los mtodosempricosusuales,losdeobservacinyexperimentacin;peroelpensamientobiolgicono pertenece al mismo tipo que el pensamiento fsico o qumico. Uexkll es un resuelto campen del vitalismo y defiende el principio de la autonoma de la vida. La vida es una realidad ltima y que dependedesmisma;nopuedeserdescritaoexplicadaentrminosdefsicaodequmica.Partiendo de este punto de vista Uexkll desarrolla un nuevo esquema general de investigacin biolgica. Como filsofo es un idealista o fenomenista, pero su fenomenismo no se basa en consideraciones metafsicas o epistemolgicas sino que se funda, ms bien, en principios empricos. Como l mismo seala, representara una especie verdaderamente ingenua de dogmatismo suponer que existe una realidad absoluta de cosas que fuera la misma para todos los seres vivientes. La realidad no es una cosa nica y homognea; se halla inmensamente diversificada, poseyendo tantos esquemas y patrones diferentes cuantos diferentes organismos hay. Cada organismo es, por decirlo as, un ser mondico. Posee un mundo propio, por lo mismo que posee una experiencia peculiar. Los fenmenos que encontramos en la vida de una determinada especie biolgica no son transferibles a otras especies. Las experiencias, y por lo tanto, las realidades, de dos organismos diferentes son inconmesurables entre s. En el mundo de una mosca, dice Uexkll, encontramos slo "cosas de mosca",enelmundodeunerizodemarencontramosslo"cosasdeerizodemar". PartiendodeestesupuestogeneraldesarrollaVonUexkllunesquemaverdaderamenteingeniosoy originaldelmundobiolgico;procurandoevitartodainterpretacinpsicolgicasigue,porentero,un mtodoobjetivoobehaviorista. La nica clave para lavida animal nosla proporcionan los hechosde la anatoma comparada; si conocemos la estructura anatmica de una especie animal estamos en posesin de todos los datos necesarios para reconstruir su modo especial de experiencias. Un estudio minucioso de la estructura del cuerpo animal, del nmero, cualidad y distribucin de los diversos rganos de los sentidos y de las condiciones del sistema nervioso, nos proporciona una imagen perfecta del mundo interno y externo del organismo. Uexkll comenz sus investigaciones con el estudio de los organismos inferiores y las fue extendiendo poco a poco a todas las formas de lavidaorgnica.Enciertosentidoseniegaahablardeformasinferioresosuperioresdevida.Lavida es perfecta por doquier, es la misma en los crculos ms estrechos y en los ms amplios. Cada organismo, hasta el ms nfimo, no slo se halla adaptado en un sentido vago sino enteramente coordinado con su ambiente. A tenor de su estructura anatmica posee un determinado sistema "receptor"yundeterminadosistema"efector."Elorganismonopodrasobrevivirsinlacooperacin y equilibrio de estos dos sistemas. El receptor por el cual una especie biolgica recibe los estmulos externos y el efector por el cual reacciona ante los mismos se hallan siempre estrechamente entrelazados. Son eslabones de una misma cadena, que es descrita por Uexkll como "crculo funcional".13 No puedo entretenerme en una discusin de los principios biolgicos de Uexkll; me he referido nicamente a sus conceptos y a su terminologa con el propsito de plantear una cuestin general. Es posible emplear el esquema propuesto por Uexkll para una descripcin y caracterizacin del mundohumano? Esobvioque estemundo no constituye una excepcin de esasleyes biolgicasque gobiernan la vida de todos los dems organismos. Sin embargo, en el mundo humano encontramos una caracterstica nueva que parece constituir la marca distintiva de la vida del hombre. Su crculo funcional no slo se ha ampliado cuantitativamente sino que ha sufrido tambin un cambio cualitativo. El hombre, como si dijramos, ha descubierto un nuevo mtodo para adaptarse a su ambiente. Entre el sistema receptor y el efector, que se encuentran en todas las especies animales, hallamos en l como eslabn intermedio algo que podemos sealar como sistema "simblico". Esta nueva adquisicin transforma la totalidad de la vida humana. Comparado con los dems animales el hombre no slo vive en una realidad ms amplia sino, por decirlo as, en una nueva dimensin de la realidad.Existeunadiferenciainnegableentrelasreaccionesorgnicasylasrespuestashumanas.En el caso primero, una respuesta directa e inmediata sigue al estmulo externo, en el segundo la
13

Vase Johannes von Uexkll, Theoretische Biologie (2a ed. Berln, 1938); Unwelt und InnenweltderTiere(1909;2 aed.Berln,1921).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

20

respuesta es demorada, es interrumpida y retardada por un proceso lento y complicado de pensamiento. A primera vista semejante demora podra parecer una ventaja bastante equvoca; algunos filsofos han puesto sobre aviso al hombre acerca de este pretendido progreso. El hombre que medita, dice Rousseau, "es un animal depravado": sobrepasar los lmites de la vida orgnica no representa una mejora de la naturaleza humana sino su deterioro. Sin embargo, ya no hay salida de esta reversin del orden natural. El hombre no puede escapar de su propio logro, no le queda ms remedio que adoptar las condiciones de su propia vida; ya no vive solamente en un puro universo fsico sino en un universo simblico. El lenguaje, el mito, el arte y la religin constituyen partes de este universo, forman los diversos hilos que tejen la red simblica, la urdimbre complicada de la experiencia humana. Todo progreso en pensamiento y experiencia afina y refuerza esta red. El hombre no puede enfrentarse ya con la realidad de un modo inmediato; no puede verla, como si dijramos, cara a cara. La realidad fsica parece retroceder en la misma proporcin que avanza su actividad simblica. En lugar de tratar con las cosas mismas, en cierto sentido, conversa constantemente consigo mismo. Se ha envuelto en formas lingsticas, en imgenes artsticas, en smbolosmticosoenritosreligiosos,entalformaquenopuedeveroconocernadasinoatravsde la interposicin de este medio artificial. Su situacin es la misma en la esfera terica que en la prctica. Tampoco en sta vive en un mundo de crudos hechos o a tenor de sus necesidades y deseos inmediatos. Vive, ms bien, en medio de emociones, esperanzas y temores, ilusiones y desilusiones imaginarias, en medio de sus fantasas y de sus sueos. "Lo que perturba y alarma al hombrediceEpicteto,nosonlascosassinosusopinionesyfiguracionessobrelascosas." Desdeelpuntodevistaalqueacabamosdellegarpodemoscorregiryampliarladefinicinclsicadel hombre. A pesar de todos los esfuerzos del irracionalismo moderno, la definicin del hombre como animalracionalnohaperdidosufuerza.Laracionalidadesunrasgoinherenteatodaslasactividades humanas. La misma mitologa no es una masa bruta de supersticiones o de grandes ilusiones, no es puramente catica, pues posee una forma sistemtica o conceptual;14 pero, por otra parte, sera imposible caracterizar la estructura del mito como racional. El lenguaje ha sido identificado a menudo con la razn o con la verdadera fuente de la razn, aunque se echa de ver que esta definicin no alcanza a cubrir todo el campo. En ella, una parte se toma por el todo: pars pro toto. Porque junto al lenguaje conceptual tenernos un lenguaje emotivo; junto al lenguaje lgico o cientficoellenguajedelaimaginacinpotica.Primariamente,ellenguajenoexpresapensamientos oideassinosentimientosyemociones.Yunareligindentrodeloslmitesdelapurarazn,talcomo fue concebida y desarrollada por Kant, no es ms que pura abstraccin. No nos suministra sino la forma ideal, la sombra de lo que es una vida religiosa germina y concreta. Los grandes pensadores quedefinieronalhombrecomoanimalracionalnoeranempiristasnitrataronnuncadeproporcionar una nocin emprica de la naturaleza humana. Con esta definicin expresaban, ms bien, un imperativo tico fundamental. La razn es un trmino verdaderamente inadecuado para abarcar las formas de la vida cultural humana en toda su riqueza y diversidad, pero todas estas formas son for mas simblicas. Por lo tanto, en lugar de definir al hombre como un animal racional lo definiremos como un animal simblico. De este modo podemos designar su diferencia especfica y podemos comprenderelnuevocaminoabiertoalhombre:elcaminodelacivilizacin.

ACTIVIDAD:
1) Organiceunglosariocontodoslostrminosqueconsideredesconocidos. 2) Diseeunmapaconceptualendondequedenarticuladoslosconceptoscentralesdeltexto deCassirertomandocomoejeCrticaalaracionalidadcientfica. 3) BusquealmenosdoscoincidenciasconceptualesentreeltextodeCassireryeltextode Nietzsche 4) Enfuncindesurespuestaanterior,diseeunmapaconceptualquegrafiqueclaramentela relacindesincronaconceptualentreambasposiciones.

14

VaseCassirer,DieBegriffsformimmythischenDenken(Leipzig,1921).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

21

ELSUPUESTODELLENGUAJE
PROFESORAElisaCaruso Laconfianza Podramos sintetizar las dos actitudes caractersticas ante el lenguaje en trminos deconfianzaodedesconfianzahaciaelmismo;esdecir,enlaasuncindequeellenguaje trasuntaelpensamientoysteasuveztrasuntalarealidadoquenohacenadadeeso. En su semntica y especialmente en su sintaxis, toda lengua establece una ontologa, es decir nos dice qu hay en el mundo y cmo referirnos a l. Por esto la especulacinfilosficaacercadellenguajeescasitanvieja comolafilosofamisma.Como hemos ya visto, el concepto de logos se liga tan fuertemente al lenguaje que es difcil discernirlos.Serunanimalracionalhabasido entendidoengranpartecomosercapazde hablar y, por ello, de reflejar la realidad. El crculo cierra sobre s mismo porque as la realidad habla a travs del hombre. En este sentido el lgos ha signado nuestra relacin con el mundo en trminos bastante optimistas. De algn modo ha prevalecido la confianzaenellenguajeyensupoderlgico. Comienzalasospecha El lgos, lajusta palabra de razn, era tambin la garanta de la comunicabilidad del pensamiento, pensamiento que la tradicin ha privilegiado por sobre el lenguaje, entendidostecomoelmedioparaexpresarlo.Enelfondo,todalaconcepcinclsicadel lenguaje se ha planteado el problema del mismo como un problema de traduccin, el de latraduccindelpensamientoalaspalabras.Enellmiteextremoestaralaexperienciade lo inefable, experiencia que slo admite metforas, un discurso que frente al logos apophantiksparecefallido,mallogrado,defectivo. Por otro lado, la proliferacin infinita de los discursos posibles ha hecho pensar que es preciso controlarlos, rigorizar y disciplinar el lenguaje para evitar sus excesos y abusos. As lo entendieron, por ejemplo, los representantes del Crculo de Viena para quienes muchos problemas filosficos, especialmente aquellos problemas considerados metafsicos,tienensuorigenysereducenaproblemasdeabusosdellenguaje. En las antpodas de la posicin anterior se encuentran quienes han exaltado al lenguaje por encima del pensamiento racional. El lenguaje se revela plstico, creador, libre.Ellenguajesiempretieneposibilidaddeagregarunapalabranuevaqueseamsfiel, ms justa, ms abarcativa. Aqu la metfora no aparece como su defecto sino como su mayorriqueza.Cuandoeldiscursoracionalseagotaseabreeldiscursopotico. Signosysmbolos Los griegos ya haban advertido que en el lenguaje se juega muchas veces otro sentido, un sentido indirecto que se da a travs de otro directo que requiere de un desciframiento, de una interpretacin que no es ms que la inteligencia de ese doble

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

22

sentido. Los griegos llamaban a esto hiponoia y allegoria. El lenguaje, segn Foucault, no dice exactamente lo que dice. El sentido que captamos y que se manifiesta inmediatamente,nopuedesermsqueunmnimosentidoqueprotege,reduce,yapesar detodotransmiteotrosentidoelcualesalavezmsfuerteyelquesehallapordebajo.1 Esto es muy distinto de lo que se entiende por la funcin sgnica Un signo, seguimos aqu a Paul Ricoeur2, es un vehculo sensible portador de una funcin significantequehacequevalgaporotracosa.Elpapeldelsignoesrepresentar,ocuparel puestodeotracosa,evocndolaattulodesustituto(Benveniste).Unsignoestantoms eficazenlamedidaqueesunvoco. Adiferenciadelaanterior,lafuncinsimblicaestableceunarelacindesentidoa sentido.Lossmbolossonmultvocos,polismicos.Comoenlossueos,elsentidoliteralo manifiesto remite a otro latente, ms profundo. Esta relacin de sentido a sentido es una relacin de analoga3. La analoga simblica es el movimiento mismo del primer sentido hacia el segundo (Ricoeur). Es el movimiento de la metfora que ms que recoger una semejanza evidente, la funda. Pero, este movimiento no es inocente, dice Ricoeur, sino lleno de ardides y falsificaciones del sentido. De all que se precise una hermenutica, de unartedelasospecha,unateoradelainterpretacin,uncriptoanlisisqueesalavezun desafoalainteligencia. Nietzsche, Freud y Marx han sido los maestros del arte de la sospecha. Lo que estospensadorestienenencomnesqueenelloslossignossemuestranmalvolos.Ellos noshanenseadoasospechardelossignosinaugurandounanuevahermenutica.Enella el problema de la interpretacin se refiere a una nueva posibilidad que no es la del error en sentido epistemolgico ni el de la mentira en sentido moral, sino la ilusin. Los tres han luchado contra las mscaras.4 Segn Foucault ellos nos han permitido inaugurar una nueva forma de descifrar jeroglficos. Ellos no dieron un sentido nuevo a los signos sino que cambiaron su naturaleza. A partir de ellos, la interpretacin se ha convertido en una tareainfinitayestoporqueelprimerprincipiodelahermenuticamodernaesquenohay nada a interpretar ya que tras el signo no subyace un significado o un sentido que clausurara el movimiento de la interpretacin, ya que en el fondo todo es ya interpretacin, cada smbolo no remite a la cosa sino a otras interpretaciones. La interpretacinnoesclareceunamateriaainterpretar,queseofrecieraaellapasivamente. La interpretacin es siempre una violencia que debe desplazar a martillazos una
Foucault,M.Nietzsche,Freud,Marx.Bs.As.,EdicionesElcieloporasalto,1995. Ricoeur,Paul.Freud:unainterpretacindelacultura.Mxico,sigloveintiunoeditores,1970. 3 Noderazonamientoporanaloga.Noesunargumentoquepuedadominarseracionalmentepuestoque nopuedeconsiderarsedesdeafuera. 4 EnFreudtodounconjuntodesignos,lossueos,lossntomas,unaobradearte,aparececomotextoa descifrar.EnNietzschelaproblemticacentralesladelvalor,ladelorigendelvalorydelvalordelorigen.Es laproblemticadelaGenealogadelamoral.QuhaydetrsdelossagradosvaloresdeOccidente?Nada demasiadoprofundo:eltemoralavida.Laspalabrassiemprefueroninventadasporlospoderosos;no indicanunsignificadosinoqueimponenunainterpretacin.Freuddiceenunadesuscartas:Cadavezcreo menosamishistricas,lostraumasnosonsucesosreales,sonfantasas.MarxalcomienzodelCapital mostrarquenoexistenenigmasprofundosporquetodoloquehaydeprofundidadenlaconcepcindela burguesaprovienedelamoneda,delcapital,etc.,ynoesenrealidadsinosimpleza.Lostresmostrarnque laconcienciaesconcienciafalsa.
2 1

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

23

interpretacin que ya est all y que hay que destruir. El signo no es un ser simple y bondadoso.Elsignoesengaoso,malvoloporqueesunainterpretacinquenosedapor tal, que trata de justificarse. La hermenutica clsica haba sospechado que el nico ocultamiento que podan operar los signos era el de velar la realidad. Pero este velo es todavatransparente. Ahora bien, si tras los signos no hay un significado que sea originario sino ya una interpretacin, el movimiento de la hermenutica conduce al intrprete. La interpretacin ser siempre la interpretacin por el quin; no se interpreta lo que hay en el significado, sino que se interpreta a fondo: quien ha planteado la interpretacin. El principiodelainterpretacinnoesotroqueelintrprete...5

MaterialesdeUsodidctico AntropologaSocialyCultural

Foucault.Op.Cit.Pg.47.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

24

Lenguaje y realidad: soportes conceptuales


(Peter McLaren y Henry A. Giroux) 1

Para tratar algunos de los problemas que hemos subrayado en la seccin anterior, deseamos concentrarnos en la necesidad de un lenguaje terico ms abarcativo, capaz de concebir a las escuelas corno sitios complejos que no pueden entenderse solamente dentro de las modalidades de reproduccin de la teora de la resistencia. Parte del proyecto de transformacin de nuestra comprensin de las escuelas es la manera en que hablamos incluso sobre el proceso mismo de escolaridad. Esto, a su vez, involucra una lucha sobre el vocabulario terico y tico que empleamos para analizar la manera en que las escuelas funcionan en nuestra sociedad. Deseamos alegar que el propsito de desarrollar un lenguaje crtico de la escolaridad no es describir el mundo de manera ms objetiva, sino crear un mundo ms poderoso ticamente que induzca una mayor conciencia de la manera en que puede movilizarse el poder para lograr la liberacin humana. La teora crtica educacional necesita un lenguaje que entienda cmo se produce la experiencia, cmo se legitima y cmo se organiza en tanto aspecto central de la pedagoga. Debemos examinar el lenguaje y su produccin en tanto forma de argumento histrico; lo que es ms, necesitamos un lenguaje que sea crtico con respecto a sus propios mecanismos de autoridad. El lenguaje de la educacin crtica al que aspiramos es uno en el cual la diferencia sea considerada como sitio de afirmacin tanto como de reconstitucin, como una prctica crtica negociada y compleja en la que la posibilidad de una vida pblica democrtica se convierta en referente central, tanto de la crtica como de la posibilidad. Para entender mejor la escolaridad como un proceso culturalmente complejo, la empresa poltica es reconocer la naturaleza social del lenguaje y su relacin con el poder y con las formas del conocimiento. Esta relacin es crtica para entender las limitaciones de la manera en que actualmente interpretamos el rol de la escolaridad dentro de nuestra sociedad. Pero antes de explorar ese tema, es importante saber algo acerca de la manera en que funciona el lenguaje como mediador y como factor constitutivo de aquello que consideramos es la realidad. El primer punto que queremos acentuar es que el lenguaje constituye la realidad en vez de meramente reflejarla. En este caso, el lenguaje no se conceptualiza como una ventana transparente hacia el mundo sino ms bien como un medio simblico que moldea, refracta y transforma activamente al mundo. Es decir, el lenguaje es el medio primario a travs del cual se constituyen las identidades sociales, se asegura la hegemona cultural y se designa la prctica emancipatoria sobre cuya base se acta (Fraser, 1992). El lenguaje no es un conducto hacia un inmutable orden de coherencia y estabilidad, sino que es un agente generativo de la realidad que l mismo evoca y con la cual habla. Es el arche sycope, lo cual significa que el lenguaje es siempre distorsionante y distorsionado; invita a una variedad de interpretaciones y lecturas ms que resistirse a ellas (Parker, en imprenta). Desde este enfoque, el conocimiento es una construccin social; lo que significa que el mundo que habitamos como individuos est simblicamente construido por la mente (y el cuerpo) a travs de la interaccin social y depende fuertemente de la cultura, el contexto, la costumbre y la especificidad histrica (McLaren, 1988, 1989). Lo que esto significa, segn Richard Brown, es que debemos abandonar la bifurcacin entre lo literal y lo objetivo y lo metafrico, lo simblico y lo subjetivo, Brown (1987, p. 118) ha sealado que las realidades a las que se refieren los smbolos tambin son simblicas es decir, son concebidas por actores humanos y dentro de algn encuadre de visin compartido. Para Brown, al igual que para nosotros, esto sugiere que las palabras no son signos para las cosas, sino ms bien las cosas son signos para las palabras, ya que no existe una realidad social que no sea experimentada por medio de una matriz social de discurso. Aunque el lenguaje no es la nica fuente de la realidad (es evidente que existe un mundo no discursivo fuera del lenguaje), es en gran parte a travs de l que se crea el sentido. Esto significa que no hay ningn mundo ideal, monoltico, autnomo, prstino ni aborigen que pueda ser entendido fuera de la naturaleza social del lenguaje y al que nuestras construcciones sociales
1

Extrado de Desde los mrgenes: geografas de la identidad, la pedagoga y el poder, de Peter McLaren y Henry A. Giroux; Ediciones. en Peter McLaren: Pedagoga, Identidad y Poder. Los educadores frente al multiculturalismo, Homo Sapiens phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

25

correspondan necesariamente. Siempre hay un campo referencial en el que se sitan los smbolos, y este campo referencial particular (es decir, el lenguaje, la cultura, el lugar, el tiempo) ejercer influencia sobre la manera en que los smbolos generan significado. Tal como lo ha sealado Bakhtin (1981), el lenguaje est siempre poblado por los significados de otras personas, ya que siempre est traspasado de acentos e intenciones (p.293). En consecuencia, el lenguaje es incalificablemente subjetivo. El lenguaje marca al mundo con una presencia social que nunca es neutral ni deja de ser problemtica. El lenguaje no refleja una imagen impecable de la sociedad de all afuera; cualquiera sea la imagen o el objeto o el acontecimiento que pretenda expresar, siempre lo hace por medio de la refraccin y la distorsin. Esto no implica afirmar que el conocimiento es siempre falso sino ms bien que nunca es completo. Podemos decir, por lo tanto, que el lenguaje produce particulares comprensiones del mundo, es decir, significados particulares. Cuando el significado se produce por medio del lenguaje irreflexivamente al punto de quedar sedimentado en el conocimiento que es sentido comn -lo que llamamos ideologa- tiende a enmascararse como verdades fijas o hechos existentes con respecto al mundo social, como si esos hechos fueran inmunes a las relaciones particulares de poder o a los intereses materiales. El lenguaje, sin embargo, siempre est situado dentro de la ideologa y de las relaciones poder/conocimiento que gobiernan y regulan el acceso de comunidades interpretativas particulares a prcticas especficas del lenguaje. Y esto ocurre tambin con el lenguaje que nosotros, como educadores, empleamos con el propsito tanto de entender tericamente nuestro propio trabajo con los estudiantes como de ensearles. El significado de cualquier acontecimiento o experiencia slo est a nuestro alcance por medio del leguaje seleccionado por la comunidad interpretativa en particular con el deseo de hacer inteligibles esos acontecimientos y experiencias. El lenguaje siempre se localiza en los discursos o familias de ideas y el espectro de discursos es siempre limitado o selectivo, ya que la cultura dominante ha legitimado y ha vuelto aceptados ciertos discursos, desacreditando y marginando otros. El espacio de significado es siempre un espacio colonizado en el cual la necesidad ya ha sido inscripta por los cdigos culturales y el campo ms amplio de las relaciones polticas, sociales y econmicas. Por lo tanto, el lenguaje puede ser usado para enmarcar y legitimar diferentes lecturas del mundo. Es tanto un sntoma como una causa de nuestro saber cultural. Los educadores radicales han llegado a reconocer que no es la verdad lo que nos libera, sino la comprensin de que la verdad constituye los efectos de compromisos narrativos con el mundo; la verdad no es nunca independiente de las prcticas de lectura y de escritura que usamos para llegar a ella para decirla. La verdad al igual que los hechos- no es antecedente de nuestros esquemas interpretativos. La verdad depende de los vocabularios de interpretacin que tienen dominio provisorio y de una autoridad sostenida de manera contingente. No hay un solo discurso ni una sola comunidad discursiva que tengan la concesin exclusiva de la verdad. Los discursos no son auto-regulados, autoiniciados ni de funcionamiento autnomo. No hay ninguna realidad en s misma que no sea al mismo tiempo una realidad tal-como-la-vemos. La realidad se adapta a y es resultado de los lenguajes crticos que usamos para describirla. No hay ninguna corespondencia original ni absoluta del lenguaje con las verdaderas descripciones del mundo. La posibilidad de discurso misma presupone una multiplicidad de interpretaciones, una lgica de suplementariedad. Si no hay presencia de una alineacin de la representacin y de la manera en que las cosas son realmente, entonces todas nuestras descripciones son susceptibles de ser re-descriptas, recodificadas, desplazadas y re-ledas. Si es as, entonces cada lectura es tambin una lectura errnea. Si la verdad est subordinada a sus efectos y si toda la realidad textual puede ser colocada sous rature -incluyendo nuestras visiones de liberacin y de emancipacin -eso sugiere que debemos abandonar nuestras pretensiones de lograr la verdad y un lenguaje interpretativo purgado de distorsin y dirigir nuestros esfuerzos a cuestionar esas narraciones que justifican que un uno por ciento de la poblacin controle las vidas del resto, explotando su trabajo y colonizando su capacidad de resistir... de soar o de pensar de otra manera. 2

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

26

CULTURAYNATURALEZA. LABSQUEDADELAANTROPOGNESIS1.
ProfesoraElisaCaruso Esimposiblecomenzarconunadefinicindecultura.ComosealaNellySchnaith2, elusodelapalabraculturaadolece,engeneral,deunaimprecisinavaladaporlamisma amplituddelconcepto,origendeunapolisemiaquehaimposibilitadocualquierintentode definicin unvoca. Una distincin clsica podra en principio ayudarnos a delimitar su concepto. Se trata de la diferencia entre naturaleza y cultura, diferencia que arraiga tambinenunaviejatradicin.Elhombrequenohapodidososlayarsu propiayevidente realidad biolgica tampoco se ha considerado a s mismo como un animal ms. En consecuencia, ha dirigido grandes esfuerzos a comprender la relacin entre lo humano y la naturaleza. A lo largo de la historia, la comprensin de esta relacin ha ido variando desde la oposicin radical, pasando por la afirmacin de una evolucin continua, hasta la necesidad de la disolucin de la dicotoma como parte de un paradigma perdido (Edgard Morin).3
SigoenlneasgeneralesyamplioloyapublicadoeneltrabajoLacienciacomofuerzaestructurantedel presenteencoautoraconMalenaLasala,enGuiber,(ed.)Ciencia:uncaminoentrecontinuidadesy rupturas.Bs.As.,Biblos,1996.Pgs.25ysgtes.AgradezcoalaProfesoraLasalaquepermitierasudivulgacin enestasfichasdectedra. 2 Schnaith,Nelly.CondicinculturaldeladiferenciapsquicaentrelossexosenAA.VV.Labella (in)diferencia.Mxico,SigloXXI,1991. 3 Han existido posiciones que, partiendo de una oposicin radical entre ambos trminos han negado a uno uotro.Veamos: 1. La cultura es la segunda naturaleza. La cuestin tiende a plantearse en trminos de pasaje. El paso dadopor el hombre hacia el abandonode las formas de la vida animalno tiene retorno. Elhombre no puede escapar a su propio logro. Para algunos, con la cultura el hombre ha producido una desnaturalizacin o degeneracin , para otros, que valoran el pasaje positivamente, ha progresado.. Esta manera de entender la relacin es comn a las narraciones mticoreligiosas (mito del paraso perdido) y a las racionalizaciones de las mismas que subyacen a muchas teoras delorigendelestado(Hobbes,Rousseau). 2. Para los biologistas, slo existe la naturaleza. Lo social y cultural no es ms que una astucia de la naturaleza en la lucha por la sobrevivencia de la especie. Hasta las conductas ms refinadas y aparentementeespiritualestienensuorigenyexplicacinenlosinstintos,enpatronesdeconducta adquiridos por la especie a lo largo del proceso de evolucin. Las diferencias entre lo animal y lo humanonosonesencialesnicualitativamentediscernibles.Sonensugranmayoraslodiferencias cuantitativas, de grados de inteligencia. La inteligencia misma y el conocimiento no tienen un estatutoespecial.Sonslomecanismosadaptativosdeuncomnmecanismobiolgicodeensayoy error. Esta respuesta biologista es comn a algunas interpretaciones evolucionistas, a la sociobiologayaalgunascorrientesdelaetologa. 3. Una tercera manera de entender la cuestin plantea que en tanto la cultura es la condicin de lo humano, es en s misma la verdadera naturaleza del hombre. La cultura es el modo en que la
1

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

27

La idea de naturaleza tambin posee una enorme complejidad, herencia de una amalgamadeaspectoslargamentereunidosdesdelosalboresdelacivilizacinoccidental. Alapreguntaporlanaturalezaesposibleofreceralmenosunparderespuestas: 1 La tradicin griega, a partir de la segunda mitad del siglo V, la habra asimilado a la Physis, al conjunto de seres no creados por el hombre unido al sentido previo de totalidad de lo que tiene en s su propio origen. En consecuencia, las oposiciones radicales se establecen entre physis y nomos, la convencin social, y entre physis y techne,la capacidad humana de producir desde un artefacto hasta una tragedia o undiscursoeficaz.Peroelhombredebetenerenlaphysissuinspiracin y su ideal. Imitar la naturaleza es la mxima que en gran medida dar direccinalhaceryalobrarhumanos. 2 La concepcin judeocristiana significar un punto de ruptura respecto de la armnica visin de los griegos. La naturaleza ya no se definir por su rasgo positivo, sino por el negativo: naturaleza es lo otro de Dios, el reino de lo creado pero que no se confunde con su Creador. El hombre, serintermediocreadocomopartedeella,debesuperarlahastamerecer la dignidad de haber sido hecho a imagen y semejanza de Dios. La oposicin y no la continuidad organiza un deber ser que girar en torno del dominio de esa otredad que para el hombre mismo aparecer comounaescisinentresucuerpoysualma,entresurealidadbiolgica ysuespritu,entreloanimalylohumano,entrelatierrayelcielo. Ambas concepciones coinciden en entender que, en la dimensin de exterioridad, lanaturalezaaparececomounteatroenelquesedesenvuelveeldramadelohumano. En su dimensin temporal, la naturaleza ha sido concebida tambin como un estado previoaldelingresoalacultura.Tantoslosmitosdendolereligiosacomolosmitoslaicos que constituyen su racionalizacin en especial aquellos que han pretendido servir de legitimacinalosorgenesdelestadohansostenidoque,antesdelaentradadelhombre enlasociedadcivilopoltica,aqulhabravividoenuncontactodirectoconelmundo,las otras especies y los otros hombres. La sociedad y la cultura podrn aparecer desde entonces como fuerzas represivas para una naturaleza humana presuntamente violenta o presuntamentemansarespectivamente.ElEstadoysupodersejustificancomofrenoala maldad natural (Hobbes),o bien el Estado y la sociedad deben ser limitados por su opresincorruptoradelasbuenasdotesnaturalesdelhombre(Rousseau) Seacualsealaposicinqueseadopte,esprecisocomprenderquelanaturalezano es una realidad que se ha dejado atrs o afuera de la cultura4, que el pasaje, tal como
MaterialesdeUsodidcticoAntropolo naturaleza del hombre se despliega y manifiesta. La cultura est en funcin de la naturaleza (Funcionalismo). La cultura viene a compensar la natural debilidad biolgica. El hombre es una especie mallograda que requiere de un sistema artificial compensatorio con el que suplir las deficiencias de su naturaleza fallida. La naturaleza humana se compone de un repertorio de necesidadesbsicascuyasatisfaccinsercultural. 4 Lanaturalezacomoexterioridaddelaculturaesconcebidacomolapartedelambientenocreadao modificadaporelhombreyrecprocamentesevealaculturacomolapartedelambientecreadaporel

MaterialesdeUsodidctico AntropologaSocialyCultural

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

28

sostiene Schnaith, no es un hecho relegado a un pasado mtico sino un dilema siempre actual, constitutivo de la dimensin humana en cuanto tal; que la cultura, orden de lo simblico,noesunavatardelhombrenaturalsinoque,por locontrario,lanaturaleza,en el ser humano es un modo de ser de su propia cultura o de su estado cultural. La naturalezanoesunadimensinquelaculturahadejadoatrssinounainstanciainteriora la cultura misma y, bajo este aspecto, la experimentamos y la pensamos como uno de los objetos culturales.5 La naturaleza es interior a la cultura en un doble sentido: en primer lugar, la cultura se construye sobre la base biolgica de las sujetos que la componen y deber proveer de uno u otro modo a su conservacin y reproduccin. En segundo lugar, no hay cultura que no se plantee desde su propio interior lo otro de la cultura, la naturaleza, pero construida a veces como una fantasa de los orgenes a los que se aora regresar, otras veces como aquello que es preciso imitar y no contradecir ni violentar; en otros casos, aquello que debe ser dominado en el cuerpo mismo de los hombres, caballo deTroyadelasfuerzasexterioresalacultura,paraponerloalserviciodelavidahumana.6 En sntesis, la naturaleza, lejos de ser un dato inequvoco del que partir para comprender por oposicin a la cultura, resulta definida e interpretada por la cultura misma. Es sta la quesiempreproporcionaunauotrainterpretacin:msquenaturaleza,siempretenemos unaciertaideadeella7. Liberada as la cultura de su aparente antagonista, trasmutada la naturaleza tambinencultura,debemoshacerreingresarlapreguntaporlacultura. En primera instancia, al haber negado un estado de naturaleza previo a la cultura,nocabeplantearselahiptesisdeunhombreencontactodirectoconlascosas.El hombre no vive en un mundo fsico sino en un universo simblico (Cassirer). Como seala JosLoriteMena,lasimbolizacineslamediacininterpretativaconlascosas,elhombre no pertenece a un mundo de cosas sino que existe en una nocinde realidad que recompone la ruptura con la inmediatez entre individuo y entorno. Las cosas no solo son estmulossinoquesehancargadodesignificacinyesyaestasignificacinloquelehace al hombre signo. El mundo estalla as en polisemia, en un orden de sentido no biolgico que implica un distanciamiento con las cosas en s para hacerlas realidad en el interior de una totalidad significativa, esto es, la cultura. Cultura es entonces la condicin de lo humano en tanto humano. No hay hombre sin cultura y es por esta razn que en el hombre lo vital no nunca slo lo biolgico. Ahora bien, si las cosas no simplemente se les
mismo(Willey1927)Sevinculafuertementealanocindemedioambienteysereconocequeesesta dimensinlaqueesfuertementedefendidaporelpensamientoecologista.Aquseplateaelproblemadela relacinticaconlasotrasespecies,elproblemadelderechodelhombredeexplotarlaydominarla,etc. 5 Schnaith,N.Op.cit. 6 La naturaleza no ha quedado atrs en el tiempo como un estado previo a la cultura sino ms bien ha sido incorporada a ste como una instancia interior a la cultura misma porque, adems, en tanto la cultura se construye sobre la base biolgica de los sujetos que la componen, deber proveer de algn modo a su conservacin.
7

MaterialesdeUsodidctico AntropologaSocialyCultural

Esprecisosealarentonceselcarcterideolgicodecualquierafirmacinquepretendalegitimarse apelandoaunpresuntoorigennatural.Laideologaocultaelcarcterconvencional,socialyculturaldela ideamismadenaturaleza.Esideolgicotododiscursoquenaturalizasuobjeto,setratedefunciones vitales(parto,sexualidad,gnero,porej.)odelasinstitucionessociales(familia,sociedad,estado).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

29

presentan al hombre sino que ste las representa, si el sentido de estas representacionesprovienendelaculturadeesemundoyaconfiguradoporunasociedad que es previa al individuo, si adems de estimularnos las cosas lo hace tambin el significado que stas han adquirido en la cultura, entonces el saber, en su sentido ms amplio y general8, como el orden de lo ya sabido, representado y conocido, es consustancialalaculturaeindiscernibledeella. Lastresdimensionesdelacultura SiguiendonuevamenteaSchnaith,podemossistematizarlasdistintas manerasenlasque ha sido comprendida la cultura de modo no excluyente como tres dimensiones de la misma.Asaber: La cultura como experiencia vivida: esta dimensin hace referencia a la forma de vida de un pueblo. Aqu la cultura no es vista como dique o freno de la naturaleza humana, sino msbiensuexpresinsocialdirectamenteintuida,sinreflexin,enlasmanifestacionesen que la cultura da rienda suelta a la naturaleza como costumbre. Nietzsche podra ejemplificarestamaneradeentenderlo. La cultura como dimensin conciente de la vida social: aqu la cultura abarca el acervo espiritual de un pueblo plasmado en las realizaciones como espritu objetivado. El mito, el arte, la religin, las formas de pensamiento, etc., constituyen el espejo privilegiado en los que un pueblo puede reflexionarse y comprenderse. Ernst Cassirer ha enfatizado este aspectodelaculturacomoconjuntodeformassimblicas. La dimensin no conciente de la cultura: en este plano se ubican las convenciones estructurantes de la cultura, aquellos actos cuyo origen convencional y cultural se desconoce y pasan a ser considerados precisamente como naturales. La raz de estas convenciones fundantes ha sido situada en el tab del incesto. Freud y luego LeviStrauss han destacado este aspecto y han situado all el pasaje que trasmuta el instinto en una fuerzasocial.Estasconvencionesinstauranunordennobiolgicoaunquevital.Eselorden de lo simblico que establece y estipula lo que cada grupo humano considera precisamentelohumano. Eldeseocomoclavedelacultura. Muchos autores, en el intento de encontrar una caracterstica antropognica, esto es que explique lo humano en tanto humano, que sea su razn de ser y no meramente una prolongacin de las cualidades ya encontradas en la escala zoolgica, han visto en el deseo el componente diferenciador. El hombre se revela y constituye a s mismo y a los otros en y por el deseo. En el deseo, lo deseado se revela como un noyo y por lo tanto, haceconcientealyo. Hegel (17701831), en la seccin de la autoconciencia de La fenomenologa del espritu, narra esta fase de la experiencia de la conciencia humana que en este punto se ha distanciado de su raz natural primitiva y busca la verdad de la certeza que tiene de s,
8

MaterialesdeUsodidctico AntropologaSocialyCultural

Nosloelpensarracionalsinoelpensarencualquieradesusmanifestacionesyformas.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

30

certeza de ser no meramente un animal sino autoconciencia, saber de s, saber que sabe, sujeto.Buscaenprincipioenelgocedelascosassensiblesperoprontocomprendequees en vano buscar su verdad en las cosas. Es decir, no es en el disfrute comn al animal que puede obtener su verdad. Descubre que slo otra autoconciencia puede proporcionar un fundamento objetivo a su certeza subjetiva y por ello debe lograr el reconocimiento de la otra autoconciencia contrapuesta. Se desata as una lucha por el reconocimiento, lucha a muertepuescadaunapretendeserreconocidasinreconoceralaotra.Cadaunaquierela muerte de la otra aunque ninguna de las dos muere. Sin embargo una resulta ser amo, pueshaenfrentadoelriesgoabsoluto,sehajugadolavida;laotrahadevenidoesclava,ha retrocedidoantelamuerte,elamoabsoluto. Pero se opera una inversin dialctica. El amo que se vincula con la cosa a travs del esclavo slo se relaciona negativamente es decir, destructivamente con ella en el disfrute.Adems,quedaapresadoenelreconocimientodeunaautoconcienciainesencial; es reconocido por un esclavo, alguien carente de libertad y, en consecuencia, no verdaderamente humano. El esclavo, que vive en la angustia y el temor del amo, el estar obligadoaltrabajoobtienedelascosaselconocimientodes,suautoconciencia.Sabeque eneltrabajoobjetivasuesenciaenlascosaspuesstasdejandesernaturalezaypasana formar parte del mundo humano de la cultura. Se inicia as el camino de la formacin cultural, de la bildung que se desarrolla en el pensamiento y en el mundo objetivo como praxistransformadora. ComosntesispodramoscitarlasexpresionesdeN.Frye: La cultura no es simplemente imitacin de la naturaleza sino un proceso de construccin de una forma humana total mediante elementos de la naturalezay depende de aquella fuerza que hemos llamado deseo. El deseo de alimento y de casa no se apaga con las races y las cavernas: produce esas formas humanas de naturaleza que llamamos cultivos y arquitectura. El deseo no es por tanto una simple respuesta a la carencia porque un animal puede necesitar alimento sin plantar un jardn para conseguirlo ni deseo de algo particular. No est ni limitado a los objetos ni es satisfecho por ellos, sino que es una fuerza que gua a la sociedad humana en el desarrollo de su forma peculiar... Laformadeldeseoesliberadayvueltamanifiestaporlacultura.(AnatomyofCriticism).

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

31

CULTURA
La cultura como concepto central de la Antropologa
Ariel Gravano Sentidos amplio y restringido de cultura Ya que el objeto de estudio de la Antropologa ha quedado definido como la otredad cultural y se ha identificado a la alteridad como eje de ese objeto, nos ocuparemos ahora del segundo componente de la ecuacin: lo cultural o, con mayor precisin, del concepto de cultura, tomando en cuenta tanto sus usos ms corrientes cuanto la forma como lo trata el enfoque antropolgico. Para qu puede servir hablar de cultura? Por qu la Antropologa puede aportar al enfoque de problemas mediante el uso de este concepto? [] Vamos a contextualizar el momento en el que surge la nocin de cultura en general y su sentido antropolgico en particular. [] Un concepto se define por el foco o conjunto de fenmenos a los que refiere. Los antroplogos decimos que cultura es lo que el hombre crea y produce, un modo de vida, o el conjunto de representaciones y prcticas de todo grupo humano. Este sentido amplio del concepto proviene de la definicin clsica del antroplogo ingls Edward Tylor (1871): cultura... es aquel todo complejo que incluye el conocimiento, las creencias, el arte, la moral, el derecho, las costumbres y cualesquiera otros hbitos y capacidades adquiridos por el hombre.... Pero, tambin hay otro uso, ms corriente y ms restringido: el que considera que la cultura est compuesta por ciertas y especiales manifestaciones y comportamientos, como las artes plsticas, la escritura y literatura, la educacin, la msica, la danza, la poesa, el cine, la comunicacin meditica, los espectculos. A su vez, todo concepto se define por oposicin a otros fenmenos que no refiere, en este caso a lo que no es cultura. En cuanto al sentido antropolgico que vimos recin, lo opuesto a la cultura sera lo que pertenece a la naturaleza, lo que el hombre tiene como animal, su fsico, su funcionamiento orgnico. Y en cuanto al otro sentido, cultura se distinguira del sistema o estructura econmico-social, el sistema poltico, la tecnologa industrial, para citar algn ejemplo. Estos dos sentidos de cultura -amplio y restringido- no se distinguen solamente porque el primero abarca una realidad ms total (todo lo que el hombre hace) y el segundo una ms reducida (cierto tipo de obras), sino porque conforman dos perfiles de una misma moneda, ya que -como veremos- nada de lo que el hombre hace deja de tener un carcter significante, y esto nos da pie para comenzar a abordar la complejidad del fenmeno y los interrogantes ya citados. Surgimiento del concepto: modernidad y expansin colonial Cultura es una categora conceptual, una construccin que surge en determinado momento histrico y que va modificndose segn diversos usos. Su matriz original es la poca del Iluminismo, a la par de otras nociones y otras palabras que emergen dentro del pensamiento de la Modernidad para encarar determinadas cuestiones no vistas hasta ese momento como tales o no tenidas en cuenta. Es lo que pasa con humanidad e ideologa: junto a cultura, apuntan a definir el fenmeno humano en forma autnoma y ya no como algo dependiente en sus determinaciones de la Providencia Divina o como algo degradado respecto de sta. Lo humano se va constituyendo como un objeto de reflexin a partir de la ruptura con el paradigma del pensamiento hegemnico medieval, previo a la Modernidad, en el que prevalece la argumentacin mstica para explicar el mundo. Las necesidades de las relaciones capitalistas de produccin (en cuanto al desarrollo de la tecnologa, los procesos sociales y de trabajo) impulsan a explicar el mundo como algo racional, analizable,

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

32

manejable y, sobre todo, previsible, con precisin y garanta de optimizacin de resultados y ganancias. Por eso comienza a perfilarse el racionalismo como la forma de pensamiento ms acorde con esos intereses, en puja con las posturas mstico-absolutistas que defendan el rgimen feudal. No es casual que coincida esto con la ponderacin de la Razn como herramienta distintiva de la comprensin y accin del ser humano respecto del mundo. Desde el pensamiento moderno, cientfico, secular, las causas del acontecer histrico van a ir a buscarse, entonces, tambin en los actos de los hombres, tanto los que se definen como materiales o prcticos cuanto los espirituales. Vemos que en esta ltima palabra se refleja parte del antiguo paradigma, que escinde -como seala Nstor Garca Canclini- un viejo divorcio: entre lo material y lo espiritual, el cuerpo y el alma, el trabajo y la conciencia (Garca Canclini 1981:9). Esta separacin, reproduce en el campo terico la divisin de la sociedad en clases: de un lado, la actividad -material- de apropiacin y transformacin de la naturaleza; del otro, la traduccin simblica -ideal- de esas operaciones concretas (bid). A esto se suma que la expansin colonial europea haba producido nuevos interrogantes o bien nuevas respuestas a interrogantes previos. Una de esas cuestiones era si deba concebirse a los seres humanos como conformando una unidad y, si era as, cul de las sociedades conocidas hasta el momento era la ms perfecta y modelo a seguir. El prejuicio generalizado en el pensamiento eurocntrico colocaba a las sociedades capitalistas mercantiles y en proceso de producir la revolucin industrial como ideal de ese modelo. Este es el terreno desde donde surgirn, en consecuencia, las ciencias humanas y sociales. La paradoja es que cuando el podero econmico, militar y organizativo de Occidente logra la expansin y encuentra la amplia diversidad de imgenes de los Otros, comienza a surgir la pregunta por los componentes comunes que pudieran hacer posible hablar de una sola Humanidad. La diversidad pone en el tapete, entonces, la cuestin de la unicidad humana. La Antropologa dir lo suyo cuando enuncie la nocin de unidad psquica de la especie humana en su conjunto. La cultura emerge, entonces, como una categora construida en gran medida a partir de esta nueva problemtica que planteaba la expansin colonialista y su correspondiente visin del mundo: el cruento y asimtrico encuentro con la diversidad respecto a Occidente, con los otros. Lo que interesa puntualizar aqu es que la diversidad estuvo representada tanto por el aspecto fsico de los otros como -y principalmente- por las distintas formas de comportamiento, de prcticas rituales, de sistemas de creencias, de valores, de smbolos, en suma, de culturas. La cultura como tesoro de signos En realidad, la cultura del hombre -como fenmeno- existe desde que el hombre es hombre y produjo el primer artefacto, como se vi cuando estudiamos los procesos de hominizacin y humanizacin. Pero la palabra cultura aparece en 1750 (pleno Iluminismo), enunciada por el estadista y filsofo francs Anne Robert Jaques Turgot: cultura es -dice- el tesoro de signos que constituye la herencia social de la Humanidad1, que propende, a la reproduccin de los hombres sobre la base de la transformacin de la naturaleza. Con la expresin tesoro de signos se sintetizaba lo que nosotros hoy englobamos en la nocin de cultura en un sentido amplio, que incluye bsicamente el lenguaje, sus imgenes materializadas en relatos, conos, gestos, que aluden a valores, metforas, smbolos, y que se atesoran precisamente porque los grupos sociales (y en conjunto la Humanidad, dir Turgot) le asignan valor, sentido y necesidad de preservarlos. Mitos, creencias, tabes, cultos, ideas, recetas, sistemas de clasificacin, transformados tambin en prcticas: ceremonias, ritos, oraciones, cantos, formas de conseguir y tratar el alimento, criar a los
1

MaterialesdeUsodidctico AntropologaSocialyCultural

Poseedor de un tesoro de signos que tiene la facultad de multiplicar hasta el infinito, el hombre es capaz de asegurar la conservacin de las ideas que ha adquirido, de comunicarlas a otros hombres y de transmitirlas a sus sucesores como una herencia constantemente creciente, deca Turgot [1750] (en Harris 1978: 12).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

33

nios, de saludar, de considerar a los mayores, a las mujeres, a los hombres, todo de acuerdo con valores implcitos o expresados pblicamente. Lo que nosotros incluimos en el conjunto de representaciones simblicas que refieren a significados compartidos y a prcticas llevadas a cabo en forma regular precisamente por estar valoradas culturalmente. La primera asociacin es con la nocin de cultivo; esto es: lo que hacen o producen los hombres, lo que no es natural. Y un eje inicial constitutivo del concepto puede ser sealado por esta distincin entre herencia social y herencia biolgica. Esta ltima es lo que los hombres -a nivel de su especietienen en comn con el resto de los seres vivos. Pero la cultura, los signos, hacen que los hombres se diferencien cualitativamente del reino de lo puramente orgnico, constituyendo un algo ms, que el componente biolgico no puede explicar. A ese algo ms, la cultura, cada generacin debe aprenderla en su totalidad, ya que no se recibe por legado gentico. De acuerdo con esta nocin inicial, todos los hombres son igualmente capaces de producir cultura, poseerla, transmitirla y fundamentalmente renovarla, ya que en la cultura no hay copia; siempre implica innovacin, porque el signo es eso: un resultado de la relacin dialctica entre algo familiar (p.e. el significante, la forma) y algo nuevo: el efecto de significado que puede tener en los receptores. Por eso la cultura es un terreno de interminables interpretaciones de esos signos que, para mayor precisin, llamaremos smbolos2. Hablar de smbolo (o de representacin simblica) implica situarnos en el salto cualitativo que da nuestra especie en su ruptura con lo dado de su naturaleza. El smbolo se constituye por sustitucin respecto de un referente real o imaginario: cualquier palabra remite a una cosa, a un estado, a algo que acta de referente de lo que la palabra misma significa. Pero el smbolo slo re-presenta (vuelve a presentar), no es esa cosa, estado o situacin, sino que, por medio de la abstraccin y la sntesis, es posible incluir en l numerosos casos particulares de referentes que se condensan en el mismo smbolo y hacen posible la comunicacin y la comprensin. Adems de la representacin, la cultura incluye los modelos o convenciones en que los hombres hacen todo, incluyendo sus actividades ms ligadas a lo orgnico y natural, como las formas y normas para comer, vestirse, unirse sexualmente, ms que ingerir alimentos, abrigarse o reproducir la especie. En otras palabras: en ninguna cultura los seres humanos solamente se nutren, se abrigan o se reproducen: siempre a cada una de esas actividades se les da una significacin, que implica gustos, identidades, orgullos o desprecios compartidos, normas sobre lo que hay que comer y cmo y en qu momento; qu ponerse sobre el cuerpo y sobre lo que no hay que hacer con l para no recibir las burlas del conjunto (resultado de la perplejidad). Y los actos sexuales no dejan de estar regidos por tabes (eso no se hace, eso no se toca, eso no se dice, con se o aqulla no, etc.) y valores ponderados (econmico, sentimental, esttico, etc.). La cultura, entonces, implica hablar de prcticas y representaciones simblicas, acciones de vida que adquieren significacin establecida por los actores que las comparten y no sentidos dados en forma natural. Y adems implica el establecimiento de modelos que sirven para la accin, que actan como parmetros para la atribucin de esas significaciones y valores. La cultura como transformacin de lo natural La produccin de significados y sentidos tiene una inherente relacin con la cultura como transformacin []. Desde esta perspectiva, la produccin (material y simblica) es el rasgo humano

MaterialesdeUsodidctico AntropologaSocialyCultural

La constitucin misma de la cultura en el reino de lo simblico implica situarnos en el terreno de lo arbitrario y lo convencional, de lo que no tiene un sentido natural o fijo, como podra ser el sentido de las seales que sirven para establecer la comunicacin entre los animales, sino sentidos construidos en forma explcita o implcita como valores de esa cultura.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

34

por excelencia.3 Desde el surgimiento del hombre, todos sus actos han devenido productos, en donde lo meramente vital se ha desgarrado bajo la infinita formacin y transformacin de la naturaleza en cultura. Y es necesario resaltar que nada de lo material deja de adquirir significacin simblica y ningn smbolo puede manifestarse sin un soporte material. Podemos afirmar que la cultura se constituye por oposicin y transformacin de la naturaleza. [], como especie, en esta doble dimensin entre lo natural y lo cultural, nos pasamos todo el tiempo tratando de conocer las leyes naturales para contradecirlas. Es como si la contra-diccin (decir en contra) fuera nuestra ms especfica forma de comportarnos4. Para crear cultura, el hombre contradice a la piedra, para que deje de ser solamente piedra y pase a ser un instrumento que le permita cazar un animal y abrigarse y alimentarse. As se adapta a los ms variados climas sin cambiar su naturaleza, sino mediante sus herramientas, su cultura. Y hoy manda naves a las otras galaxias aplicando este mismo principio de la contra-diccin. Esta oposicin conceptual entre naturaleza y cultura, entonces, resulta bsica para comprender no slo sta ltima nocin sino tambin para situar el primero de los eslabones que constituyen al ser humano como tal: ser productor de cultura a partir del principio de contradiccin. La oposicin a lo natural, como lo dado, mediante el trabajo de la cultura, mediante las prcticas materiales significativas, implica la constitucin del hombre como ser histrico. Por eso la Historia resulta ser una contienda continua con lo dado, con lo que aparece como natural, como naturalizado dentro de las representaciones del mundo, como lo que se preconcibe como la naturaleza de las cosas, con lo que niega a la cultura ese carcter bsico de ser ruptura con lo dado. La cultura como arena de lucha por los significados: dominacin y hegemona Si decimos que los significados o sentidos no son algo dado sino construcciones permanentes, tambin tenemos que tomar nota que en las culturas siempre se establecen -como afirmamos recin- modelos de lo que hay que hacer, decir, etc. Los monumentos nos dictan a quines debemos venerar y recordar como modelos de accin para el futuro. Los himnos nos dictan a qu smbolos debemos atenernos para mantener una cierta identidad. Las ceremonias y ritos nos dictan qu debe repetirse, evocarse, mantenerse. Estas seran funciones de la cultura que tienden a la reproduccin, a la actualizacin y representacin de ciertos valores, ciertas ideas y no otras. Y hemos repetido la palabra dictar porque precisamente esos dictados son mensajes que apuntan a la reproduccin porque representan intereses que tratan de imponerse, conservarse, mantenerse. Y esto es as porque esos valores o ideas a mantener estn en riesgo de perderse o son cuestionadas, contradichas. Si no, no habra necesidad de invocar su conservacin en una cultura. Ningn signo se mantiene o se trata de mantener de modo inercial, sin una razn histrica, sin un inters y una racionalidad que lo motoriza. Esta racionalidad puede manifestarse hasta en un gusto artstico, por ejemplo, musical. Cunto de nuestra identidad se construye alrededor de nuestros gustos musicales y de nuestros artistas preferidos? Cuntas veces en un festival se establecen bandos que pujan por el mantenimiento en el
3

MaterialesdeUsodidctico AntropologaSocialyCultural

El concepto de trabajo de Marx y Engels es el equivalente a la base de la produccin humana, pero no se reduce ni al trabajo ni a la produccin como los entiende la economa capitalista, como mercanca. Lo que hoy se llama trabajo no es ms que un fragmento diminuto y miserable de la formidable y poderossima produccin La moral mercantilista aleja al trabajo de la totalidad de los matices que tiene la vida humana, incluida la diversin y el placer, a pesar de que tambin eso es producir (Marx & Engels: La Ideologa Alemana), con lo cual el trabajo queda entendido dentro de la cultura en su sentido integral. La vida consiste precisamente en que un ser sea al mismo tiempo, en el mismo instante, el que es y otro. La vida no es, a su vez, ms que una contradiccin albergada en las cosas, y en los fenmenos y que se est produciendo y resolviendo incesantemente: al cesar la contradiccin, cesa la vida... (Engels: Anti Dhring; 127).
4

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

35

escenario de su artista en desmedro de los otros? Bien, pensemos -parafraseando irreverentemente a Turgot- que una cultura es un festival de significaciones, de valores, ideas, es una lucha permanente por imponer esas significaciones, esas ideas y esos valores. Y el mantenimiento o no de los mismos va a depender de quin detente el poder de establecer esos sentidos o bien de convencer a los dems de que esos sentidos son los que hay que mantener. A la primera forma -la imposicin- se la llama dominacin, que es cuando al otro no se le brinda la oportunidad ni siquiera de manifestar su significacin o su identidad. La dominacin es la imposicin desde el exterior de una determinada relacin; imposicin violenta, que cuenta con resistencia explcita y que slo puede mantenerse con el aparato represivo, explicaba el revolucionario italiano Antonio Gramsci. [] Pero estar en una cultura implica tambin aceptacin, consenso. El hecho mnimo de hablar un lenguaje, desde el que establecemos la comunicacin, indica que adherimos a un modelo (sintctico, semntico), al que difcilmente cuestionemos. En realidad, a la mayora de las prcticas las realizamos sin siquiera cuestionarlas, dado que estar en una cultura es precisamente no contradecir en forma explcita todo el tiempo todo lo que hacemos. Algo siempre deberemos tomar como dado, en algn lugar debemos pararnos, centrarnos como sujetos. Estos son los componentes ms interesantes de toda cultura. Son los modelos que actuamos y arraigan sin imposicin forzada. Y puede haber representaciones o prcticas que no respondan a nuestros intereses objetivos, pero an as las actuamos. A esta segunda forma, que no implica necesariamente imposicin por la fuerza sino consenso de parte de quienes no comparten objetivamente los intereses de quien domina y, sin embargo, se apropian de ellos, se le da el nombre de hegemona. Consiste en la aceptacin de una concepcin del mundo como propia, an cuando resulte contraria a los intereses sociales o de clase de quien la adopta. La censura durante las dictaduras muchas veces est precedida o acompaada por la concepcin generalizada de que en realidad existen expresiones peligrosas y hasta pensamientos peligrosos5 que deben ser censurados. Hasta la represin se avala con asunciones como en algo andara..., equivalente a los prejuicios con que se amparan las discriminaciones de nuestros das. La hegemona produce dominio, si bien con la anuencia de los dominados, porque produce que los actores adquieran las ideas que no se corresponderan con sus intereses, sobre todo de clase. As lo estableca Marx: las ideas de la clase dominante son las ideas dominantes en cada poca; o, dicho en otros trminos, la clase que ejerce el poder material dominante en la sociedad es, al mismo tiempo, su poder espiritual dominante. La clase que tiene a su disposicin los medios para la produccin material dispone con ello, al mismo tiempo, de los medios para la produccin espiritual, lo que hace que se le sometan, al propio tiempo, por trmino medio, las ideas de quienes carecen de los medios necesarios para producir espiritualmente. Las ideas dominantes no son otra cosa que la expresin ideal de las relaciones materiales dominantes, las mismas relaciones materiales dominantes concebidas como ideas; por tanto, las relaciones que hacen de una determinada clase la clase dominante son tambin las que confieren el papel dominante a sus ideas (Marx & Engels: La Ideologa Alemana; 50) Marx establece como eje de la dominacin el ejercicio del poder. Pero no meramente un poder material, sino espiritual o, decimos nosotros, simblico, en el terreno de las ideas, de los valores, de la cultura, porque es slo en el terreno de las ideas, de la ideologa y siempre en la cultura, que los sujetos pueden representarse el mundo de acuerdo con intereses propios o ajenos y hasta opuestos a los propios. Toda clase que aspire a implantar su dominacin tiene que empezar conquistando el poder poltico, para poder presentar su inters como el inters general (op.cit.30). Cada nueva
5

MaterialesdeUsodidctico AntropologaSocialyCultural

Cuando Benito Mussolini manda a prisin a Gramsci, ordena a sus carceleros: que ese cerebro deje de pensar...

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

36

clase que pasa a ocupar el puesto de la que domin antes de ella se ve obligada a presentar su propio inters como el inters de todos los miembros de la sociedad, a imprimir a sus ideas la forma de lo general, a presentar esas ideas como las nicas racionales y dotadas de vigencia absoluta (b.52). Pero sealemos que, en el terreno de la cultura, la hegemona es necesaria para ejercer el poder porque detrs (o en contra) de ella hay un juego permanente de oposicin que podemos llamar alterna, porque representa, en el fondo, un antagonismo con el poder hegemnico. Si no existiera esa alternidad, no habra razn para que se ejerciera la hegemona6. Como no existe ningn actor, individual y colectivo que sea pasivo en trminos culturales, siempre la hegemona se da en lucha con su contrario, latente o explcito, en un proceso permanentemente dinmico en donde nunca est dicha la ltima palabra. Las vctimas de la represin y de los prejuicios discriminatorios en general cuestionan al poder con su sola existencia, de ah su peligro. La dominacin se ejerce por la necesidad de aplastar un movimiento opositor pre-existente, resistente y alterno a esa misma dominacin, no porque s. La hegemona tambin se edifica sobre la base de contrarrestar o neutralizar la conciencia de verdades que las ideologas no se representan o bien aquellos contenidos de verdad que las ideologas no cuestionan, que encubren u opacan, lo que se da en llamar la falsa conciencia, que es cuando el sujeto asume como propia una idea ajena a su inters. Pero dentro de una cultura esto es algo normal, no se puede evitar. Toda comunicacin produce ideologa y opacidad, aunque tienda a la transparencia. Es una dialctica insoslayable del estar en el mundo humano, social e histrico. Por qu aceptamos ideas o valores que no tienen que ver con nuestros intereses y son an contrarios a ellos? Por qu aceptamos la hegemona? Porque vivir en la cultura implica vivir en un mundo de significados en construccin permanente y no en un mundo de ideas fijas, transparentes o verdaderas de por s, cuyo sentido no pueda ni deba ser contrastado, interpretado y verificado respecto a condiciones reales. La opacidad de nuestra vida -aquellas representaciones de la realidad que se nos escapan dentro de la totalidad- es la que nos impide conocer todo, saber todo, estar por encima de los smbolos, pero a su vez es la que nos permite -parafraseando a Engels- estar vivos, contradiciendo, desentraando, desenmascarando permanentemente nuestras propias condiciones de existencia, transparentando mediante nuestra conciencia. En este proceso, lgico es que las fuerzas de mayor poder tanto comunicativo cuanto material -como dice Marx- se impongan como las ms importantes, verdaderas o hasta inevitables. Por eso la cultura hegemnica efectiva es aquella que se ejerce con flexibilidad, que se adecua a situaciones y cambios. La hegemona no acta en forma impositiva ni unidireccional (Garca Canclini 1987: 23), sino que opera mediante cambios, ambigedades y sentidos cruzados, en los que bsicamente lo que se dirime es el poder de imponer por consenso sentidos ajenos y an contrarios a los intereses de quienes se los apropian. Lo importante es que los mismos contenidos culturales pueden resultar hegemnicos, esto es conservadores de intereses dominantes en un contexto y contrarios a esos intereses en otros contextos. Es lo que ejemplifica Gramsci con la religin: las mismas creencias y los mismos ritos pueden esgrimirse para consolidar a sectores dominantes como para luchar contra ellos. Es precisamente lo que llama lucha cultural (Gramsci 1976: 126). Como estamos viendo, la relacin entre la cultura y el contexto de lucha por los significados -en trminos de dominacin y hegemona- no puede estar ajena a la realidad de la lucha de clases, ya que implica identificar quin ejerce el poder de dictar o pretender dictar los valores, los modelos, las
El concepto de alternidad no se reduce al de contra-hegemona o hegemona alternativa (Williams 1980:132 y ss.) sino que abarca procesos de conflicto u oposicin latentes, de hecho, no slo de lucha explcita. Es lo que hace que los mensajes hegemnicos se tornen necesarios para los sectores dominantes, ya que ponen en riesgo ese dominio.
6

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

37

representaciones, los smbolos y, por lo tanto, determinar las acciones y los hechos sociales. Pero tambin nos obliga a categorizar los procesos de confrontacin (oposicin explcita) y alternidad (que puede ser una oposicin objetiva pero no declarada respecto al dominio) con relacin a los significados dominantes. Por eso hablamos de puja y contradiccin. Podemos decir que la cultura no brinda la imagen de una laguna apacible, sino que se parece ms al oleaje permanente de un mar embravecido, a una confrontacin permanente, a una lucha por dar, cambiar y reproducir sentidos. Con esto afirmamos que la cultura no responde a un nico orden, lgica o sentido, sino que ser precisamente el reinado de la diversidad, de la heterogeneidad, por su carcter de magma de contradicciones permanentes y una arena de luchas (al decir del semilogo Valentim Voloshinov) por dar, compartir o imponer significados. [] Cultura, entonces, es el conjunto de operaciones simblicas y prcticas mediante las cuales el hombre est en el mundo transformndolo, producindolo como un mundo especficamente humano. Es el conjunto de prcticas y representaciones simblicas mediante las cuales, en una determinada sociedad, grupo u organizacin, la gente, los pueblos, los sectores sociales, dan sentido, en forma compartida (an dentro de la heterogeneidad de intereses y valores determinados por la estructura social), a las acciones y actividades que realizan. MaterialesdeUsodidctico AntropologaSocialyCultural El sentido antropolgico del concepto de cultura Se habla del sentido antropolgico del concepto de cultura cuando sta se atribuye a todos los hombres, sin establecer juicios de valor sobre cules manifestaciones podran eventualmente ser o no cultura, o ser ms o menos cultas o tener menos o ms cultura. Este sentido ni siquiera tiene en cuenta estas cuestiones, no se las plantea: se parte de la base de que toda manifestacin (material o simblica) producida por cualquier grupo humano es cultura. Este es el concepto que ms ha sido utilizado por los antroplogos, iniciales especialistas en el tema de la diversidad, precisamente por haber apropiado y redefinido el concepto de cultura en estos trminos. El hecho de partir de la nocin de una cultura distribuida por igual -en tanto tal- entre todos los hombres es lo que hace posible concebir la diversidad entre las manifestaciones de esa cultura genrica como culturas -en plural-, como diversidad. De esta cuestin surgir ms adelante el problema de dnde est el lmite entre una y otra cultura, porque pensar una diversidad implica obligarse a establecer elementos en comn y elementos que distinguen y, por lo tanto, hacen posible una identificacin entre unidades, como pueden ser cada cultura en particular (la cultura mapuche, la cultura europea, la cultura nahualt, la cultura trobriandesa), en distintas escalas. Hablamos de cultura en un sentido antropolgico cuando nos ocupamos de todo lo que los seres humanos hemos construido en el mundo y todo lo que nos representamos de ese mundo, las formas de hacer, de pensar y de expresar. Desde este punto de vista, no hay distingos de ms o menos cultura, mejor o peor cultura: todos producimos cultura. El uso antropolgico es relativista cultural, ya que afirma la validez igualitaria de la pluralidad de culturas, sin que sea admisible que una prepondere sobre otra y cada una deba ser comprendida en sus propios trminos, es decir: tal como la interpretan sus propios miembros. La paradoja es que la definicin ms clsica, que ha servido para fundamentar la perspectiva antropolgica, es la de Tylor que vimos al inicio, enunciada en el contexto de la Inglaterra colonialista y desde la concepcin evolucionista, segn la cual a la civilizacin occidental se la pre-conceba como el pinculo de la evolucin humana y al mismo tiempo se atribuye la cultura en particular a la totalidad de la especie y a la totalidad de cosas que la especie hace. Aplicada hoy, abarcara desde la narracin de un chiste hasta la ms complicada ceremonia religiosa, desde la fabricacin de una canoa hasta una nave espacial. Cuando nos referimos al sentido antropolgico, entonces, no estamos hablando de la cultura entendida como conocimientos refinados, o formas de buena educacin, ni tampoco las bellas artes o la literatura. Este ltimo sentido del concepto sera el uso iluminista, y es el de uso ms recurrente. Si

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

38

bien es opuesto al sentido antropolgico, tienen entre s relaciones que se remontan al surgimiento del concepto mismo. Vimos que la matriz de gestacin de la nocin de cultura y sobre todo la apropiacin ms generalizada es la del iluminismo como tendencia del pensamiento occidental y la Modernidad como paradigma histrico e ideolgico de ese pensamiento. Esto es lo que explica que el mismo sentido antropolgico, que establece la universalidad de la produccin de cultura como patrimonio de la especie humana, sea eclipsado -en situaciones concretas de uso- por la valoracin asimtrica de las diferencias culturales propias de los procesos de colonialismo y conquista de las que emergieron. En efecto, la diversidad fue concebida a partir del contraste entre las culturas otras de los territorios colonizados y los valores de las culturas consideradas modernas y civilizadas, que no eran otras que las de las sociedades dominantes y de sus sectores dominantes. Estos valores fueron tomados como parmetros desde los que era posible establecer representaciones etnocntricas desde culturas preconcebidas como superiores hacia culturas consideradas inferiores, lo que muchas veces era expresado como un conflicto entre los verdaderos valores culturales y su contrario, o entre los portadores de ms o menos cultura y eran, por lo tanto, considerados ms o menos cultos. Para este pensamiento dominante al que nos referimos, los no cultos o menos cultos podan ser tanto el nativo de la colonia como el campesino europeo o ambos a la vez, en situaciones de cercana o lejana geogrfica, pero siempre como smbolos del otro, del distinto-extrao y en no pocas ocasiones peligroso. Por eso podemos afirmar que el conflicto es la base de la cultura. Los conflictos sociales -segn el pensador francs contemporneo Pierre Ansart- no son diferentes a cmo se plantean los conflictos dogmtico-religiosos, aunque de manera ms compleja y formalizada de otros modos. Pero en s se realizan dentro de este mundo cultural, donde la lucha por los significados es el ring donde se dirimen. Por ejemplo, para los historiadores de la denominada en forma oficial Conquista del Desierto (que, en realidad estaba poblado por numerosos pueblos y para nada desierto) los indios tomaban cautivos, en cambio los blancos tomaban prisioneros, nada pequea aunque aparentemente sutil diferencia. Y para algunas corrientes antropolgicas (y, por lo tanto, ms relativistas que esos historiadores etnocntricos), los indios tenan cultura, en cambio los blancos eran sostenedores de la civilizacin. La Antropologa se ocupa de la alteridad de valores, de la lucha de racionalidades y significados, del entrecruzamiento de sistemas de representa ciones, de la diversidad de actores en pugna y cooperacin, dentro de la realidad prctica y concreta, en una palabra: de la realidad concebida como una dialctica de la cultura. En el enfoque antropolgico se necesita, epistemolgica mente, de la voz de un actor otro, y en eso reside su punto de partida dialctico en lo metodolgico. Para que sea dialctico se deben tener en cuenta, desde la misma definicin y constitu cin de los actores, sus relaciones mutuas de interdependencia, asimetra y contraposicin. Si asignamos a la cultura el papel de transformadora de la naturaleza por medio del trabajo o, si se prefiere, el ser resultado de la transformacin de la naturaleza por medio del trabajo del hombre, la relacin bsica o estructural que se est implicando es la de una ruptura con lo dado. Por eso decimos que la cultura es una herramienta tanto de la reproduccin como de la transformacin, porque sobre todo implica desarrollarse dentro de esta dialctica entre lo que se supone dado, verdadero a priori, y, por lo tanto, no se cuestiona, y lo que pretende producir una ruptura con ese prejuicio o creencia en una verdad absoluta. El sentido humanista o iluminista del concepto de cultura Un antroplogo, George Stocking, llama humanista al uso contrario al cultura. l define humanista como el uso que proviene del pensamiento manifestacin del etnocentrismo que concibe a la otra cultura en forma supone en el fondo la existencia de un modelo de cultura como paradigma sentido antropolgico de iluminista, y que es una paternalista. Este sentido desde el cual las otras se

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

39

colocaran en una posicin de parecerse ms o menos. Este modelo de cultura visto en singular ubica a la pluralidad de culturas como girando en su derredor, como subordinadas, degradadas o marginales, si bien acepta que si se encaminan por el respeto de esos valores considerados centrales y ms perfectos podrn aspirar a parecerse, a encolumnarse en el camino a esa perfectibilidad. Este modo de ver la cultura acepta como posible un camino progresivo de evolucin y perfectibilidad hacia esa cumbre, que representara la cultura entendida como superior. De esto resulta no slo que se considere que hay personas, sectores o pueblos ms cultos que otros sino que haya actividades valoradas como propiamente culturales y otras que caeran lisa y llanamente en el campo de la in-cultura o de lo que no sin esfuerzo podra aspirar a ser cultura. Ms all que el rtulo humanista pueda ser un tanto engaoso, digamos que esta actitud iluminista hacia la cultura es la propia de todos los sistemas de enseanza, pero mucho ms de los dominantes y por nosotros ms conocidos. stos ltimos se establecen sobre la base de la idea de un recinto oscuro de por s (el alumno, etimolgicamente, del latn: alumni, equivalente a un ser sin luz), al que se debe iluminar con la transmisin de determinados contenidos elegidos de antemano y concebidos como superiores, los que finalmente l debe ser capaz de reproducir, o sea repetir en forma lo ms cercana al modelo que recibi. Es como, si desde esta posicin humanista no se considerara cultura a los valores de quien todava no est dentro del sistema formal de apropiacin de esos valores: la educacin. Por eso, el punto de vista humanista establece parmetros que supuestamente sirven para medir el grado de cultura pero a la vez es tolerante ante el otro y, a su manera, relativamente relativista cultural, ya que considera que cualquiera (persona, pueblo, sector social) puede escalar o evolucionar desde lo menos perfecto a lo ms perfecto, por medio de la educacin en los valores considerados superiores. De algunos distinguidos argentinos que mechan palabras en francs en su habla cotidiana, estn seguros de cul tenedor es el apropiado para cada tipo de manjar, se quejan de lo atascante del trnsito alrededor del Trastvere romano, enarcan sus cejas los fines de semana ante las pginas culturales de los diarios y a situaciones complicadas les atribuyen el ser algo kafkiano, se suele decir que son personas cultas. Se acostumbra a denominar cultura general a un conocimiento acumulado que en gran medida sirve para establecer una distincin entre los que lo tienen y -paradjicamente- la generalidad de las personas. Para agregado cultural de las embajadas se suele nombrar a quien se ha destacado por su notoriedad en actividades culturales por antonomasia, como la literatura, la pintura o la msica culta. Estn quienes ritualizan en forma ms que abundante la ingesta de bebidas de eufricos efectos sin caer en el descontrol, por lo que se les admira su cultura alcohlica. Desde este uso, entonces, vimos que tendra ms cultura quien comparte ciertos y determinados conocimientos, distribuidos en forma distintiva: para saber cul es el tenedor ms apropiado hay que pertenecer a tal grupo de iniciados en la materia; lo mismo para conocer tal o cul trmino extranjero o lo que se considera cultura general, como conocimiento acumulado. Para saber cun enmadejado es el trnsito en el centro de Roma hay que haber estado en Roma, y para saber que algo complejo puede ser kafkiano hay que haber ledo a Kafka, y as de seguido. Ac es necesario no confundir lo verdadero con lo verosmil (lo que es y lo que se cree que pueda ser). Porque la cuestin de fondo es que para ninguna de estas imgenes es necesario conocer lo que se dice que se conoce sino ostentarlo, que no es lo mismo. En otras palabras: lo importante es el valor simblico que puede adquirir la posesin del conocimiento de cierto bien distintivo de cultura, lo que representa para ese grupo y para el resto social del cual ese grupo intenta diferenciarse, apareciendo como culto. Queda claro entonces el carcter socio-cntrico y elitista del sentido humanista o iluminista de cultura. La especificidad de las pginas culturales de un peridico y de la agregadura diplomtica estaran tambin basadas sobre este sentido, que produce la valoracin de ciertas y determinadas actividades como propiamente culturales, principalmente las artstico-literarias y de stas slo algunas, y principalmente manifestadas en los centros dominantes. El chisme de la cola del mercado, el refrn en

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

40

una conversacin de caf, el canto de la tribuna futbolera o los cuentos de Jaimito, por ejemplo, no entraran dentro de esta clasificacin, como tampoco sus ejecutores como gente de la cultura. Y el ejemplo de la cultura alcohlica es interesante porque se apartara de estas concepciones de lo culto como lo exclusivamente artstico-erudito o como contenido de conocimiento. Si al que toma mucho se le nota, es un borracho; si no se le nota, es un hombre culto (de alcohol). La ostentacin, lo que se muestra, es lo ms importante, aunque la cantidad real sea la misma. En el fondo, la perspectiva que prevalece es la de la cultura como algo cuantificado, acumulable, seleccionable y centralizable, siempre determinada por el sujeto que se auto-atribuye el poder de cuantificar, acumular, seleccionar y centralizar ciertos valores supuestamente ms culturales. Unidad de contrarios El sentido antropolgico sirve para tomar conciencia que todas las manifestaciones humanas de cualquier latitud y cualquier poca son, han sido y sern cultura, como parte de la produccin simblico-material de la especie, transmitida en trminos de signos aprendidos y arbitrarios, compartidos y en transformacin permanente, y que todas las sociedades y grupos son productores de cultura, sin que sea posible distinguir en trminos de ms o de menos. En consecuencia, nos permite realizar una crtica respecto de las posiciones etnocntricas, sociocntricas y elitistas respecto a la cultura, que en gran medida coinciden con el sentido que Stocking tipifica como humanistas y en general situamos como iluministas. Pero debemos tomar nota que ambos sentidos constituyen un par de opuestos que conforman una unidad, ya que uno se constituye y define en funcin del otro y, como veremos enseguida, adquieren un valor analtico y de transformacin social slo si se los ve en esta unidad de contrarios. Por ahora digamos que si bien todas las sociedades poseen cultura por igual, no existe grupo humano que no pondere, dentro de su misma cultura, unos valores por sobre otros. Lo que equivale a expresar que ninguna cultura deja de reivindicar, ensear o imponer ciertos valores, comportamientos o creencias por encima de otras. Si bien las culturas pueden diferir sobre quin realiza la socializacin y educacin de los nios (los futuros sucesores de la definicin de Turgot), en ninguna cultura se deja de sealar qu se debe decir, qu se debe tocar, qu se debe hacer, etc., en suma: ninguna cultura, paradjicamente, deja de ser iluminista consigo misma, con lo que el relativismo cultural extremo encuentra otro punto de crisis en s mismo. [] Cultura para la accin Cmo situarse desde una posicin y accin transformadora con esta base conceptual del concepto de cultura? Evidentemente el concepto antropolgico, manejado en forma hipertrofiada, como hemos visto, tiende a la reproduccin del statu quo. Su utilidad se dar siempre y cuando se lo maneje como un contrario en unidad con el concepto iluminista. Es difcil pensar una transformacin social sin apelar a un sentido de la cultura como aprendizaje continuo, de acuerdo con determinados valores y no de absolutizaciones de lo relativo. Slo de la combinacin dialctica y constante entre pares analticos (material-simblico, etnocentrismo-relativismo, iluminista-antropolgico) se pueden dar cuenta de la realidad ms all de las naturalizaciones y los preconceptos. Si se recorren las modificaciones que fue sufriendo la postura de la UNESCO respecto a las cuestiones culturales, se podr encontrar de lleno con una dinmica entre la perspectiva iluminista y la antropolgica, entre concebir la cultura como todo lo creado por el hombre y el modo de vida de los pueblos y advertir a la vez contra los peligros de la provincializacin (uno de los efectos del relativismo extremo) de las realidades culturales, que conlleva al ahistoricismo y la aceptacin de modelos estticos y congeladores de la historia.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

41

Si la cultura no se hereda ms que socialmente y se debe aprender todo en cada generacin, nada puede obligarnos a naturalizar ni el progreso continuo ni un mundo mejor como algo garantizado de por s, por el mero transcurrir de los tiempos. Es la Historia, como eslabonamiento de contradicciones, la que puede construir el progreso, pero tambin puede no hacerlo. Y es la accin de los hombres, dentro de las contradicciones de cada sistema social, la que determina que los cambios sean posibles. La fantasa es como la veleta y es como una antena la conciencia del hombre. Amo a las dos. Las dos en mi tejado vibran como una rosa, escribi el poeta argentino Ral Gonzlez Tun (1905-1974). Tanto la fantasa como la conciencia entran dentro de la cultura, pues se construyen mediante la dimensin simblica de las acciones humanas. Es imposible escindir una de otra, como es imposible, en el mundo humano, dejar de lado el vuelo creador de las representaciones y el proceso de profundizacin de la conciencia social, en el terreno frtil que las contiene como herramienta de anlisis y transformacin: la cultura.

Cuerpo y cultura
Mercedes Cravero y Alejandra Roca Lo material y lo simblico La Antropologa ha mantenido una perspectiva social y cultural de los diversos fenmenos y manifestaciones humanas. Desde sus comienzos, el enfoque holstico de la antropologa clsica ha prestado inters a las formas materiales del universo simblico, interpretndolas en la compleja red de significaciones culturales. Como ha dicho Claude Lvi-Strauss: no podemos estudiar dioses, ignorando sus imgenes, a la vez que toda representacin simblica utiliza mediaciones materiales. De esta forma, el diseo de los objetos, la distribucin espacial, la arquitectura de las casas, los templos, la utilizacin de los colores y las vestimentas, no han pasado inadvertidos por los antroplogos y menos an por los arquelogos, quienes trabajan exclusivamente con restos materiales socio-culturales. De este modo, la expresin material y simblica de toda produccin humana, ha constituido uno de los ejes fundamentales de la Antropologa. Lvi-Strauss afirma que cierto tipo de hacha de piedra, puede ser un signo. Qu significa esto? Fuera de su contexto cultural, un ingeniero podra examinar la eficiencia del hacha como herramienta, la tecnologa con la cual fue realizada, en una palabra, el aspecto utilizado del artefacto. Un diseador se detendra en sus lneas y formas, un artista en su valor esttico; un coleccionista en su valor como reliquia, y un anticuario en su valor monetario. Asimismo, un anlisis de laboratorio nos brindara el detalle de su composicin qumica, determinando a su vez su antigedad. Sin embargo, un hacha de piedra supone un conjunto de elecciones, que implican tanto su eficacia, su valor esttico y tecnolgico, pero esta hacha adquiere su sentido pleno en el contexto de una cultura particular. Lo que Lvi-Strauss llama un sistema de elecciones posibles; es decir, esta hacha de piedra es una y no otra de tantas posibles. Es un producto material dotado de significado, dentro de un contexto especfico. En otros trminos, la observacin de Lvi-Strauss hace referencia a la existencia de un sistema cultural particular que opera en elecciones arbitrarias a menudo percibidas como estrictamente funcionales (utilizando como ejemplo un hacha de piedra, un objeto aparentemente simple y rudimentario). Estas observaciones no se limitan al estudio de las llamadas sociedades primitivas. Historiadores como Eric Hobsbawm han percibido con precisin la dimensin simblica de la cultura material, tal como surge de las descripciones pormenorizadas que hace del mundo capitalista del siglo XIX, de donde surge la estrecha relacin entre el interior burgus, los objetos que lo habitan, y los valores estticos, morales, religiosos, las prescripciones de clase y los smbolos de status. En La era del capitalismo, Hobsbawm se refiere al mundo burgus del siglo XIX de la siguiente forma: MaterialesdeUsodidctico AntropologaSocialyCultural

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

42

Permtasenos comenzar el anlisis de esta sociedad... con la descripcin de las ropas que vestan sus miembros y los intereses que las rodeaban. El hbito hace al monje, deca un proverbio alemn, y ninguna otra poca lo entendi tan bien como sta, en la que la movilidad social poda colocar a un gran nmero de personas en la situacin, histricamente nueva, de desempear nuevos (y superiores) roles sociales, y, en consecuencia vestir las ropas apropiadas. [...] La impresin ms inmediata del interior burgus de mediados de siglo es de apiamiento y ocultacin, una masa de objetos, con frecuencia cubiertos por colgaduras, cojines, manteles y empapelados y siempre, fuese cual fuese su naturaleza, manufacturados. Ninguna pintura sin su marco dorado, calado, lleno de encajes e incluso cubierto de terciopelo, ninguna silla sin tapizado o forro, ninguna pieza de tela sin borlas, ninguna madera sin algn toque de tomo, ninguna superficie sin cubrir por algn mantel o sin algn adorno encima. Sin ninguna duda era un signo de bienestar y status. [...] Los objetos expresaban su precio... los objetos eran algo ms que simples tiles, fueron los smbolos del status y de los logros obtenidos... [...] Sus objetos al igual que las casas que los albergaban eran slidos... La dualidad entre solidez y belleza expresaba una neta divisin entre lo material y lo ideal, lo corporal y lo espiritual, muy tpica del mundo de la burguesa; sin embargo en l, tanto el espritu como el ideal dependan de la materia, y nicamente poda expresarse a travs de la misma o, en ltima instancia a travs del dinero que poda comprarla. Nada era ms espiritual que la msica, pero la forma tpica en que entr en los hogares burgueses fue el piano, un aparato excesivamente grande, elaborado y caro. Vemos entonces cmo, tanto en el estudio de las sociedades arcaicas como en las modernas e industrializadas se ha demostrado que lo material y lo simblico conforman una totalidad. Un hacha de piedra, una alfombra, un piano, un chicle, una pieza tallada de jade, una gua telefnica, o un corpio con relleno, expresan el sistema de mltiples determinaciones de la sociedad que los produce y adquieren significado en un contexto especfico. Cabe sealar tambin que el contexto cultural, al tiempo que posibilita, limita nuestra capacidad para signar significados e interpretar. Para dar un ejemplo, cuando vemos un film, un mismo objeto, como una goma de mascar sobre una alfombra persa, puede significar, de acuerdo con la trama, la contradiccin entre Oriente y Occidente, la presencia de un espa norteamericano en Irn, o la pista de un asesino. En nuestra vida cotidiana, solemos estar permanentemente atentos al significado de nuestras prcticas y tambin (especialmente) a las de los dems. El clebre dramaturgo Molire observ mordazmente estas aspiraciones, en su retrato del burgus gentilhombre, donde satiriza las pretensiones y el ascenso econmico de la burguesa del siglo XVII: El seor Jourdain: -Os he hecho esperar un poco, pero es que ahora me estoy haciendo vestir como las gentes de categora; y mi sastre me ha enviado medias de seda como jams pens que haba de ponerme. El maestro de msica: -No estamos aqu sino para esperar que os desocupis. El seor Jourdain: -Os ruego a ambos que no os vayis hasta que no me hayan trado mi traje, a fin de que podis vrmelo. [...] Mi sastre me ha dicho que las gentes de categora andan as por la maana, El Sastre: -Mirad, aqu tenis el ms y mejor guarnecido traje de corte. Es una obra maestra haber inventado un traje tan serio sin que fuera negro ... El seor Jourdain: -Qu significa esto? Habis puesto las flores para abajo! El Sastre: -S, por cierto todas las personas de categora las llevan en esa forma. El seor Jourdain: -Las personas de categora llevan las flores para abajo? El Sastre: -S, seor. El seor Jourdain: -Oh, entonces est bien.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

43

En este retrato de un parvenu (algo as como un nuevo rico), observarnos un uso de la indumentaria que resulta familiar en nuestra sociedad: el gasto desmedido en la vestimenta que expresa la pretensin de pertenencia a un sector social de status ms elevado. Los significados sociales atribuidos a la indumentaria se relacionan as tanto a diferencias de clase y status, como tambin a distinciones de gnero, preferencias sexuales, etreas, actividad laboral, o de grupos definidos por lo que se han dado en llamar las nuevas identidades urbanas. Innumerables trabajos etnogrficos acerca de las sociedades llamadas primitivas describen con amplitud los distintos tipos de arreglos y ornamentaciones, as como las ropas apropiadas que deben usarse en diferentes ocasiones, tales como rituales de iniciacin, funerarios, bodas y ritos de pasaje. Consumo de signos Estas prescripciones indumentarias y de arreglo personal, como ya dijimos, no son puramente estticas, o puramente funcionales, sino que expresan de modo implcito la estratificacin social, los valores, etc. La sociedad capitalista va a imprimir su propio sesgo a este tipo de expresiones, ya que si bien existen convenciones (novias de blanco, luto de negro), las mismas tendrn su propia expresin en diferentes grupos sociales, de acuerdo con sus propias pautas de consumo. Estas no descansan solamente en el poder adquisitivo que se tenga con respecto a un bien. Pierre Bourdieu nos habla de una apropiacin diferencial de los bienes. Si bien las clases sociales se diferencian por su relacin con la produccin y la propiedad, tambin lo hacen por el aspecto simblico del consumo, es decir por la manera de usar los bienes transmutados en signos. Este rasgo es especfico de la llamada sociedad de consumo. Por ejemplo: la entrada a un Museo, o a un concierto de una orquesta sinfnica puede ser gratuita (lo que la hara accesible a todos), pero slo algunos sectores sociales consumen y gustan este tipo de bienes culturales. La posibilidad de apropiarse de los mismos est relacionada con hbitos socioculturales, estticos y estructuras del gusto, internalizadas y aprendidas en el grupo de pertenencia. La apropiacin diferencial de los bienes se expresa tambin en el consumo de espacios de recreacin pblicos o semipblicos. Un ejemplo de ello son los paseos de compras o shopping center. All pueden reunirse una chica que ha hecho un largo viaje en colectivo con sus familiares para fotografiarse con su traje de cumpleaos de 15 en un ambiente de lujo, un contingente de amas de casa del interior del pas para hacer un tour de compras y recreacin, un grupo de adolescentes que hacen del shopping un lugar de encuentro, una persona que entra directamente a una negocio, realiza una compra y se va... Todos estos sujetos sociales se apropian en forma diferenciada y desigual del mismo espacio. En la indumentaria, por ejemplo, una misma prenda puede ser consumida de modo diferencial: una camisa verde loro, corta, con solapas enormes y botones diferentes, acompaada de saco marrn, o un jean roto, no produce la misma impresin (es decir: hacemos otra lectura de la misma) en una modelo que en una empleada domstica. Tambin diferentes elementos del contexto como el lugar (una disco de moda o un transporte colectivo del Conurbano Bonaerense), el tipo de arreglo personal, los accesorios, el horario, nos hablan de situaciones y usos sociales por completo diferentes, aunque se trate de la misma prenda. Sin dudas, para la empleada domstica esa camisa no est a la moda, si no se compra otra es porque no puede hacerlo. En cambio para la modelo seguramente signifique algo retro y original, inclusive estar dispuesta a comprar ropa usada, en un comercio exclusivo. Como ya sealara Garca Canclini, cabe plantearse que los procesos de diferenciacin que se expresan en el consumo y generan identidades son resultado de desigualdades, es decir, dejar de lado un enfoque relativista de acuerdo con el cual slo veramos diferencias, donde en realidad hay desigualdades. Las diferencias de clase no implican entonces solamente el aspecto econmico material, ya que la burguesa desplaza la diferenciacin a un sistema conceptual, en un plano simblico. De ah que Bourdieu nos habla de la lucha simblica. Esta estrategia crea la ilusin de que la diferenciacin no

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

44

se debe a lo que se tiene, sino a lo que se es. De esta forma, la cultura, el arte, el buen gusto, la distincin, aparecen como un don natural. Finalmente, podemos retomar aqu el concepto de cultura, tal como lo entiende la Antropologa, segn el cual todo sistema simblico inserto en estructuras materiales expresa sentidos, a la vez procesos de identidad y diferencia, observables en las diversas prcticas e instituciones sociales. Recordemos la nocin de cultura que la define en oposicin a la naturaleza (ver Gravano): la arbitrariedad y diversidad de la produccin humana que va ms all de lo dado, de lo natural, transformndolo... El hombre, al modificar la naturaleza se transforma a s mismo, y su propio cuerpo lleva inscriptas las marcas de su cultura. A propsito de esta distincin entre naturaleza y cultura, Lvi-Strauss nos relata, en Tristes Trpicos, en alusin al arte del tatuaje de los indios Caduveo (de Brasil), en sus pinturas faciales... los mbay expresan un mismo horror por la naturaleza. El arte indgena proclama un soberano desprecio por la arcilla de la que estamos amasados... Y luego agrega: Las pinturas confieren al individuo su dignidad de ser humano, operan al paso de la naturaleza a la cultura, del animal estpido al hombre civilizado... Es que la construccin social y cultural del cuerpo es comn a toda experiencia humana.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

45

GRAVANOLACULTURACOMOCONCEPTOCENTRALDELAANTROPOLOGA CRAVEROYROCACUERPOYCULTURA A.Respondaelsiguientecuestionarioamododeguadelectura 1. En qu momento histrico comienza a enunciarse el trmino cultura, cmo se lo define y conquseloasocia? 2. Qusignificalaexpresin:laculturacomotesorodesignos? 3. Quseentiendeporrepresentacinsimblicayqueslaculturacomomodelo? 4. Cmo se puede explicar la relacin entre lo natural y lo cultural y entre lo material y lo simblico? 5. Quvaloradquierelacontradiccincomoherramientaespecficamentehumana? 6. Ququieredecirquelaculturaesunaarenadeluchaporlosignificados? 7. Queselsentidoantropolgicodelconceptodecultura? 8. A qu se opone este sentido? Cul es su relacin con la categora de conflicto y la concepcindelasotredades? 9. Queselsentidoiluministadelconceptodecultura?Cmopodraejemplificarse? 10. Qu significa que ambos sentidos son dos contrarios en unidad? Qu ejemplo podra mencionarse? 11. Qusignificaqueningunacultura,paradjicamente,dejadeseriluministaconsigomisma? 12. Qu posicin tienen R. Williams y J. Martn Barbero respecto al sentido antropolgico y al sentidorestringidodecultura? 13. Cmo situarse desde una posicin y accin transformadora con esta base conceptual del conceptodecultura? 14. Qu otros ejemplos se podran dar, adems del presentado al final del texto de Gravano, acercadelarelacinentrelafantasaylaconciencia? B. Analicesiseexpresanlosdossentidosdelconceptodecultura?Porqu?

MaterialesdeUsodidctico AntropologaSocialyCultural

A m me trataron de inculto y de muchas cosas y yo no lo acepto. Mi viejo no habr podido mandarme a un colegio ingls, me dio la educacin que l poda... Aprend a convivir con todo lo que me rodea y sin cambiar gracias a mi familia, a la nica educacin que pudo darme mi viejo (Diego ArmandoMaradona,exjugadordeftbol). C. Proponemos la siguiente actividad grupal: analizar distintas definiciones de cultura tomando como referencia algunas de las que se listan a continuacin u otras que el grupo recupere. Se espera que se las confronte, se distingan aspectos comunes y distintivos y se construyanunadefinicinpropia. La cultura o civilizacin es ese todo complejo que incluye el conocimiento, las creencias, el arte, la moral, el derecho, las costumbre, y cualesquiera otros hbitos y capacidades adquiridos por el hombreencuantomiembrodelasociedad.(Tylor) Esunaentidadinamovible,enequilibriobalanceadooautoreproducido,dentrodelacuallos individuostiendenaversehomogneos.(Wright) Reddesignificadoscompartidos.(Geertz) Procesoconflictivodeconstruccindesignificado.(Merry)

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

46

La cultura es un todo funcional, integrado y coherente, que no se opone a la naturaleza sino que la continua.Eslarespuestaorganizadadelasociedadparasatisfacersusnecesidadesnaturalesatravs degruposinstitucionalizados.(Malinowski) Formas aprendidas de sentir, pensar y comportarse. Forma distintiva de la estructura social. (RadcliffeBrown) Espaciooarenadeluchaporimponersignificados(Williams;Voloshinov) Conjunto coherente de rasgos conductuales e ideacionales originados por difusin de un grupo a otrooporcreacinindependiente.(Boas) Laculturaesunaentidaddepequeaescala,concaractersticasdefinidas(listaderasgoso atributos).(EnWright) Procesoactivodeconstruccindesignificadoydedisputasobreladefinicin.(EnWright) Conjuntos de conocimientos y esquemas de percepcin, pensamiento y accin. (Garca Castao y GranadoMartnez) D. Proponemos ahora reordenar las definiciones enunciadas ms arriba, tomando en consideracin lo que en el texto de Gravano se asocia tanto a sentidos iluministas/antropolgicos, amplios/restringidos, etnocntricos/relativistas, como a concepciones que la entienden enraizada en la conflictividad social. Una vez reordenadas, describa comparativamente cada sentido o posicin. E. Siguiendo el hilo de la actividad anterior, se propone ahora analizar y reflexionar grupalmente el siguiente prrafo que alude a los procesos hegemnicos de produccin cultural y construccindesignificados. Tal como lo sugieren Comaroff y Comaroff (1992), en su dimensin hegemnica, la cultura aparece como coherente,sistemtica yconsensuada.Procuraaparecercomounobjeto, unacosamsallde la accin humana, no ideolgica en lo ms mnimo. () Los mismos antroplogos haban confundido alasideologashegemnicasconlaautnticacultura,yenelproceso,apoyaronaaquellosmiembros delacomunidadconelpoderascendienteparadefinirlascaractersticasdesuculturayproyectarla como atemporal y objetiva. Ninguna ideologa, por ms hegemnica que sea e imbricada en las instituciones y la vida cotidiana que est, se encuentra fuera de disputa; el de cultura es un concepto dinmico, siempre negociable y en proceso de aprobacin, discusin y transformacin .( Wright1) RelacioneesteprrafoconlacrticaesbozadaeneltextodeGravanoalasconcepcionesms relativistasdelacultura(olosencubrimientos). 2. Qu ejemplos pueden darse acerca de la cultura hegemnica que grafiquen algn aspecto tratadoenesteprrafoyeneltextodeGravano?
1.

Wright, Susan (2004): La politizacin de la cultura. En: Constructores de otredad. Una introduccin a la antropologa social y cultural. (Boivin, M.; Rosato, A. y Arribas, V.). Editorial Antropofagia.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

47

F. Sugerimos reflexionar entorno alos siguientes fragmentosreferidosaprocesos educativos, que en distintos momentos y espacios, han implicado un posicionamiento particular respecto a lo que seentiendeporcultura. Es difcil que esta escuela primaria que ha mantenido durante cuatro dcadas su divisin en grado, la misma distribucin del tiempo, sus programas, sus exmenes, sus mtodos intuitivos, sus interrogatoriossocrticos, sus formasheursticas, susfestividadescvicas,suscantosa labandera, su culto a los prceres, su toque de campana laico es difcil, digo, que sea suplantada por otra que, al subvertir este rgimen,ofrezcauno superior para los interesesdelacultura ylacivilidadargentinas. (Mercante,V.,1911,enGagliano,op.cit.) ElnacionalismodelaEducacinalemana,secultiva:1)porellargoestudiodelidiomanacional;2) por continuos cantos patriticos; 3) por el estudio de la historia nacional; 4) por las asociaciones particulares que se constituyen siempre con fines subsidiariamente patriticos y 5) porque en la Instruccin en general, no se desperdicia coyuntura de traer a colacin los sentimientos cvicos. Es de notarsequeesepatriotismo,nuncasemanifiestacomochurriguerescopatriotismo:sehalla,msque en protestas y gritos, en las altas esferas de la ciencia y del arte nacional, as como de la crtica literaria y cientfica. Ms que una ostentacin forzada de victorias materiales, es una ingenua y profunda revelacin de una ambicionada superioridad moral e intelectual, que falsa o verdadera, levantayenorgulleceelnimodelpueblo.(Bunge,C.O.,1901,enGagliano,1991)2 Qu elementos se pueden identificar en estos discursos de comienzos del siglo XX, que remitanalosprocesosconflictivosdeconstruccindesignificados? 2. Qu relacin puede establecerse entre educacin, construccin de los nacionalismos y cultura? 3. Qusujetoseinteresesestnimplicados?
1.

G. El texto de Cuerpo y Cultura nos permite continuar profundizando la reflexin acerca de la interrelacin/interdependencia entre lo material y lo simblico de todo fenmeno cultural. A continuacin se invita a la lectura de un breve fragmento de texto en el que se describen algunas prcticasrelacionadasalcuerpo,alvestido,alaconstruccindegnero,alcontextohistricoyala estructurasocialdeunapoca. A las nias bien educadas, con la mejor de las intenciones, las compriman en versiones juveniles delcorsalatempranaedaddetresocuatroaos.Gradual,peroincesantemente,suscorssseiban haciendo ms largos, ms rgidos y ms ceidos. Al llegar al final de la adolescencia iban metidas en jaulas de pesada lona reforzada con barba de ballena o de acero, y a menudo se les atrofiaban los msculos dorsales hasta el punto de no poder sentarse ni estar de pie durante mucho tiempo sin apoyarse. El cors tambin deformaba los rganos internos y haca imposible respirar hondo. Como consecuencia,lamujerqueibavestidaalamodasesonrojabaysedesmayabaconfacilidad,sufrade apetito,ydemolestiasdigestivas,ysesentadbilycansadaalhacerunesfuerzoexcesivo.Cuandose quitaba el cors, empezaba a dolerle la espalda enseguida, y a veces segua sin poder respirar bien porquehabatenidolascostillasoprimidasdurantemuchotiempo.Sobreestadebilitadora prendade base lamujer victoriana llevada variascapasdecamisones,treso cuatroenaguasms,unmiriaque y un vestido largo que poda llevar hasta 20 metros de gruesa lana o seda y que con frecuencia
Gagliano, Rafael (1991). Nacionalismo, inmigracin y pluralismo cultural. En: Sociedad civil y estado en los orgenes del sistema educativo argentino. Buenos Aires, Galerna, p. 281-307
2

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

48

tambin iba emballenado en el corpio y llevaba adornos adicionales de tela, cinta y abalorios. Cuandosaladecasaaadaunpesadochaldelanayungransombrerodecoradoconplumas,flores, cintas y velos. En total poda llevar entre cinco y quince kilos de ropa () Con esta indumentaria era difcilmoverseoandarvigorosamente,ycasiimposiblecorrer.Peroentonceslasdamasnoandaban pues en el discurso educado no tenan piernas ms bien se deslizaban o se desplazaban por el suelo como una aspiradora, y por supuesto no corran. En una emergencia lo apropiado era desmayarseoconfiarsealaproteccindelcaballeromscercano.()Seconsiderabaalasmujeresel sexo ms dbil no slo fsicamente sino tambin moralmente: sus mentes, sus voluntades y tambin sus espaldas eran dbiles. Una dama poda ser pura e inocente, por supuesto, pero esa pureza e inocencia slo se podan conservar con vigilancia constante. Por tanto no deba ir a la universidad ni ejercer una profesin. () Necesitaba estar al mismo tiempo apoyada y confinada en una indumentaria de mltiples capas y fuertemente reforzada, que hara del acto de desvestirse un procesodifcilydemasiadolargo. (AlisonCurie:Ellenguajede lamoda.1994,Paids,Barcelona,pp. 24). Se reconocen en la actualidad imperativos en la moda o el modelo esttico dominante que seanequiparablesalcorset?Sesugiereenumerarydescribirejemplos. 2. Con respecto a estos imperativos en la actualidad, con qu valores y/o condicionamientos socialespodranvincularse?
1.

MaterialesdeUsodidctico AntropologaSocialyCultural

H. En el libro Tristes Trpicos, Lvi Strauss describe el arte del tatuaje y la pintura entre los indios Caduveo, quienes dedican especial atencin al tatuado de sus rostros: la cara, y a veces tambin todo el cuerpo, estn cubiertos por toda una redecilla de arabescos asimtricos alternados con motivos de una geometra sutil. Al parecer, el primero en describir su arte fue SnchezLabrador,unmisionero,alcualhacereferenciaLeviStraussenelmismotexto.Sepropone leeratentamenteelsiguienteprrafo: Hoy en da los Caduveo se pintan slo por placer, pero antes la costumbre ofreca una significacin msprofunda.Segn eltestimoniodeSnchezLabrador,lascastasnoblesno sepintabanmsque la frente y slo el vulgo se adornaba toda la cara, tambin en esta poca slo las mujeres jvenes seguan la moda. Es raro indica que las viejas pierdan el tiempo en estos dibujos: se contentan con losquelosaosgrabaronensurostro.Elmisionerosemuestraalarmadoporesedespreciodelaobra del Creador: Por qu los indgenas alteran la apariencia del rostro humano? Busca explicaciones: 'quizs para engaar el hambre pasan horas trazando sus arabescos? quiz para ocultarse de sus enemigos?' Imagine l lo que imagine, siempre se trata de engaos. Por qu? Por ms repugnancia que experimente, hasta el misionero es conciente de que esas pinturas tienen para los indgenas una importancia primordial y de que son, en cierto sentido, su propio fin. Tambin nos muestra a esos hombres que pierden das enteros hacindose pintar, olvidados de la caza, de la pesca y de sus familias. 'Por qu sois tan estpidos?', preguntaban aqullos a los misioneros. Y por qu somos estpidos?, respondan stos. Porque no os pintis como los eyiguayegu. Haba que estar pintado para ser hombre, el que permaneca al natural no se distingua de los irracionales (Claude Lvi Strauss1970:TristesTrpicos.EUdeBA,178). La prctica del tatuaje como de las pinturas sobre el cuerpo no son privativas de las sociedades salvajes descriptas por Lvi Strauss. Por el contrario, podemos dar cuenta de ellas en diversas sociedades, como en la nuestra, expresando mltiples significados. Con respecto a esto , veamos algunasobservacioneshechasporlospropiostatuados:

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

49

Vivimos en una sociedad descartable y los tatuajes son decididamente permanentes. Eso es lo que nos da temor, pero a la vez es lo que los hace poderosos. Tomar una decisin irrevocable es bueno paraelalma.(TatooRevue,Vol.7,32,NewYork,1994). Mis tatuajes muestran un poco lo que me fue pasando, cada uno expresa mi estado de nimo del momento,escomolahistoriademvida..(AlumnadelCBC,19aos).
1. 2. 3. 4.

5.

QusugiereeltextodeLviStrauss? Esposiblerelacionarestasprcticasfrecuentesenlasllamadassociedadesprimitivas,conla prcticadeltatuajeenlaactualidad?Porqu? Quelementoscomunesidentificayculesmarcandiferencias? Qu otros ejemplos actuales podran consignarse, en los que el arreglo personal implique una transformacin del propio cuerpo? Cmo podran explicarse de acuerdo con su significadoycontextosocial? Qu implicancias tendra el pensar el cuerpo como una construccin social y cultural? Qu relaciones puede establecerse con las conceptualizaciones de la cultura que brinda la Antropologa?

I Lea el siguiente texto y subraye aquellas frases donde pueda ejemplificar alguno de los conceptostrabajados Aceite,culturaymemoria PorArturoPrezReverte Acaboderecibirelprimeraceitedelao,quemeenvanlosamigos:aceitedeolivavirgen,decantado y limpio tras su recoleccin hace un mes o dos. Siempre me llegan algunos litros embotellados y enlatadosqueatesoro en la bodega,yqueirncayendo pocoa poco,conmuchamesurayrespeto.Y tiene gracia. Soy todo lo contrario a un gourmet. Como y bebo lo justo. Pero antes, con la juventud y las prisas del oficio yesas cosas, todava le daba menos valor alacosa gastronmica. Tomabaaceite con tostadas,o echndolo a la ensalada,o con huevosfritos, sinreparardemasiado en ello. Quienes, comoyo,comencasidepie,yasabenaqumerefiero.Loquepasaesqueluego,pocoapoco,conel tiempo y la calma, cuando la mirada en torno y hacia atrs suele ser de ms provecho, empec a advertir ciertos matices. A valorar cosas de las que antes pasaba por completo. En lo del aceite de oliva result decisivo mi amigo y compadre Juan Eslava Galn, que es autoridad aceitil en el buen sentido de la palabra. No se trata de aceite nada ms, ni de comida ni de cocina. El aceite de oliva forma parte no slo de nuestramesa,sinodelamemoria,delaculturayhastadelaverdadera patria,sientendemosasese lugar viejo, sabio, generoso, llamado Mediterrneo:esabulliciosaplaza pblicadondenacitodo, en tornoalasaguasazulesporlasqueyaviajaban, hacediezmil aos,navesnegras conunojopintado en la proa. Hablo del lago interior que nos trajodioses, hroes, palabra, razny democracia.Del mar de atardeceres color de vino y de orillas salpicadas de templos y olivos, donde se fundieron, para alumbrar Europa y lo mejor del pensamiento de Occidente, las lenguas griega, latina y rabe. Hablo delmarpropio,nuestro,quenuncafueobstculo,sinocaminopordondeseextendieron,fundindose para hacernos lo que somos Talmud, Cristianismo e Islam. No es casual que todava hoy los pueblos y manteca. brbaros sigan friendo con grasa

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

50

Salud y cocina aparte, consumir aceite no es un acto banal. Es, tambin, participar de un rito y una tradicin seculares, hermosos. El currculum de ese bello lquido dorado es impresionante: zumo del fruto del olivo la seitn rabe y del trabajo honrado y antiguo del hombre, ya era parte de los diezmos que el Libro de los Nmeros recomendaba reservar a Dios. Tambin se utilizaba en la consagracin de los sacerdotes y los reyes de Israel, y ms tarde ungi a los emperadores del Sacro Imperioyalosmonarcaseuropeosantesdesucoronacin.Ensociedadesdeorigencristiano,comola nuestra, el aceite estuvo presente durante siglos, tanto en la uncin del nacimiento como en la extrema uncin de la muerte. La costa mediterrnea est jalonada por nforas olearias de innumerablesnaufragios,ylosviejostextosabundanenalusiones:elDeuteronomiollamaaPalestina tierra de aceite y miel, Homero menciona el aceite en la Ilada y en la Odisea, Aristteles detalla su precio en Atenas y Marcial, que era romano e hispano esa Hispania que algunos imbciles niegan que haya existido nunca, pone por las nubes el aceite de la Btica. Y todo eso, de algn modo, se contiene en cada chorrito de aceite que ponemos sobre una humilde tostada. As que, por una vez, permtanme un consejo: si quieren disfrutar ms del aceite de oliva de cada da, piensen un instante, cuando lo utilicen, en todo lo que significa y lo que es. Luego virtanlo con cuidado y mucho respeto, procurando no derramar una gota. Sera malversar nuestra propia historia. revista@lanacion.com.ar El autor es periodista y escritor espaol, miembro de la Real Academia Espaola de la Lengua; Link permanente: http://www.lanacion.com.ar/895348.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

51

Europa, modernidad y eurocentrismo


Enrique Dussel 1

I. Deslizamiento semntico del concepto de Europa

n primer lugar, deseamos ir indicando, con propsito terico, el cambio de significado del concepto de Europa. En general no se estudia ese deslizamiento semntico, y, por ello, es difcil discutir sobre el tema.

En primer lugar, la mitolgica Europa es hija de fenicios, de un semita entonces2. Esta Europa venida del Oriente es algo cuyo contenido es completamente distinto a la Europa definitiva (la Europa moderna). A Grecia no hay que confundirla con la futura Europa. Esta Europa futura se situaba al norte de la Macedonia, y al norte de la Magna Grecia en Italia. El lugar de la Europa futura (la moderna) era ocupado por lo brbaro por excelencia (de manera que posteriormente, en cierta forma, usurpar un nombre que no le es propio, porque el Asia (que ser provincia con ese nombre en el Imperio romano: slo la actual Turqua) o el Africa (el Egipto) son las culturas ms desarrolladas, y los griegos clsicos tienen clara conciencia de ello. El Asia y el Africa no son brbaras, aunque tampoco plenamente humanas 3. Lo que ser la Europa moderna (hacia el norte y el oeste de Grecia) no es la Grecia originaria, est fuera de su horizonte, y es simplemente lo incivilizado, lo no-poltico, lo no-humano. Con esto queremos dejar muy claro que la diacrona unilineal Grecia-Roma-Europa (Esquema 2) es un invento ideolgico de fines del siglo XVIII romntico alemn; es entonces un manejo posterior conceptual del modelo ario, racista.
1. Universidad Autnoma Metropolitana Iztapalapa (UAM-I), Mxico. 2. Vase mi obra El humanismo semita, EUDEBA, Buenos Aires, 1969, donde ya recuperbamos a Grecia del rapto Moderno. Por su parte, escribe Martin Bernal, en Black Athena. The Afroasiatic Roots of Classical Civilization, Rutgers University Press, New Jersey, t.I, 1987: Homer and Hesiod both referred to Europa, who was always seen as a sister or some other close relative to Kadmos, as the daughter of Phoinix[...] Homers frequent use of Phoinix in the sense of Phoenician, and the later universal identification of Europa and Kadmos with Phoenicia. 3. Aristteles no las considera humanas como los griegos (vivientes que habitan la polis) en su Poltica I ,1, pero tampoco son consideradas brbaras.

41

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

52

Enrique Dussel

En segundo lugar, lo Occidental ser el imperio romano que habla latn (cuya frontera oriental se sita aproximadamente entre la actual Croacia y Serbia)4, que ahora contiene al Africa del norte. Lo Occidental se opone a lo Oriental, el imperio helenista, que habla griego. En lo Oriental est Grecia y el Asia (la provincia Anatolia), y los reinos helenistas hasta los bordes del Indo, y tambin el Nilo ptolomaico. No hay concepto relevante de lo que se llamar Europa posteriormente. En tercer lugar, Constantinopla desde el siglo VII, el imperio romano oriental cristiano, se enfrenta al mundo rabe musulmn creciente. Es muy importante recordar que lo griego clsico -Aristteles, por ejemplo- es tanto cristiano bizantino como rabe musulmn 5.

Esquema 1

4. Esto explica, en parte, que las luchas de la desarticulada Yugoslavia desde 1991 tienen larga historia (la Croacia latina, posteriormente catlica, contra la Serbia griega, que despus ser ortodoxa). 5. Mucha razn tiene Samir Amin, Eurocentrism, Monthly Review Press, Nueva York, 1989, cuando escribe: Ch ristianity and Islam are thus both heirs of Hellenism and remain, for this reason, twin siblings, even if they have been, at certain moments, relentless adversaries (p.26). Muestra muy bien que la filosofa helenstica sirvi primero al pensamiento cristiano bizantino (del siglo III al VII), posteriormente al rabe musulmn (cuyo esplendor comienza en el VIII siglo hasta el XII, de inspiracin aristotlica), y posteriormente el tiempo clsico escolstico latino desde fines del siglo XII (tambin aristotlico). El renacimiento platnico en Italia en el siglo XV, en cambio, ser ya de origen cristiano bizantino.

42

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

53

Europa, modernidad y eurocentrismo

Aclaraciones a las flechas: la influencia griega no es directa en la Europa latino occidental (pasa por las flechas a y b). La secuencia c de la Europa moderna no entronca con Grecia, ni tampoco directamente con el mundo bizantino (flecha d), sino ms bien con el mundo latino romano occidental cristianizado. En cuarto lugar, la Europa latina medieval se enfrenta igualmente al mundo rabe-turco. Nuevamente Aristteles, por ejemplo, es considerado ms un filsofo en manos de los rabes que de los cristianos. Abelardo, Alberto Magno y Toms de Aquino, contra la tradicin y arriesgndose a condenaciones, usan al Estagirita. En efecto, Aristteles ser estudiado y usado como el gran metafsico y lgico en Bagdad, mucho antes que sea traducido en la Espaa musulmana al latn, y de Toledo llegue a Pars a finales del siglo XII. Europa se distingue ahora del Africa, por primera vez (ya que sta es musulmana berebere; el Magreb), y del mundo oriental (principalmente del imperio bizantino, y de los comerciantes del Mediterrneo Oriental, del Medio Oriente). Las Cruzadas son el primer intento de la Europa latina de imponerse en el Mediterrneo Oriental. Fracasan, y con ello la Europa latina sigue siendo una cultura perifrica, secundaria y aislada por el mundo turco y musulmn, que domina geopolticamente desde Marruecos hasta Egipto, la Mesopotamia, el imperio Mogol del norte de la India, los reinos mercantiles de Malaka, hasta la isla Mindanao en Filipinas en el siglo XIII. La universalidad musulmana es la que llega del Atlntico al Pacfico. La Europa latina es una cultura perifrica y nunca ha sido hasta ese momento centro de la historia; ni siquiera con el imperio romano (que por su ubicacin extremadamente occidental nunca fue centro ni siquiera de la historia del continente euro-afro-asitico). Si algn imperio fue centro de la historia regional euro-asitica antes del mundo musulmn, slo podemos remontarnos a los imperios helenistas desde los Seleusidas, Ptolomeicos, el de Antocos, etc. Pero, de todas maneras, el helenismo no es Europa, y no alcanz una universalidad tan amplia como la musulmana en el siglo XV. En quinto lugar, en el renacimiento italiano (especialmente despus de la cada de Constantinopla en 1453), comienza una fusin novedosa: lo Occidental latino (secuencia c del esquema), se une con lo griego Oriental (flecha d), y enfrenta el mundo turco, el que, olvidando el origen helenstico-bizantino del mundo musulmn, permite la siguiente ecuacin falsa: Occidental = Helenstico + Romano + Cristiano. Nace as la ideologa eurocntrica del romanticismo alemn6 siguiente:
6. Uno de los mritos de las hiptesis de Martin Bernal, op.cit., tomo I, captulos IV-V, pp.189-280, es mostrar la importancia del movimiento que inaugura en 1803 Friedrich Schlegel ( Ueber die Sprache und Weisheit der Indier, Heidelberg), de donde la India, el Indoeuropeo, y la decadencia de la centralidad de Egipto (origen de la cultura y la filosofa griega para los griegos desde Herodoto, Platn y Aristteles hasta el siglo XVIII), permite a la ideologa prusiana unificar de manera directa la cultura clsica griega con la alemana: un pensamiento racista, ario, que impulsar a la invencin de las historias de la filosofa, donde de Grecia (autopoitica) y Roma se pasarn primero a la Edad Media, y luego directamente a Descartes y Kant. Abreak was made with the Latin tradition of humanism and an entirely new humanism, a true new Hellenism, grew up. Winckelmann was the initiator, Goethe the consummator, W ilhelm von Humboldt, in his linguistic, historical and educational writings, the theorist. Finally, Humboldts ideas were given practical effect when he became Prussian Minister of Education and founded the new university of Berlin and the new humanistic Gymnasium (R. Pfeiffer, History of Classical Scho larship, Clarendon, Oxford, 1976). Todo esto debe ser profundamente reconstruido, y sacado del helenocentrismo y eurocentrismo ya tradicional.

43

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

54

Enrique Dussel

Esquema 2

Esta secuencia es hoy la tradicional7. Nadie piensa que es una invencin ideolgica (que rapta a la cultura griega como exclusivamente europea y occidental), y que pretende que desde la poca griega y romana dichas culturas fueron centro de la historia mundial. Esta visin es doblemente falsa: en primer lugar, porque, como veremos, no hay fcticamente todava historia mundial (sino historias de ecumenes juxtapuestas y aisladas: la romana, persa, de los reinos hindes, del Siam, de la China, del mundo mesoamericano o inca en Amrica, etc.). En segundo lugar, porque el lugar geopoltico le impide poder ser centro (el Mar Rojo o Antioqua, lugar de trmino del comercio del Oriente, no son el centro sino el lmite occidental del mercado euro-afro-asitico). Tenemos as a la Europa latina del siglo XV, sitiada por el mundo musulmn, perifrica y secundaria en el extremo occidental del continente euro-afro-asitico.

7. Por ejemplo, Charles Taylor ( Sources of the Self. The Making of the Modern Identity, Harvard University Press, Cambridge, 1989) habla de Platn, Agustn, Descartes, etc. Es decir, la secuencia griega-romano cristiana-moderna europea, como siendo unilineal.

44

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

55

Europa, modernidad y eurocentrismo

Esquema 3
Aclaracin: la flecha a indica la procedencia del homo sapiens en Amrica y las influencias neolticas del Pacfico; nada ms.

II. Dos conceptos de Modernidad


Llegados a este punto de la descripcin entramos en el meollo de la discusin. Deberemos oponernos a la opinin hegemnica en cuanto a la interpretacin de la Europa moderna (a la Modernidad), y no como un tema extrao a la cultura latinoamericana, sino, contra la opinin corriente, como problema fundamental en la definicin de la Identidad latinoamericana -para hablar como Charles Taylor-. En efecto, hay dos conceptos de Modernidad. El primero es eurocntrico, provinciano, regional. La Modernidad es una emancipacin, una salida8 de la inmadurez por un esfuerzo de la razn como proceso crtico, que abre a la humanidad a un nuevo desarrollo del ser humano. Este proceso se cumplira en Europa, esencialmente en el siglo XVIII. El tiempo y el espacio de este fenmeno lo describe Hegel, y lo comenta Habermas en su conocida obra sobre el tema -y es unnimemente aceptado por toda la tradicin europea actual-: Los acontecimientos histricos claves para la implantacin del principio de la subjetividad [moderna] son la Reforma, la Ilustracin y la Revolucin francesa9.

8. Ausgang para Kant ( Was heit Aufklrung?, A 481). 9. Der philosophische Diskurs der Moderne, Suhrkamp, Frankfort, 1988, p.27.

45

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

56

Enrique Dussel

Como puede observarse se sigue una secuencia espacio-temporal: casi siempre se acepta tambin el Renacimiento italiano, la Reforma y la Ilustracin alemana y la Revolucin francesa. En un dilogo con Ricoeur10, ste nos propona adems el Parlamento ingls. Es decir: Italia (siglo XV), Alemania (siglos XVIXVIII), Francia (siglo XVIII), Inglaterra (siglo XVII). Denominamos a esta visin eurocntrica porque indica como punto de partida de la Modernidad fenmenos intra-europeos, y el desarrollo posterior no necesita ms que Europa para explicar el proceso. Esta es aproximadamente la visin provinciana y regional desde Max Weber -con su anlisis sobre la racionalizacin y el desencantohasta Habermas). Para muchos un Galileo (condenado en 1616), Bacon (Novum Organum, 1620) o Descartes (El discurso del mtodo, 1636) seran los iniciadores del proceso moderno en el siglo XVII. Proponemos una segunda visin de la Modernidad, en un sentido mundial, y consistira en definir como determinacin fundamental del mundo moderno el hecho de ser (sus Estados, ejrcitos, economa, filosofa, etc.) centro de la Historia Mundial. Es decir, nunca hubo empricamente Historia Mundial hasta el 1492 (como fecha de iniciacin11 del despliegue del Sistema-mundo)12. Anteriormente a esta fecha los imperios o sistemas culturales coexistan entre s. Slo con la expansin portuguesa desde el siglo XV, que llega al Extremo Oriente en el siglo XVI, y con el descubrimiento de Amrica hispnica, todo el planeta se torna el lugar de una sola Historia Mundial (Magallanes-Elcano da la vuelta de circunvalacin a la tierra en 1521). Espaa, como primera nacin moderna (con un Estado que unifica la pennsula, con la Inquisicin que crea de arriba-abajo el consenso nacional, con un poder militar nacional al conquistar Granada, con la edicin de la Gramtica castellana de Nebrija en 1492, con la Iglesia dominada por el Estado gracias al cardenal Cisneros, etc.) abre la primera etapa Moderna: el mercantilismo mundial. Las minas de plata de Potos y Zacatecas (descubiertas en 1545-1546) permiten acumular riqueza monetaria suficiente para vencer a los Turcos en Lepanto veinticinco aos despus de dicho hallazgo (1571). El Atlntico suplanta al Mediterrneo. Para nosotros, la centralidad de la Europa latina en la Historia Mundial es la determina cin fundamental de la Modernidad. Las dems determinaciones se van dando en torno a ella (la subjetividad constituyente, la propiedad privada, la libertad del contrato, etc.). El siglo XVII (p.e. Descartes, etc.) son ya el fruto de un siglo y medio de Modernidad: son efecto y no punto de partida. Holanda (que se emancipa de Espaa en 1610), Inglaterra y Francia continuarn el camino abierto.
10. Filosofia e Liberazione. La sfida del pensiero del Terzo Mondo , Capone Editore, Lecce, 1992. 11. Vase mi obra 1492: El encubrimiento del Otro. Hacia el origen del mito de la Modernidad, Nueva Utopa, Madrid 1992 (Editions Ouvrires, Paris, 1992; La Piccola Editrice, Bescia, 1993; Patmos Verlag, Dsseldorf, 1993). 12. Vase Immanuel Wallerstein, The Modern World-System, Academic Press, San Diego-Nueva York, t.I, 1974 .

46

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

57

Europa, modernidad y eurocentrismo

La segunda etapa de la Modernidad, la de la revolucin industrial del siglo XVIII y de la Ilustracin, profundizan y amplan el horizonte ya comenzado a fines del siglo XV. Inglaterra reemplaza a Espaa como potencia hegemnica hasta el 1945, y tiene el comando de la Europa moderna, de la Historia mundial (en especial desde el surgimiento del Imperialismo en torno a 1870). Esta Europa Moderna, desde 1492, centro de la Historia Mundial, constituye, por primera vez en la historia, a todas las otras culturas como su periferia.

Esquema 4

Aclaraciones: flecha a: la primer periferia; b: el esclavismo en sus costas occidentales; flecha c: algunas colonias (como Goa, etc.), pero sin ocupacin continental; d: emancipacin de Estados Unidos; e: emancipacin hispanoamericana. En la interpretacin habitual de la Modernidad se deja de lado a Portugal y Espaa, y con ellos el siglo XVI hispanoamericano, que en opinin unnime de los especialistas nada tiene que ver con la Modernidad -sino, quiz, con el fin de la Edad Media-. Y bien, deseamos oponernos a estas falsas unanimidades y proponer una completa y distinta conceptualizacin de la Modernidad, con un sentido mundial, lo que nos llevar a una interpretacin de la racionalidad moderna diversa de los que piensan realizarla (como Habermas) como de los que se oponen a ella (como los Postmodernos). 47

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

58

Enrique Dussel

III. Racionalidad e irracionalidad o el mito de la Modernidad


Si se entiende que la modernidad de Europa ser el despliegue de las posibilidades que se abren desde su centralidad en la Historia Mundial, y la constitucin de todas las otras culturas como su periferia, podr comprenderse el que, aunque toda cultura es etnocntrica, el etnocentrismo europeo moderno es el nico que puede pretender identificarse con la universalidad-mundialidad. El eurocentrismo de la Modernidad es exactamente el haber confundido la universalidad abstracta con la mundialidad concreta13 hegemonizada por Europa como centro. El ego cogito moderno fue antecedido en ms de un siglo por el ego conqui ro (Yo conquisto) prctico del hispano-lusitano que impuso su voluntad (la primera Voluntad-de-Poder moderna) al indio americano. La conquista de Mxico fue el primer mbito del ego moderno. Europa (Espaa) tena evidente superioridad sobre las culturas aztecas, mayas, incas, etc.14, en especial por sus armas de hierro15 -presentes en todo el horizonte euro-afro-asitico-. Europa moderna, desde 1492, usar la conquista de Latinoamrica (ya que Norteamrica slo entra en juego en el siglo XVII) como trampoln para sacar una ventaja comparativa determinante con respecto a sus antiguas culturas antagnicas (turco-musulmana, etc.). Su superioridad ser, en buena parte, fruto de la acumulacin de riqueza, experiencia, conocimientos, etc., que acopiar desde la conquista de Latinoamrica16. La Modernidad, como nuevo paradigma de vida cotidiana, de comprensin de la historia, de la ciencia, de la religin, surge al final del siglo XV y con el dominio del Atlntico. El siglo XVII es ya fruto del siglo XVI; Holanda, Francia, Inglaterra, son ya desarrollo posterior en el horizonte abierto por Portugal y Espaa. Amrica Latina entra en la Modernidad (mucho antes que Norte Amrica) como la otra cara dominada, explotada, encubierta. Si la Modernidad tiene un ncleo racional ad intra fuerte, como salida de la Humanidad de un estado de inmadurez regional, provinciana, no planetaria; dicha Modernidad, por otra parte ad extra, realiza un proceso irracional que se oculta a sus propios ojos. Es decir, por su contenido secundario y negativo mti co17, la Modernidad es justificacin de una praxis irracional de violencia. El mi to podra describirse as:
13. Universalidad abstracta es lo que pretende, por ejemplo, Kant con su principio de la moralidad. De hecho, sin embargo, identific la mxima europea con la universalizable. 14. No tena superioridad con respecto a las culturas turco-musulmanas, mongolas o mogolas, china, etc. 15. El amerindio no usaba armas sino de madera. 16. La China, presente desde Kenya hasta Alaska, no tuvo ningn inters particular de ocupar una Amrica inhspita y sin complementaridad con su propia economa. Lo contrario ocurre para las potencias comerciales del Mediterrneo italiano (y Espaa es, en cierta manera su continuacin), de all que la ecuacin del desarrollo diacrnico de la Modernidad debera ser: Renacimiento, Conquista de Latinoamrica, Reforma, Ilustracin, etc. 17. Es sabido que Max Horkheimer-Theodor Adorno, Dialektik der Aufklrung (1944), Fischer, Frankfort, 1971 (vase Jrgen Habermas, Der philosophische Diskurs der Moderne, Suhrkamp, Frankfort, 1988, pp.130ss.: Die Verschlingung von Mythos und Aufklrung), define un cierto nivel mtico de la Modernidad, que Habermas no puede admitir. Nuestro sentido de mito se sita no en un nivel intra-europeo (como en el caso de Horkheimer, Adorno o Habermas), sino en un nivel Centro-Periferia, Norte-Sur, es decir, en un nivel mundial.

48

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

59

Europa, modernidad y eurocentrismo

1) La civilizacin moderna se autocomprende como ms desarrollada, superior (lo que significar sostener sin conciencia una posicin ideolgicamente eurocntrica). 2) La superioridad obliga a desarrollar a los ms primitivos, rudos, brbaros, como exigencia moral. 3) El camino de dicho proceso educativo de desarrollo debe ser el seguido por Europa (es, de hecho, un desarrollo unilineal y a la europea, lo que determina, nuevamente sin conciencia alguna, la falacia desarrollista). 4) Como el brbaro se opone al proceso civilizador, la praxis moderna debe ejercer en ltimo caso la violencia si fuera necesario, para destruir los obstculos de la tal modernizacin (la guerra justa colonial). 5) Esta dominacin produce vctimas (de muy variadas maneras), violencia que es interpretada como un acto inevitable, y con el sentido cuasi-ritual de sacrificio; el hroe civilizador inviste a sus mismas vctimas del carcter de ser holocaustos de un sacrificio salvador (el indio colonizado, el esclavo africano, la mujer, la destruccin ecolgica de la tierra, etctera). 6) Para el moderno, el brbaro tiene una culpa18 (el oponerse al proceso civilizador)19 que permite a la Modernidad presentarse no slo como inocente sino como emancipadora de esa culpa de sus propias vctimas. 7) Por ltimo, y por el carcter civilizatorio de la Modernidad, se interpretan como inevitables los sufrimientos o sacrificios (los costos) de la modernizacin de los otros pueblos atrasados (inmaduros)20, de las otras razas esclavizables, del otro sexo por dbil, etctera. Por todo ello, si se pretende la superacin de la Modernidad ser necesario negar la negacin del mito de la Modernidad. Para ello, la otra-cara negada y victimada de la Modernidad debe primeramente descubrirse como inocente: es la vctima inocente del sacrificio ritual, que al descubrirse como inocente juzga a la Modernidad como culpable de la violencia sacrificadora, conquistadora originaria, constitutiva, esencial. Al negar la inocencia de la Modernidad y al afirmar la Alteridad de el Otro, negado antes como vctima culpable, permite des-cubrir por primera vez la otra-cara oculta y esencial a la Modernidad: el mundo perifrico colonial, el indio sacrificado, el negro esclavizado, la mujer oprimida, el nio y la cultura popular alienadas, etctera (las vctimas de la Modernidad) como vctimas de un acto irracional (como contradiccin del ideal racional de la misma Modernidad).
18. Kant, Op.cit., nos habla de inmadurez culpable ( verschuldeten). 19. El mismo Francisco de Vitoria, profesor de Salamanca, admite como ltima razn para declarar la guerra, el que los indgenas opongan impedimentos a la predicacin de la doctrina cristiana. Slo para destruir esos obstculos se puede hacer la guerra. 20. Para Kant unmundig: inmaduro, rudo, no-educado.

49

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

60

Enrique Dussel

Slo cuando se niega el mito civilizatorio y de la inocencia de la violencia moderna, se reconoce la injusticia de la praxis sacrificial fuera de Europa (y an en Europa misma), y entonces se puede igualmente superar la limitacin esencial de la razn emancipadora. Se supera la razn emancipadora como razn liberadora cuando se descubre el eurocentrismo de la razn ilustrada, cuando se define la falacia desarrollista del proceso de modernizacin hegemnico. Esto es posible, an para la razn de la Ilustracin, cuando ticamente se descubre la dignidad del Otro (de la otra cultura, del otro sexo y gnero, etctera); cuando se declara inocente a las vctimas desde la afirmacin de su Alteridad como Identidad en la Exterioridad como personas que han sido negadas por la Modernidad. De esta manera, la razn moderna es trascendida (pero no como negacin de la razn en cuanto tal, sino de la razn violenta eurocntrica, desarrollista, hegemnica). Se trata de una Trans-Modernidad como proyecto mundial de liberacin donde la Alteridad, que era co-esencial de la Modernidad, se realice igualmente. La realizacin de la Modernidad no se efecta en un pasaje de la potencia de la Modernidad a la actualidad de dicha Modernidad europea. La realizacin sera ahora el pasaje trascendente, donde la Modernidad y su Alteridad negada (las vctimas), se co-realizarn por mutua fecundidad creadora. El proyecto trans-moderno es una co-realizacin de lo imposible para la sola Modernidad; es decir, es co-realizacin de solidaridad, que hemos llamado analctica, del Centro/Periferia, Mujer/Varn, diversas razas, diversas etnias, diversas clases, Humanidad/Tierra, Cultura occidental/Culturas del Mundo Perifrico ex-colonial, etctera; no por pura negacin, sino por incorporacin21 desde la Alteridad22. De manera que no se trata de un proyecto pre-moderno, como afirmacin folklrica del pasado; ni un proyecto anti-moderno de grupos conservadores, de derecha, de grupos nazis o fascistas o populistas; ni un proyecto post-moderno como negacin de la Modernidad como crtica de toda razn, para caer en un irracionalismo nihilista. Debe ser un proyecto trans-moderno (y sera entonces una Trans-Modernidad) por subsuncin real del carcter emancipador racional de la Modernidad y de su Alteridad negada (el Otro de la Modernidad), por negacin de su carcter mtico (que justifica la inocencia de la Modernidad sobre sus vctimas y por ello se torna contradictoriamente irracional). En ciertas ciudades de la Europa medieval, en las renacentistas del Quatrocento, creci formalmente la cultura que producir la Modernidad. Pero la Modernidad realmente pudo nacer cuando se dan las condiciones histricas de su origen efectivo: el 1492 -su emprica mundializacin, la organizacin de un mundo colonial, y el usufructo de la vida de sus vctimas, en un nivel pragmtico y econmico. La Modernidad nace realmente en el 1492: esa es nuestra tesis. Su real superacin (como subsuntion (y no meramente como Aufhebung hegeliana) es subsuncin de su carcter eman21. Traducimos de esta manera la palabra subsuntion en Marx que, por su etimologa latina, corresponde a la Auf hebung hegeliana. 22. Vase mi Philosophie der Befreiung , con respecto al momento analctico del movimiento dialctico subsuntivo (5.3) (edicin italiana en Queriniana, Brescia, 1992).

50

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

61

Europa, modernidad y eurocentrismo

cipador racional europeo trascendido como proyecto mundial de liberacin de su Alteridad negada: la Trans-Modernidad (como nuevo proyecto de liberacin poltico, econmico, ecolgico, ertico, pedaggico, religioso, etctera). Proponemos entonces dos paradigmas contradictorios: el de la mera Modernidad eurocntrica, y el de la Modernidad subsumida desde un horizonte mundial, donde cumpli una funcin ambigua (por una parte, como emancipacin; y, por otra, como mtica cultura de la violencia). La realizacin del segundo paradigma es un proceso de Trans-Modernidad. Slo el segundo paradigma incluye a la Modernidad/Alteridad mundial. En la obra de Tzetan Todorov, Nosotros y los otros23, el nosotros son los europeos, y los otros somos nosotros, los pueblos del mundo perifrico. La Modernidad se defini como emancipacin con respecto al nosotros, pero no advirti su carcter mtico-sacrificial con respeto a los otros. Montaigne lo vio de alguna manera cuando escribi: As, podemos llamarlos brbaros con respecto a nuestras reglas de la razn, pero no con respecto a nosotros, que los rebasamos en toda especie de barbarie24.

Esquema 5

Dos paradigmas de modernidad


(Simplificacin esquemtica de algunos momentos que codeterminan la comprensin de ambos paradigmas) Lase diacrnicamente desde A hacia G y de a hacia i. I) Determinaciones ms relevantes: A: Europa en el momento del descubrimiento (1492) B: El presente europeo moderno C: Proyecto de realizacin (habermasiana) de la Modernidad
23. Seuil, Paris, 1989. 24. Des Cannibales, en Oeuvres Compltes, Gallimard-Pliade, Paris, 1967, p.208.

51

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

62

Enrique Dussel

D: La invasin del continente (de Africa y Asia posteriormente) E: El presente perifrico F: Proyecto dentro del Nuevo Orden Mundial dependiente G: Proyecto mundial de liberacin (Trans-modernidad) R: Mercantilismo hispnico (Renacimiento y Reforma) K: Capitalismo industrial (La Aufklrung) II) Relaciones con una cierta direccin o flechas: a: Historia europea medieval (lo pre-moderno europeo) b: Historia moderno-europea c: Praxis de realizacin de C d: Historias anteriores a la conquista europea (Amrica Latina, Africa y Asia) e: Historia colonial y dependiente mercantilista f: Historia del mundo perifrico al capitalismo industrial g: Praxis de realizacin de F (desarrollismo) h: Praxis de liberacin o de realizacin de G i: Praxis de solidaridad del Centro con la Periferia 1,2,3,n: Tipos histricos de dominacin (de A -> D, etc.) III) Los dos paradigmas de Modernidad: [ ]: Paradigma eurocntrico de Modernidad: [R->K->B->C] { }: Paradigma mundial de Modernidad/Alteridad (hacia una Trans-modernidad): {A/D->B/E->G} A los 500 aos del comienzo de la Europa moderna, leemos en Informe so bre el desarrollo humano 199225 de las Naciones Unidas que el 20 % ms rico de la humanidad (principalmente Europa occidental, Estados Unidos y Japn) consume el 82 % de los bienes de la tierra, y el 60 % ms pobre (la periferia histrica del Sistema-mundial) consume el 5,8% de dichos bienes. Una concentracin jams observada en la historia de la humanidad! Una injusticia estructural nunca sospechada en la escala mundial! No es este acaso el fruto de la Modernidad o del Sistema mundial que inici la Europa occidental?
25. United Nations Development Programme (UNDP), Human Development Report 1992, Oxford University Press, Nueva York, 1992, p.35. En 1930 la diferencia entre los 20 % ms ricos de la humanidad y los 20 % ms pobres era de 1 a 30, en 1990 es de 1 a 59 (casi el doble en slo 30 aos). Vase tambin en el tema, The Invention of the Ame ricas. Eclipse of the Other and the Myth of Modernity, Continuum Publishing, Nueva York, 1995; The Undersi de of Modernity. Ricoeur, Apel, Taylor and the Philosophy of Liberation, Humanities Press, Nueva York, 1996 y Eti ca de la Liberacin en la Edad de la Globalizacin y la Exclusin, Editorial Trotta-UAM.I-UNAM, Mxico, 1998.

52

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

63

Europa, modernidad y eurocentrismo

Referencias bibliogrficas
Amin, Samir: Eurocentrism, Monthly Review Press, Nueva York, 1989. (Edicin en espaol: El eurocentrismo, Siglo XXI Editores, Mxico, 1989). Bernal, Martin: Black Athena. The Afroasiatic Roots of Classical Civiliza tion, Rutgers University Press, New Jersey, t.I, 1987. Dussel, Enrique: Etica de la Liberacin en la Edad de la Globalizacin y la Exclusin, Editorial Trotta-UAM.I-UNAM, Mxico, 1998. Dussel, Enrique: The Underside of Modernity. Ricoeur, Apel, Taylor and the Philosophy of Liberation, Humanities Press, Nueva York, 1996 (Edicin en espaol: Apel, Ricoeur, Rorty y la filosofa de la liberacin, Universidad de Guadalajara, Mxico, 1993). Dussel, Enrique: The Invention of the Americas. Eclipse of the Other and the Myth of Modernity, Continuum Publishing, Nueva York, 1995. (Edicin en espaol: 1492: El encubrimiento del Otro. Hacia el origen del mito de la Modernidad, Nueva Utopa, Madrid, 1992.) Dussel, Enrique: Filosofa de la liberacin, Edicol, Mxico 1977, Usta, Bogot, 1980. Dussel, Enrique: El humanismo semita, EUDEBA, Buenos Aires, 1969. Habermas, Jrgen: Der philosophische Diskurs der Moderne, Suhrkamp, Frankfurt, 1988. (Edicin en espaol: El discurso filosfico de la moderni dad, Editorial Taurus, Madrid, 1989). Horkheimer, Max y Theodor Adorno: Dialektik der Aufklrung [1944], Fischer, Frankfurt, 1971. (Edicin en espaol: La dialctica de la ilustracin, Editorial Trotta, Madrid, 1997). Montaigne: Des Cannibales, en Oeuvres Compltes, Gallimard-Pliade, Paris, 1967. Pfeiffer, R:, History of Classical Scholarship , Clarendon, Oxford, 1976. Taylor, Charles: Sources of the Self. The Making of the Modern Identity, Harvard University Press, Cambridge, 1989. Todorov, Tzetan: Nosotros y los otros, Siglo XXI Editores, Mxico, 1991. United Nations Development Programme (UNDP): Human Development Re port 1992, Oxford University Press, Nueva York, 1992. Wallerstein, Immanuel: The Modern World-System, Academic Press, San Diego-Nueva York, tomo I,1974. 53

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

64

FENOMENOLOGADELACONCIENCIADESLADIALCTICADELAMOYELESCLAVO
1. En la Fenomenologa la conciencia de s aparece como la verdad de la conciencia (1). En estanuevay ms elevada forma de laconcienciaelsaberde lootro,delobjeto,aparececomo un saber de si y adems este saber de s, la conciencia de s, es algo ms que el saber de lo otro. La conciencia de s es esencialmente conciencia prctica, conciencia de una superacin delsaberdelootro,delmeroobjeto,delanaturaleza. 2. La conciencia de s aparece en la Fenomenologaen oposicin a la conciencia en sentido estricto o mera conciencia, sensible, percipiente o del entendimiento como la conciencia activa. La positividad de la conciencia sensible, su pasividad, se torna negatividad, actividad negadoraenlaconcienciades. 3. La primera forma de la conciencia de s, de la conciencia prctica, es el deseo que, oponindose al mundo y a s mismo como ser que est en el mundo, nos conduce a formas mscomplejasdeestamismaconcienciaprctica. 4. En este proceso se ponen de manifiesto las insuficiencias de la conciencia terica y de la conciencia prctica, de la conciencia y de la conciencia de s como la necesidad y la exigencia de una sntesis. As surge la Razn como una nueva forma de conciencia que ser la identidad delaconcienciaydelaconcienciades,delserydelactuar. Este es el carcter general y el movimiento de la conciencia de s, su gnesis y su fin. Sigamos ahorasuvida,describamossuexperiencia. 5. El anlisis del "pensamiento", de la "razn", del "entendimiento" o, lo que es igual, el comportamiento cognoscitivo, contemplativo y por lo tanto pasivo de un ser o de un sujeto cognoscente, no descubre nunca el porqu o el cmo del nacimiento de la palabra Yo y por consecuencia de la conciencia de s, es decir, de la realidad humana (2). El hombre que contempla con atencin una cosa, que quiere verla tal como es sin cambiar en ella nada, es absorbido por esta contemplacin (est absortocomo se dice en ella, en estado de hipnosis, desapoderadodesmismo,cautivo,prisionerodelocontemplado)(3).Seolvidaasmismo,no piensa ms que en la cosa contemplada; no piensa ni en su contemplacin ni menos an en s mismo, en su Yo. Es tanto menos consciente de s cuanto ms consciente de la cosa. Nos hablar de la cosa pero no de s mismo. La contemplacin revela el objeto, no el sujeto (4). El hombre absorto, perdido en el objeto, no puede ser "despertado a s mismo" ms que por un Deseo. En efecto, cuando el hombre experimenta un deseo cualquiera, pongamos el ms rudimentario, el de nutrirse, y cobra conciencia de l, cobra al mismo tiempo y necesariamenteconcienciades(5).Eldeseoserevelasiemprecomomideseoyparaexpresar el deseo es indispensable servirse de la palabra Yo. Es en y por, o en tanto que es l mismo su deseo que el hombre se revela a s y a los otros como un Yo, como el Yo esencialmente diferentedelnoYoyradicalmenteopuestoal(6).ElYohumanoeselYodelDeseo. No es pues la contemplacin puramente cognoscente y pasiva lo que constituye la base de la conciencia de s, es decir, de la existencia verdaderamente humana y por ende y en ltima instanciadelaexistenciafilosfica,sinoelDeseo(7). 6.Peroqueseldeseo,enquconsiste?(8).Eldeseoessiempreeldeseodetransformarpor una accin la cosa contemplada, en suprimirla en su ser que no tiene relacin con el mo, que

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

65

me es extrao, ajeno, que es independiente de m; es el deseo de negar, abolir esta independencia suya, dominarla, asimilarla a m a m vez, como haca antes conmigo, absorberla en y por mi Yo. Para que haya pues conciencia de s y por consecuencia filosofa es necesarioquehayaenelhombrenosolamentecontemplacinpositiva,pasiva,slorevelacin del ser, sino adems deseo negador y, por consiguiente, accin transformadora del ser dado. Es necesario que el Yo humano sea un Yo del Deseo, un Yo activo, un Yo negador, un Yo que transformaelSer,quecreaunsernuevodestruyendoelserdado. Nacida del Deseo, la accin tiende a satisfacerlo y no puede lograrlo ms que por la negacin, la destruccin, o cuando menos la transformacin del objeto deseado (9). Para satisfacer el hambre es necesario destruir o transformar el alimento. Pero la accin negadora, transformadora, no es puramente destructiva. El ser que se alimenta crea o recrea y mantiene supropiarealidadporlasupresindeesarealidadquenoeslasuya,delobjeto,delootro;por laasimilacinointeriorizacindeunarealidadextraa,exterior. EsteeselDeseo.VeamosahoraqueselYodeldeseo. 7. El Yo del deseo (es una nada, nada de algo, una falta, una ausencia, un vaco, vido de ser, de presencia, de plenitud); un vaco quequiere colmarsecon loqueest colmado, vaciando el ser, reducindolo a nada a su turno (una nada que quiere trocar sus papeles con el ser; ahora letocaalserserlanada,yalanadaelser,diceelYodeldeseo)(10).Ocuparconsuplenitudel vacoquedejalaplenitudsuprimida,quenoerasuya. ElYodelDeseo,el hombre,para ser nopuedeser unSer que es,que eseternamenteidntico a s mismo, que se basta a s mismo. El hombre debe ser un vaco, una nada, que no es una pura nada sino algo que es en la medida en que anonada, aniquila el ser para realizarse a sus expensas.Elhombreeslaaccinnegadoraquetransformaalserdadoyquesetransformaas mismo transformando ese ser. El ser del hombre no es jams lo que es y es siempre lo que no es. No es lo que es sino en tanto en que se vuelve lo que es, en tanto cambia, deviene. Su ser es Devenir, Tiempo, Historia, y no deviene, no es tiempo histrico ms que en y por la accin negadoradelodado,laaccindelaluchayelTrabajo. 8. Pero como no hay Deseo sin vida no puede haber existencia humana sin realidad biolgica, sinvidaanimal.Unapiedra,unaplanta,carentesdedeseonolleganjamsalaconcienciades (11). Pero el animal tampoco llega a ella. El Deseo animal es una condicin necesaria de la conciencia de s, de la existencia humana y por ende de la filosofa, pero no es una condicin suficiente. El Deseo animal el hambre, por ejemplo y la accin que deriva de l niegan, destruyen la naturaleza dada. Negndola la modifican, la hacen suya. El animal se eleva por encima de lo dado. Hegel dice que el animal comiendo la yerba revela y realiza su superioridad sobre ella. Pero nutrindose de yerbas el animal depende de ellas y no llega a superarlas verdaderamente.Elanimalnoseelevaporencimadelanaturalezanegadaensudeseoanimal sino para recaer inmediatamente en ella por la satisfaccin de ese deseo. As el animal no alcanza ms que al sentimiento de s pero no a la conciencia de s. No se trasciende a si mismo en tanto que ser dado, es decir, en tanto que cuerpo, que naturaleza; no se eleva por encima de s para poder volver sobre si; carece de distancia respecto de s para poder contemplarse. Para que haya conciencia de si, para que haya filosofa, es necesario que se trascienda el propioserentantoqueesunserdado,entantoquenaturaleza,cuerpo(12).Esnecesarioque

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

66

el Deseo tienda y se refiera a un objeto no natural, a algo que rebase la realidad dada. Si el Deseo se refiere a un noYo natural el Yo del Deseo ser un Yo tambin natural (13). El Yo creado por la satisfaccin activa de tal deseo tendr la misma naturaleza que las cosas a las que se refiere el deseo, ser un Yo slo viviente, un Yo animal. Y este Yo natural, funcin del objeto natural, no podr revelarse a s mismo y a los otros ms que en tanto que sentimiento desi,noalcanzarlaconcienciades. La conciencia de s slo es posible si el Deseo recae no sobre un ser dado natural sino sobre unnoser(14).Desearelserescolmarsedeesteserdado,esesclavizarseal,Desearelnoser es liberarse del Ser, realizar la propia autonoma, la libertad. Para ser humano el deseo debe recaersobreunnoser,esdecirsobreotroDeseo,sobreotrovacovido,sobreotroYo.Pues el deseoeslapresencia dela ausenciadeunarealidad,esesencialmenteotracosaquelacosa deseada, otra cosa que una cosa, que un ser real esttico y dado, que se mantiene estticamenteenlaidentidadconsigomismo(15). 9. Para que haya Deseo humano es necesario que haya primeramente una pluralidad de Deseos. La realidad humana es una realidad social. La condicin de la conciencia de s es la existencia de otra conciencia de s (16). Pero si la realidad humana es una realidad social la sociedad no es humana sino como pluralidad de Deseos que se desean recprocamente en tanto que Deseos (17). El Deseo humano que constituye a un individuo libre e histrico, consciente de su individualidad, de su libertad, de su historia, y finalmente de su historicidad, en suma, con conciencia de s, difiere pues del Deseo animal, que constituye o crea un ser puramente natural, un mero ser viviente que no tiene ms que sentimiento de s, y difiere porque recae, no sobre un hecho real "positivo", sobre una cosa dada, sino sobre otro Deseo. As en el Amor el Deseo no es humano ms que si se desea no el cuerpo sino el: Deseo del otro, si se quiere asimilar, poseer el Deseo en tanto que Deseo, es decir, si se quiere ser deseadooamadoobientodava"reconocido"ensuvalorhumano,ensurealidaddeindividuo humano. El hombre que desea humanamente una cosa natural acta no tanto para apoderarsedelacosacomoparaqueotroreconozcasuderechoaella,comosedirmstarde (18). Para que el hombre sea verdaderamente humano, para que difiera real y esencialmente del animal es necesario que su Deseo humano predomine efectivamente en l sobre su Deseo animal (19). Ahora bien, todo Deseo es Deseo de un valor. El valor supremo para el animal es su vida animal. Todos los deseos del animal son en ltimo anlisis una funcin del deseo que tiene de conservar su vida. El Deseo humano debe pues ir ms all de este deseo de conservacin. El hombre no se revela como humano, no se crea como tal, ms que si l arriesgasuvidaanimalenfuncindesuDeseohumano.Eneste riesgolarealidadhumanase muestra, se verifica y se demuestra como esencialmente diferente de la realidad animal, natural.(Laconcienciadesnacedelavidapeligrosa). ElhombreserevelacomohumanoarriesgandosuvidaparasatisfacersuDeseohumanoque tiene por objeto otro Deseo. Desear el Deseo de otro es desear que el valor que yo soy o que yo represento sea el valor deseado por ese otro; yo quiero que l reconozca mi valor como su valor,quieroquelmereconozcacomounvalorautnomo.Tododeseohumanosereduceal findecuentasaldeseodereconocimiento.Ylavidasearriesgaporestereconocimiento. 10. Pero cada conciencia de s es para s, y en tanto que tal niega todo objeto, toda cosa, todo ser (20). Es Deseo, pero deseo que se afirma en su carcter de absoluto, en su carcter exclusivo.Sinembargo,ellaestambinparaotro,paraotraconcienciadesi.Peronoesparala otraconcienciade s loquees paras misma.Parasimismaella es absoluta certidumbredes, para la otra es un simple objeto o ser viviente, una cosa independiente en el medio del ser, algo dado, algo que es visto como un "fuera". Esta es la desigualdad que debe desaparecer, y

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

67

desaparecer tanto de un lado como de otro, pues cada una es una cosa viviente para la otra y unacertidumbreabsolutadesparasi. Yonosoyunaconcienciadesmsquesiyomehagoreconocerporotraconcienciadesysi reconozco a la otra de la misma manera. Este reconocimiento recproco crea el elemento de la vida espiritual. El concepto de la conciencia de si es, en efecto, "el concepto de la infinidad realizndose en y por la conciencia", que expresa el movimiento por el cual cada trmino se vuelvelmismoinfinito,sevuelveporlotantootropermaneciendoens. 11. Pero al comienzo se quiere ser reconocido sin reconocer (21). Cada conciencia de s se afirmademodoabsolutoyporlotantoexclusivoyexigeelreconocimientouniversal(22).Pero comohayunapluralidaddeestosDeseosesevidentequelaaccinquenacedeellosnopuede sercuando menos al principio sino una lucha a vida o muerte. Cada uno querr someter al otro, a todos los otros, por una accin negadora, destructiva. El hombre arriesgar as su vida biolgica natural para satisfacer su deseo no biolgico, histrico, social, humano. Y Hegel dice que el ser que es incapaz de poner en peligro su vida para alcanzar los fines no inmediatamente vitales, es decir, que no puede ni quiere arriesgar su vida en una lucha por el Reconocimiento,enunaluchadepuroprestigio,noesunserverdaderamentehumano. Ser hombre es no ser retenido por ninguna existencia determinada (23). El hombre tiene la posibilidaddenegarlanaturalezaysupropianaturaleza:puedequerersumuerte,arriesgarsu vida.Talessusernegativo,negador:realizarlaposibilidaddenegarytrascendernegndolasu realidaddada,loquees,sermsyotracosaqueelserqueslovive. No se puede ser hombre ms que si se puede, si se es capaz de morir. Pero para ser un hombre es necesario morir como hombre. La muerte debe ser libremente aceptada en una lucha y no el resultado de un proceso meramente fisiolgico. Arriesgando as su vida por el reconocimiento pruebo al otro que no soy un mero ser, un animal; atentando contra la vida delotroleprueboqueloreconozcocomohombre. Sin embargo, si todos los hombres, o todos los seres en vas de volverse hombres, se comportasen de la misma manera, llevasen la lucha hasta el fin, slo habra un vencedor y el fin mismodel deseo quedara frustradopuesnohabra quin lo reconociera, noexistiranadie para reconocerlo (24). Y por eso l tampoco sera un ser humano. El hombre no quiere ser reconocido por un cadver ni le basta ser reconocido por s mismo, necesita ser reconocido por otro. Para que haya conciencia de s no slo es necesario pues que haya pluralidad de Deseos, que esta realidad sea mltiple; es indispensable que esta realidad implique comportamientoshumanosesencialmentediferentes(25). Para que la realidad humana, la conciencia de s, pueda constituirse como realidad "reconocida" es necesario que los dos adversarios queden con vida despus de la lucha. Y eso noesposibleamenosquesecomportendiferentementeenestalucha. 12. Por actos de libertad irreductibles e imprevisibles (ninguno de los dos est predestinado a ser vencedor ni vencido ni a quedar definitivamente tal) deben relacionarse como seres desiguales en y por esta lucha. Uno debe tener miedo del otro, debe ceder al otro, debe rechazar el riesgo de su vida. Debe abandonar su deseo de reconocimiento y satisfacer el deseo del otro. Debe reconocerlo sin ser reconocido por l. Ahora bien, este reconocimiento implica que l reconoce al otro como su Amo y se reconoce a si mismo y se hace reconocer como Esclavo por l, por el Amo. En sus orgenes el hombre no es nunca hombre simplemente. Es necesaria y esencialmente o bien Amo o bien Esclavo. La sociedad no es

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

68

humana, cuando menos en sus orgenes, ms que a condicin de suponer un elemento de Dominio y un elemento de Servidumbre, existencias autnomas y existencias dependientes. Por eso hablar del origen de la conciencia de s es hablar de la autonoma y de la dependencia de la conciencia de s, del Amo y del Esclavo. Al hombre que lucha no le es til matar a su adversario (26). Debe slo suprimirlo dialcticamente. Es decir que debe dejarle la vida y la concienciaynodestruirmsquesuautonoma.Nodebesuprimirlosinoentantoleesopuesto yactacontral.Debeesclavizarlo. El vencido ha subordinado su deseo humano de reconocimiento al deseo biolgico de conservacindelavida;esloquedeterminayrevela,alyalvencedor,suinferioridad(27).El vencedor ha arriesgado su vida por un fin no vital, y es lo que determina y revela, a l y al vencido, su superioridad sobre la vida biolgica. As la diferencia entre Amo y Esclavo se ha realizadoenlaexistenciadelvencedorydelvencidoyellaesreconocidaporlosdos. 13.ElAmoesunserparas(28).Todoelrestonoesparalmsqueunmedio.Sereconocea s mismo a travs del reconocimiento del otro pero no reconoce a este otro. Pero advirtase que la conciencia por la cual es reconocido no es ms que la conciencia de un Esclavo. Existe paraunhombreperoestehombrenoesmsqueunEsclavo. El Amo no es pues un hombre verdadero, no es ms que una etapa hacia l (29). Este reconocimiento nunca le satisfar pues slo los Esclavos le reconocen. De su parte el Esclavo depende de la vida, de las cosas. Siri embargo su repudio de la muerte es tambin una actitud humana. Su dependencia de las cosas es asimismo humana porque es negadora, transformadora de las cosas. Las domina pero depende tambin de ellas. Su trabajo tiene un ladopositivo,creador,yunladonegativoquelesubordinaalmundonatural.ElEsclavotrabaja para un Amo. La actitud del Amo respecto de las cosas del mundo natural est mediatizada por la conciencia y la actividad del Esclavo. El Amo vive as en un mundo tcnico, histrico, humanizado por el trabajo y no en un mundo natural. No depende de ese mundo pues el Esclavo trabajador le libera, le protege de l. La superioridad del Amo sobre la naturaleza, fundadasobreelriesgodelavidaenlaluchadeprestigio,serealizaysefundaenelhechodel trabajo del Esclavo (30). Este trabajo se interpone entre el Amo y la Naturaleza. El Esclavo transforma las condiciones dadas de la existencia de modo de tornarlas conformes a las exigenciasdelAmo.LaNaturalezatransformadaporeltrabajodelEsclavosirvealAmosin que este tenga necesidad de servirla. Subordinando a s al Esclavo y forzndolo a trabajar, el Amo esclaviza la naturaleza y realiza as su libertad en la naturaleza (31). La existencia del Amo puede pues ser exclusivamente guerrera. Lucha pero no trabaja. En cuanto al Esclavo su existencia se reduce al trabajo que ejecuta al servicio del Amo. El trabaja pero no lucha. Y segnHegeles laaccinalserviciodeotroloquecaracterizaaltrabajoenelsentidoespecfico y propio de la palabra, lo que hace de l una accin esencialmente humana o humanizada. El ser que acta para satisfacer sus propios instintos y quecomo tales son siempre naturales, no se eleva por encima de la naturaleza, contina siendo un ser natural, no humano. Pero actuando para satisfacer un instinto que no es mo acto en funcin de lo que no espara mi instinto. Acto en funcin de una idea, de un fin no biolgico. Y es esta transformacin de la Naturaleza enfuncindeuna idea lo queconstituyelaesencia deltrabajo.Trabajoquecreael mundo no natural, tcnico, humanizado, adaptado al deseo humano de un ser que ha demostrado y realizado su superioridad sobre la naturaleza por el riesgo de su vida, por el fin nobiolgicodelReconocimiento. 14. El Amo combate como hombre por este reconocimiento, pero consume sin haber trabajado, es decir, como un mero ser viviente, como un animal (32). Tal es su inhumanidad.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

69

No puede superar este estado porque es ocioso. Puede morir como hombre, pero no puede vivirmsquecomoanimal. La situacin existencial, la actitud del Amo, no tiene salida; no obtiene el reconocimiento que querra obtener, pues es reconocido por una conciencia que no es libre y se apercibe de ello. Por lo contrario el Esclavo reconoce la libertad del Amo. Le bastar liberarse l mismo, hacindose reconocer por el Amo, para encontrarse en la situacin del reconocimiento verdadero, es decir, mutuo. La existencia del Amo est justificada en la medida en que transformapor la lucha a animales conscientes en Esclavos que se volvern un da hombres libres. El producto del trabajo es la obra del trabajador (33). Es la realizacin de su proyecto, de su idea. El se realiza, pues, en este producto y se contempla por consiguiente a s mismo contemplndolo,adquiereconcienciadescomocreadoratravsdesuproducto,delproducto de su trabajo. Ahora bien, este producto artificial es al mismo tiempo tan autnomo, tan objetivoy tan independientedelhombrecomo lacosanatural.Deahqueseaporeltrabajoy nicamente por l que el hombre se realiza objetivamente en tanto que hombre. No es sino despus de haber producido un objeto artificial que el hombre es real y objetivamente algo ms,otracosaqueunser natural. (Produciendoseproduceasmismocomohombre).Yesen este producto real y objetivo que cobra verdaderamente conciencia de su realidad humana subjetiva. Es mediante el trabajo que el hombre se vuelve un ser sobrenatural real, y consciente de su realidad. Trabajando l es espritu encarnado, mundo histrico, historia objetiva. El trabajo es pues lo que forma o educa al hombre a partir del animal. El hombre formado y educado, el hombre acabado y satisfecho de su acabamiento no es pues el Amo sino el Esclavo, o al menos aquel que ha pasado por la servidumbre. Pero el Esclavo no es todava consciente del valor liberador del trabajo. La vida del Amo es pues esencialmente perezosa y vaca (34). De los dos el Esclavo fiel llega a estar despus de todo mucho ms cerca de la personalidad genuina. Pues la autoconciencia es prctica, activa y depende del dominio que logra sobre la experiencia. El Esclavo dice Hegel reconstruye, rehace (crea), las cosas de la experiencia. Por tanto, mediante su trabajo conquista el mundo de la experiencia, crea el mundodelYo.ElEsclavoespotencialmenteoengermenelhombrequeserespetaasmismo, que al fin tiene que enorgullecerse del verdadero poder que su obra le da. Cuando este carcter esencial del Esclavo, el hecho de que l como trabajador es el nico hombre verdadero en esta sociedad primitiva, llegue a su propia conciencia, el Yo pasar de la esclavitud a una etapa ms alta de conciencia. Se ha liberado de la Naturaleza, se liberar del Amo(35). La segunda parte del captulo IV describe la experiencia dialctica de la conciencia servil que buscasuliberacin(36).

ACTIVIDAD: Busque diferentes imgenes a partir de las

cuales usted pueda ilustrar el proceso descripto por La conciencia de s. Explique recurriendo a las categoras deltexto.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

70

La dialctica del amo y del esclavo, en Hegel, comentada por Kojve


---------------

Alexandre Kojve (Mosc, 1902 - Bruselas, 1968), filsofo francs de origen ruso, es sobre todo el introductor de Hegel en los crculos ms crticos del pensamiento francs de los aos 1930. Desde 1933 hasta 1939, siguiendo a su amigo y antecesor Alexandre Koyr en sus cursos sobre la Filosofa religiosa de Hegel, comentar, desde el seminario de la cole Pratique des Hautes tudes Paris, la Fenomenologa del Espritu, de G.W. F. Hegel. A este seminario acudirn Bataille, Lacan, Gurvitch, Merleau Ponty, Raymond Quenau... Ser Quenau quien anotar sus lecciones y las editar en Gallimard (1947) con el ttulo de Introduction la lecture de Hegel. Como introduccin a este libro se sirve Raymond Quenau del comentario de Kojve de la seccin A del captulo IV de la Fenomenologa del Espritu, cuando Hegel aborda la dialctica del Amo y del Esclavo, texto que influir en Marx en su concepcin de la lucha entre burguesa y proletariado. Ms que un comentario de la Fenomenologa del Espritu, lo que hace Kojve en este seminario es una libre interpretacin de Hegel reformulando todo el sistema hegeliano en torno al concepto clave de reconocimiento y de deseo insaciable que lleva, por eso, a otro deseo, deseo de ser reconocido por otro deseo de reconocimiento. Amo y Esclavo luchan por este reconocimiento. Es esta introduccin la que aqu publicamos a partir de la edicin argentina La dialctica del Amo y del Esclavo, Buenos Aires, 1960. El comentario de Kojve va en cursiva y entre corchetes. Las palabras unidas con guiones corresponden a un solo trmino alemn.

-------------[El hombre es Consciencia de s. Es autoconsciente; consciente de su realidad y de su dignidad humana, y en esto difiere esencialmente del animal, que no supera el nivel del simple Sentimiento de s. El hombre toma consciencia de s en el momento en que por primera vez dice: Yo. Comprender al hombre por la comprensin de su origen, es comprender el origen del Yo revelado por la palabra. Por tanto, el anlisis del pensamiento, de la razn, del entendimiento, etc., de manera general: del comportamiento cognitivo, contemplativo, pasivo de un ser o de un sujeto cognoscente, no descubre jams el porqu o el cmo del nacimiento de la palabra Yo y por consiguiente, de la autoconciencia, es decir, de la realidad humana. El hombre que contempla es absorbido por lo que l contempla; el sujeto cognoscente se pierde en el objeto conocido. La contemplacin revela el objeto, y no el sujeto. Es el objeto, y no el sujeto el que se muestra a s mismo en y por o mejor aun en tanto que acto de conocer. El hombre absorbido por el objeto que contempla no puede ser vuelto hacia s mismo sino por un Deseo: por el deseo de comer, por ejemplo. Es el Deseo (consciente) de un ser el que constituye este ser en tanto que Yo y lo revela en tanto que tal y lo impulsa a decir: Yo. Es el Deseo el que transforma al Ser revelado a l mismo por l mismo en el conocimiento (verdadero), en un objeto revelado a un sujeto por un sujeto diferente del objeto y opuesto a l. Es en y por, o mejor an, en tanto que su Deseo que el hombre se constituye y se revela a s mismo y a los otros como un Yo, como el Yo esencialmente diferente del no-Yo y radicalmente opuesto a ste. El Yo (humano) es el Yo de un Deseo o del Deseo. El ser mismo del hombre, el ser antoconsciente, implica pues y presupone el Deseo. Por tanto, la realidad humana no puede constituirse y mantenerse sino en el interior de una realidad biolgica, de una vida animal. Mas si el Deseo animal es la condicin necesaria de la Autoconciencia, no es la condicin suficiente de ella. Por s solo ese Deseo no constituye ms que el Sentimiento de s. Al contrario de! conocimiento que mantiene al hombre en una quietud pasiva, el Deseo lo torna in-quieto y

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

71

lo empuja a la accin. Nacida del Deseo, la accin tiende a satisfacerlo, y slo puede hacerlo por la negacin, la destruccin o por lo menos la transformacin del objeto deseado: para satisfacer el hambre, por ejemplo, es necesario destruirlo, en todo caso, transformar el alimento. As, toda accin es negatriz. Lejos de dejar lo dado tal como es, la accin lo destruye si no en su ser, por lo menos en su forma dada. Y toda negatividad-negatriz por relacin a lo dado es necesariamente activa. Mas la accin negatriz no es puramente destructiva. Porque si la accin que nace del Deseo destruye una realidad objetiva para satisfacerlo, crea en su lugar, en y por esta destruccin misma, una realidad subjetiva. El ser que come, por ejemplo, crea y mantiene su propia realidad por la supresin de una realidad otra que la suya, por la transformacin de una realidad otra en realidad suya, por la asimilacin, la interiorizacin de una realidad extraa, exterior. De manera general el Yo del Deseo es un vaco que no recibe un contenido positivo real sino por la accin negatriz que satisface el Deseo al destruir, transformar y asimilar el no-Yo deseado. Y el contenido positivo del Yo. constituido por la negacin, es una funcin del contenido positivo del no-Yo negado. Si en consecuencia el Deseo conduce sobre un no-Yo natural, el Yo ser natural tambin. El Yo creado por la satisfaccin activa de tal Deseo tendr la misma naturaleza que las cosas sobre las cuales lleva ese Deseo: ser un Yo cosificado, un Yo solamente viviente, un Yo animal. Y este Yo natural, funcin de un objeto natural, no podr revelarse a l mismo y a los otros sino en tanto que Sentimiento de s. No llegara jams a la Autoconciencia. Para que haya Autoconciencia es necesario que el Deseo se fije sobre un objeto no-natural, sobre alguna cosa que supere la realidad dada. Mas la nica cosa que supera eso real dado es el Deseo mismo. Porque el Deseo tomado en tanto que Deseo, es decir, antes de su satisfaccin, slo es en efecto una nada revelada, un vaco irreal. El Deseo, por ser la revelacin de un vaco, la presencia de la ausencia de una realidad, es esencialmente otra cosa que la cosa deseada, distinto de una cosa, de un ser real esttico y dado, pues se mantiene eternamente en la identidad, consigo mismo. El Deseo que conduce hasta otro Deseo, tomado en tanto que Deseo, crear entonces por la accin negatriz y asimiladora que lo satisface, un Yo esencialmente otro que el Yo animal. Ese Yo, que se nutre de Deseos, ser el mismo Deseo en su ser mismo, creado en y por la satisfaccin de su Deseo. Y puesto que el Deseo se realiza en tanto que accin negadora de lo dado, el ser mismo de ese Yo ser accin. Ese yo no ser, como el Yo animal, identidad o igualdad consigo mismo, sino negatividad-negatriz. Dicho de otro modo, el ser mismo de ese Yo ser devenir, y la forma universal de ese ser no ser espacio sino tiempo. Su permanencia en la existencia significar entonces para ese Yo: no ser lo que es (en tanto que ser esttico y dado, en tanto que ser natural, en tanto que carcter innato) y ser (es decir, devenir) lo que no es. Ese Yo ser as su propia obra: ser (en lo porvenir) lo que l ha devenido por la negacin (en el presente) de aquello que ha sido (en el pasado), pues esta negacin se efecta en vista de lo que devendr. En su ser mismo ese Yo es devenir intencional, evolucin querida, progreso consciente y voluntario. l es el acto de trascender lo dado que le es dado y que es l mismo. Ese Yo es un individuo (humano), libre (frente a lo real dado) e histrico (con relacin a s mismo). Y es ese Yo y ese Yo solamente, que se revela a s mismo y a los otros en tanto que Autoconciencia. El Deseo humano debe dirigirse sobre otro Deseo. Para que haya Deseo humano es indispensable que haya ante todo una pluralidad de Deseos (animales). Dicho de otro modo, para que la Autoconciencia pueda nacer del Sentimiento de s, para que la realidad humana pueda constituirse en el interior de la realidad animal, es menester que esa realidad sea esencialmente mltiple. El hombre no puede, en consecuencia, aparecer sobre la tierra sino en el seno de un rebao. Por eso la realidad humana slo puede ser social. Mas para que el rebao devenga una sociedad, la sola multiplicidad de Deseos no basta: es necesario an que los Deseos de cada uno de los miembros del rebao conduzcan o puedan conducir a los Deseos de los otros miembros. Si la realidad humana es una realidad social, la sociedad slo es humana en tanto que conjunto de Deseos que se desean mutuamente como Deseos. El Deseo humano, o mejor, antropgeno, que constituye un individuo libre e histrico consciente de su individualidad, de su libertad, de su historia y, finalmente, de su historicidad, el Deseo antropgeno difiere pues del Deseo animal (que constituye un ser natural, slo viviente y que no tiene ms sentimiento que el de su vida) por el hecho de que se dirige no hacia un objeto real, positivo, dado, sino sobre otro Deseo. As en la relacin entre el hombre y la mujer, por ejemplo, el Deseo es humano si uno desea no el cuerpo, sino el Deseo del otro, si quiere poseer o asimilar el Deseo tomado en tanto que Deseo, es decir, si

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

72

quiere ser deseado o amado, o ms todava: reconocido en su valor humano, en su realidad de individuo humano. Asimismo el Deseo que se dirige hacia un objeto natural no es humano sino en la medida en que est mediatizado por el Deseo de otro dirigindose sobre el mismo objeto: es humano desear lo que desean los otros, porque lo desean. As, un objeto totalmente intil desde el punto de vista biolgico (tal como una condecoracin o la bandera del enemigo) puede ser deseado porque es objeto de otros deseos. Tal Deseo slo es un Deseo humano, y la realidad humana en tanto que diferente de la realidad animal no se crea sino por la accin que satisface tales Deseos: la historia humana es la historia de los Deseos deseados. Al margen de esta diferencia esencial, el Deseo humano es anlogo al Deseo animal. El Deseo humano tiende tambin a satisfacerse por una accin negadora, es decir transformadora y asimiladora. El hombre se alimenta de Deseos como el animal se alimenta de cosas reales. Y el Yo humano, realizado por la satisfaccin activa de esos Deseos humanos, es tanto funcin de su alimento como el cuerpo del animal lo es del suyo. Para que el hombre sea verdaderamente humano, para que difiera esencial y realmente del animal, hace falta que su Deseo humano prevalezca efectivamente en l sobre su Deseo animal. Pero todo Deseo es deseo de un valor. El valor supremo para un animal es su vida animal. Todos los Deseos del animal son en ltima instancia una funcin del deseo que tiene de conservar su vida. El Deseo humano debe superar ese deseo de conservacin. Dicho de otro modo, el hombre no se considera humano si no arriesga su vida (animal) en funcin de su Deseo humano. Es en y por ese riesgo que la realidad humana se crea y se revela en tanto que realidad: es en y por ese riesgo que ella se reconoce, es decir, se muestra, se verifica, efecta sus pruebas en tanto que esencialmente diferente de la realidad animal, natural. Y por eso hablar de origen de la Autoconciencia es necesariamente hablar del riesgo de la vida (con miras a un fin esencialmente no vital). El hombre se reconoce humano al arriesgar su vida para satisfacer su Deseo humano, es decir, su Deseo que se dirige sobre otro Deseo. Pero desear un Deseo es querer superponerse a s mismo al valor deseado en ese Deseo. Porque sin esta sustitucin se deseara el valor, el objeto deseado y no el Deseo mismo. Desear el Deseo de otro es, pues, en ltima instancia desear que el valor que yo soy o que represento sea el valor deseado por ese otro: quiero que l reconozca mi valor como su valor; quiero que l me reconozca como un valor autnomo. Dicho de otro modo, todo Deseo humano, antropgeno, generador de la Autoconciencia, de la realidad humana, se ejerce en funcin del deseo de reconocimiento. Y el riesgo de la vida por el cual se reconoce la realidad humana es un riesgo en funcin de tal Deseo. Hablar del origen de la Autoconciencia implica por necesidad hablar de una lucha a muerte por el reconocimiento. Sin esa lucha a muerte hecha por puro prestigio, no habran existido jams seres humanos sobre la tierra. En efecto, el ser humano no se constituye sino en funcin de un Deseo dirigido sobre otro Deseo, es decir, en conclusin, de un deseo de reconocimiento. El ser humano no puede por tanto constituirse si por lo menos dos de esos Deseos no se enfrentan. Y puesto que cada uno de los dos seres dotados del mismo Deseo est dispuesto a llegar hasta el fin en la bsqueda de su satisfaccin, esto es, est presto a arriesgar su vida y por consiguiente a poner en peligro la del otro, con el objeto de hacerse reconocer por l, de imponerse al otro en tanto que valor supremo, su enfrentamiento no puede ser ms que una lucha a muerte. Y es slo en y por tal lucha que se engendra la realidad humana, se constituye, se realiza y se revela a s misma en los otros. No se realiza pues y no se revela sino en tanto que realidad reconocida. No obstante, si todos los hombres, o ms exactamente, todos los seres en trance de devenir seres humanos se comportan de la misma manera, la lucha debera culminar necesariamente con la muerte de uno de los adversarios, o de ambos a la vez. No sera posible que uno cediera ante el otro, que abandonara la lucha antes de la muerte del otro, que reconociera al otro en lugar de hacerse reconocer por l. Porque si as fuera, la realizacin y la revelacin del ser humano sera imposible. Esto es evidente para el caso de la muerte de ambos adversarios, puesto que la realidad humana siendo esencialmente Deseo y accin en funcin del Deseo no puede nacer y mantenerse sino en el interior de una vida animal. Pero la imposibilidad se presenta slo en el caso de la muerte de uno de los adversarios. Pues con l desaparece ese otro Deseo hacia el cual se dirige el Deseo para convertirse en Deseo humano. El sobreviviente, al no poder ser reconocido por el muerto, no puede realizarse y revelarse en su humanidad. Para que el ser humano pueda realizarse y revelarse en tanto que

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

73

Autoconciencia no basta entonces que la realidad humana sea mltiple. Es necesario an que esa multiplicidad, esa sociedad, implique dos comportamientos humanos o antropgenos esencialmente diferentes. Para que la realidad humana pueda constituirse en tanto que realidad reconocida hace falta que ambos adversarios queden con vida despus de la lucha. Mas eso slo es posible a condicin de que ellos adopten comportamientos opuestos en esa lucha. Por actos de libertad irreductibles, es decir imprevisibles o fortuitos, deben constituirse en tanto que desigualdades en y por esa misma lucha. Uno de ellos, sin estar de ningn modo predestinado, debe tener miedo del otro, debe ceder al otro, debe negar el riesgo de su vida con miras a la satisfaccin de su Deseo de reconocimiento. Debe abandonar su deseo y satisfacer el deseo del otro: debe reconocerlo sin ser reconocido por l. Pero, reconocer as implica reconocerlo como Amo y reconocerse y hacerse reconocer como Esclavo del Amo. Dicho de otro modo, en un estado naciente, el hombre no es jams hombre simplemente. Es siempre, necesaria y esencialmente, Amo o Esclavo. Si la realidad humana no puede engendrarse sino en tanto que socialmente, la sociedad, por lo menos en su origen, no es humana sino a condicin de implicar un elemento de Dominio y un elemento de Esclavitud, existencias autnomas y existencias dependientes. Y por eso hablar del origen de la Autoconciencia es necesariamente hablar de la autonoma de la dependencia de la Autoconciencia, de la Tirana y la Esclavitud. Si el ser humano slo se engendra en y por la lucha que culmina en la relacin entre Amo y Esclavo, la realizacin y la revelacin progresivas de ese ser no pueden tampoco ellas efectuarse sino en funcin de esa relacin social fundamental. Si el hombre slo es su devenir, si su ser humano en el espacio es su ser en el tiempo o en tanto que tiempo, si la realidad humana revelada no es otra cosa que la historia universal, esa historia debe ser la historia de la interaccin entre Tirana y Esclavitud: la dialctica histrica es la dialctica del Amo y del Esclavo. Pero si la oposicin de la tesis y de la anttesis no tiene sentido sino en el interior de la conciliacin por la sntesis, si la historia en el sentido estricto de la palabra tiene necesariamente un punto final, si el hombre que deviene debe culminar en el hombre devenido, si el Deseo debe culminar en la satisfaccin, si la ciencia del hombre debe tener el valor de una verdad definida y universalmente vlida, la interaccin del Amo y del Esclavo debe por fin culminar en su supresin dialctica. Sea como fuere, la realidad humana no puede engendrarse y mantenerse en la existencia sino en tanto que realidad reconocida. Slo siendo reconocido por otro, por los otros, y, en su lmite, por todos los otros, un ser humano es realmente humano tanto para l mismo como para los otros. Y no es sino hablando de una realidad humana reconocida que se puede, al llamarla humana, enunciar una verdad en el sentido propio y exacto del trmino. Porque es slo en ese caso que se puede revelar por su discurso una realidad. Por eso, al hablar de la Autoconciencia, del hombre consciente de s mismo, es necesario decir:]

La Autoconciencia existe en y para s en la medida y por el hecho de que existe (en y para s) para otra Autoconciencia; es decir, que ella slo existe en tanto que entidad-reconocida. . Ese concepto puro del reconocimiento, esto es, del redoblamiento de la Autoconciencia en el interior de su unidad, debe ser considerado ahora en el aspecto segn el cual su evolucin aparece ante la Autoconciencia. [Es decir, no en el filsofo que habla de ello sino en el hombre autoconsciente que reconoce a otro hombre o se hace reconocer por l]. Esta evolucin dejar en primer lugar expuesto el aspecto de la desigualdad de dos Autoconciencias [es decir, de dos hombres que se enfrentan con miras al reconocimiento]. O, en otros trminos, ella tornar evidente la expansin del trmino-medio [que es el reconocimiento mutuo y recproco] en los dos puntos extremos [que son los dos que se enfrentan]; estos, tomados en tanto que puntos extremos, se oponen el uno al otro y, por consiguiente tales que uno es solamente entidad-reconocida, y el otro nicamente entidad-reconocedora. [En primer trmino, el hombre que quiere hacerse reconocer por otro no desea de ningn modo reconocerlo a su vez. Si lo consigue, el reconocimiento no ser mutuo y recproco: ser reconocido pero no reconocer a quien lo reconozca.]

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

74

En primer lugar, la Autoconciencia es el Ser-para-s-simple-o-indiviso; se identifica a s misma por el acto de excluir de ella todo lo que es otro [que ella.] Su realidad-esencial y su objeto-cosificado absoluto son para ella: Yo [Yo aislado de todo y opuesto a todo lo que no es Yo]. Y en esa inmediatez, es decir, en ese ser-dado [esto es, no producido por un proceso activo creador] de su Ser-para-s, la Autoconciencia es una entidad-particular-y-aislada. Lo que, para ella, es distinto existe para ella como un objeto-cosificado privado-de-la-realidad-esencial, marcado con el carcter de entidad-negativa. Pero [en el caso que estudiamos] la entidad-otra es tambin ella una Autoconciencia: un individuo-humano se presenta a un individuo-humano. Al presentarse as de una-manerainmediata, esos individuos existen el uno para el otro en el-modo-de-ser de los objetoscosificados vulgares. Son formas-concretas autnomas, Conciencias arrojadas en el ser-dado de la vida-animal. Porque es en tanto que vida-animal que se ha determinado aqu el objetocosificado existente como-un-ser-dado. Son Conciencias que no han cumplido an, la una para la otra, el movimiento [dialctico] de la abstraccin absoluta, que consiste en el acto-deextirpar todo ser-dado-inmediato, y en el hecho de no ser otra cosa que el ser dado puramente negativo-o-negador de la conciencia idntica a s misma. O en otros trminos, son entidades que no se han manifestado an una a otra en tanto que Ser-para-s puro, es decir, en tanto que Autoconciencia. [Cuando dos primeros hombres se enfrentaron por primera vez uno no vio en el otro ms que un animal, peligroso y hostil, al que se trataba de destruir, y no un ser autoconsciente que representaba un valor autnomo]. Cada uno de esos dos individuos-humanos est, en efecto, subjetivamente seguro de s mismo; pero no lo est del otro. Y por eso su propia certeza-subjetiva de s carece an de verdad [es decir, que ella no revela todava una realidad, o en otros trminos, una entidad objetivamente, intersubjetivamente, esto es, universalmente reconocida, por tanto existente y vlida]. Porque la verdad de su certeza-subjetiva [de la idea que se forma de s mismo, del valor que se atribuye] no hubiera podido ser otra cosa que el hecho de que su propio Ser-para-s se haya manifestado a l en tanto que objeto-cosificado autnomo; o bien, lo que es igual: que el objeto-cosificado se haya manifestado a l en tanto que esa certeza-subjetiva pura de s misma; [es necesario pues que l recupere en la realidad exterior, objetiva, la idea ntima que se hace de s mismo]. Pero segn el concepto de reconocimiento, esto slo es posible si se cumple para el otro (as como el otro lo cumple para l) la abstraccin pura con referencia al Ser-para-s: cada uno la cumple en s mismo, por una parte, segn su propia actividad y, por otra, por la actividad del otro. [El primer hombre que encuentra por primera vez a otro hombre se atribuye ya una realidad y un valor autnomos, absolutos: podemos decir que l cree ser hombre, que tiene la certeza subjetiva de serlo. Pero su certeza no es an un saber. El valor que se atribuye puede ser ilusorio; la idea que se hace de s mismo puede ser falsa o desatinada. Para que esa idea sea una verdad es necesario que revele una realidad objetiva, es decir, una entidad que valga y exista no solamente para ella misma, sino tambin para otras realidades distintas de ellas. En el caso en cuestin, el hombre, para ser, en efecto, verdaderamente hombre, y saberse tal, debe pues imponer a otros la idea que se forja de l mismo: debe hacerse reconocer por otros (en el caso lmite ideal: por todos los otros). O ms an: debe transformar el mundo (natural y humano) donde no es reconocido, en un mundo donde ese reconocimiento sea posible. Esa transformacin del mundo hostil en un proyecto humano de un mundo que est de acuerdo con ese proyecto, se llama accin, actividad. Esa accin esencialmente humana puesto que es humanizadora, antropogenia comenzar por el acto de imponerse al primer otro que se encuentre. Y puesto que ese otro, si es (o ms exactamente si quiere ser, y se cree) un ser humano, debe hacer lo mismo, la primera accin antropgena toma necesariamente la forma de una lucha: de una lucha a muerte entre dos seres que se creen hombres; de una lucha por puro prestigio con miras al reconocimiento por el adversario. En efecto:] La manifestacin del individuo-humano tomado en tanto que abstraccin pura del Serpara-s consiste en el hecho de mostrarse como siendo la negacin pura de su modo-se-ser-

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

75

objetivo-o-cosificado; es, en otras palabras, mostrar que ser para s o ser hombre significa no estar ligado a ninguna existencia determinada, es no estar ligado a la particularidad-aislada universal de la existencia en-tanto-que-tal; significa no estar ligado a la vida. Esta manifestacin determina una actividad doble: actividad del otro y actividad para s mismo. En la medida que esa actividad es actividad del otro, cada uno de los dos hombres persigue la muerte del otro. Pero en esa actividad del otro se encuentra tambin el segundo aspecto, a saber, la actividad para s mismo: pues la actividad en cuestin implica en ella el riesgo de la vida propia de quien acta. La relacin entre dos Autoconciencias est pues determinada de tal modo que ellas se reconocen cada una para s y la una para la otra por la lucha de vida o muerte. [Se reconocen quiere decir que hacen sus pruebas, esto es, transforman en verdad objetiva, o universalmente vlida y reconocida, la certeza puramente subjetiva que cada uno tiene de su propio valor. La verdad es la revelacin de una realidad. Pero la realidad humana no se crea, no se construye sino en la lucha con miras al reconocimiento por el riesgo de la vida que ella involucra. La verdad del hombre, o la revelacin de su realidad, presupone pues la lucha a muerte. Y es por eso que] los individuos humanos estn obligados a comprometerse en esa lucha. Porque ellos deben elevar al rango de verdad la certeza-subjetiva que tienen de s mismos de existir-para-s, pues cada uno debe hacerlo en el otro y en s mismo. Y es nicamente por el riesgo de la vida que se reconoce la libertad, que se reconoce el hecho de que no es el ser-dado [no creado por la accin consciente y voluntaria], que no es el modo-de-ser inmediato [natural, no mediatizado por la accin (negadora de lo dado)], en el cual la Autoconciencia se presenta [en el mundo dado], que no es el hecho de estar sumergido en la extensin de la vida animal, los que constituyen para ella la realidad esencial, sino que no hay, por lo contraro, nada que no sea, para ella, un elemento-constitutivo, evanescente. Dicho de otro modo, es slo por el riesgo de la vida que se comprueba el hecho de que la Autoconciencia no es otra cosa que puro Ser-para-s. El individuo-humano que no ha osado arriesgar su vida puede, por cierto, ser reconocido, en tanto que persona-humana. Pero no ha alcanzado la verdad de ese hecho-de-ser-reconocido en tanto que una Autoconciencia autnoma. Por eso cada uno de los dos individuos humanos debe tener por fin la muerte del otro, del mismo modo que l arriesga su propia vida. Pues la entidad-otro no vale ms para l que l mismo. Su realidad esencial [que es su realidad y su dignidad humana reconocidas] se manifiesta en l como una entidad-otra [como otro hombre que no lo reconoce, y que es, por tanto, independiente de l]. Est fuera de s [en tanto que el otro no se le ha rendido reconocindolo, revelndole que lo ha reconocido y mostrndole as que depende de l, que no es absolutamente otro que l]. Debe suprimir su ser-fuera-de-s. La entidad-otra [que l] es aqu una Conciencia existente-como-un-ser-dado y confundido [en el mundo natural] de manera-mltiple-y-variada. Pero debe contemplar su ser-otro como Ser-para-s puro, es decir, como negatividad-negatriz absoluta. [Es decir, que el hombre no es humano sino en la medida en que quiere imponerse a otro hombre, hacerse reconocer por l. En primer lugar, en tanto que no es an efectivamente reconocido por otro, es ese otro el que es el fin de su accin, es de ese otro, del reconocimiento de ese otro, que dependen su valor y su realidad humanas; es en ese otro donde se condensa el sentido de su vida. Est pues fuera de s. Pero son su propio valor y su propia realidad, los que le importan, y quiere tenerlos en l mismo. Debe entonces suprimir su ser-otro. Es decir, debe hacerse reconocer por el otro, poseer en l mismo la certeza de ser reconocido por el otro. No obstante, para que ese reconocimiento pueda satisfacerlo, es necesario que sepa que el otro es un ser humano. En primer trmino, no ve en l ms que un aspecto animal. Para saber que ese aspecto revela una realidad humana, debe comprender que el otro tambin quiere hacerse reconocer, y que est dispuesto a arriesgarse, a negar su vida animal en una lucha por el reconocimiento de su ser-para-s humano. Debe pues provocar al otro, forzarlo a comprometerse en una lucha a muerte por puro prestigio. Y habindolo hecho est obligado a matar al otro para no ser aniquilado l mismo. En esas condiciones la lucha por el reconocimiento no puede por tanto terminarse sino por la muerte de uno de los adversarios, o de los dos a la vez]. Pero este acto de reconocerse-por-la-muerte suprime la verdad [o realidad objetiva revelada] que deba surgir de all y por eso mismo suprime tambin la certeza-subjetiva de s mismo en tanto que tal. Porque del mismo modo que la vida-animal es la posicin natural de la Conciencia, es decir, la autonoma privada de la negatividad-negatriz absoluta, la muerte es la negacin natural de la Conciencia, es decir, la negacin privada de la autonoma; la negacin que contina privada del significado exigido por el reconocimiento. [Esto es: si los dos adversarios perecen en la lucha, la conciencia es suprimida completamente; porque el hombre despus de la muerte no es ya ms que un cuerpo inanimado. Y si uno de los adversarios queda con vida pero muta al otro, no puede ya ser reconocido por l: el vencido muerto no reconoce la victoria del vencedor. La certeza que el vencedor tiene de su ser y de su valor permanece por tanto puramente subjetiva, y carece as de

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

76

verdad]. Por la muerte se ha constituido, en efecto, la certeza-subjetiva del hecho por el cual ambos han arriesgado sus vidas y cada uno la ha despreciado en s mismo y en el otro. Pero esta certeza no se ha constituido para aquellos que han sostenido esa lucha. Por la muerte ellos suprimen su conciencia sustentada en esa entidad extraa que es la existencia natural. Es decir, se suprimen ellos mismos. [Porque el hombre no es real sino en la medida en que vive en un mundo natural. Ese mundo le es, por cierto, extrao: debe negarlo, transformarlo, combatir para realizarse en l. Pero sin ese mundo, fuera de ese mundo, el hombre no es nada]. Y son suprimidos en tanto que puntos-extremos que intentan existir para s; [es decir: consciente e independientemente del resto del universo]. Pero por eso mismo desaparece del juego de variaciones el elemento-constitutivo esencial, a saber, el acto de descomponerse en puntos-extremos de determinaciones opuestas. Y el trmino-medio sucumbe en una unidad muerta, que se descompone en puntos-extremos inertes, que slo existen como-seres-dados y no opuestos [el uno al otro en y para una accin en el curso de la cual el uno trata de suprimir al otro afirmndose, suprimiendo al otro]. Y los dos no se dan recprocamente el uno al otro y no son acogidos a su vez el uno al otro por la conciencia. Por el contrario, no hacen sino separarse mutuamente de manera-indiferente, como cosas. [Porque el muerto es slo algo inconsciente y dad lo cual el que sigue viviendo no puede esperar nada para s y por tanto se retira de l con indiferencia]. Su accin mortal es la negacin abstracta. No es la negacin [afectada] por la conciencia, que suprime de tal modo que ella guarda y conserva la entidad suprimida y por eso mismo sobrevive en el hecho-de-ser-suprimida. [Esta supresin es dialctica. Suprimir dialcticamente quiere decir: suprimir conservando lo suprimido, que es sublimado en y por esta supresin que conserva a esta conservacin que suprime. La entidad suprimida dialcticamente es anulada en su aspecto contingente (y desprovista de sentido, sin significado) de entidad natural dada (inmediata): pero ella es conservada en lo que tiene de esencial (de importante, de significativo); estando as mediatizada por la negacin, ella es sublimada o elevada a un modo de ser ms comprensivo y comprensible que aquel de su rea-lula J inmediata de dato puro y simple, positivo y esttico, que no es el resultado de una accin creadora, es decir, negatriz de lo dado. De nada sirve al hombre la Lucha para matar a su adversario. Debe suprimirlo dialcticamente. Es decir, debe dejarle la vida y la conciencia y destruir slo su autonoma. No debe suprimirlo sino en tanto que se le opone y acta contra l. Dicho de otra manera, debe someterlo]. Lo que se constituye para la Autoconciencia en esta experiencia [de la lucha mortal] es el hecho de que la vida-animal le es tan esencial como la pura autoconciencia. En la Autoconciencia inmediata, [es decir, en el primer hombre que no ha sido an mediatizado' por ese contacto con el otro que crea la lucha], el Yo simple-o-indiviso [del hombre aislado] es el objeto-cosificado absoluto. Pero para nosotros o en s [esto es, para el autor y el lector de estas lneas, que ven al hombre tal como se ha constituido definitivamente al fin de la historia por la interaccin social cumplida], este objeto-cosificado, es decir, el Yo, es la mediacin absoluta, y tiene por elemento constitutivo esencial el mantenimiento de la autonoma. [Es decir: el hombre real y verdadero es el resultado de su interaccin con los otros; su Yo y la idea que se forma de l mismo son mediatizados por el reconocimiento obtenido en funcin de su accin. Y su -verdadera autonoma es la que l mantiene en la realidad social por el esfuerzo de esta accin]. La disolucin de esta unidad simple-o-indivisa [que es el Yo aislado] es el resultado de la primera experiencia [que el hombre hace desde su primera lucha aun mortal]. Por esta experiencia se establecen: una Autoconciencia pura [o abstracta, que ha hecho abstraccin de su vida animal por el riesgo de la lucha: el vencedor], y una Conciencia que [por ser en realidad un cadver viviente: el vencido perdonado] existe no puramente para s sino tambin para otra Conciencia [para la del vencedor;] esto es, que existe en tanto que Conciencia existente-como-un-ser-dado o en otros trminos, como Conciencia que existe en la forma-concreta de la cosidad. Los dos elementos-constitutivos son esenciales: dado que en primer trmino son desiguales y opuestos uno del otro y que su reflexin en la unidad no ha resultado an [de su accin], existen como dos formas-concretas opuestas de la Conciencia. Una es la Conciencia autnoma, para la cual el Ser-para-s es la realidad-esencial. La otra es la Conciencia dependiente, para la cual la realidad-esencial es la vida-animal, es decir, el ser dado para una entidad-otra. Aqulla es el Amo; sta, el Esclavo. [Ese Esclavo es el adversario vencido que no ha ido hasta el final en el nesgo de la vida, que no ha adaptado el principio de los Amos: vencer o morir. Ha aceptado la vida elegida por otro. Depende pues de ese otro. Ha preferido la esclavitud a la muerte, y es por eso que permaneciendo con vida, vive como Esclavo].

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

77

El Amo es la Conciencia que existe para s. Y no solamente el concepto [abstracto] de la Conciencia, sino una Conciencia [real] que existe para s, que es la mediatizada con ella misma por otra Conciencia. A saber, por una conciencia tal que pertenece a su realidadesencial por estar fusionada con el [ser-dado], es decir, con la cosidad en tanto-que-tal. [Esta Conciencia es el Esclavo que solidarizndose con su vida animal se une al mundo natural de las cosas. Rehusando arriesgar su vida animal en una lucha por puro prestigio, no se eleva por encima del animal. Se considera, por tanto a s mismo como tal, y como tal es aceptado por el Amo. Pero por su parte el Esclavo reconoce al Amo en su dignidad y su realidad humanas, y se comporta en consecuencia. La certeza del Amo es pues no puramente subjetiva e inmediata, sino objetivada y mediatizada por el reconocimiento del otro, del Esclavo. Mientras que el Esclavo sigue siendo todava un ser inmediato, natural, bestial, el Amo por su lucha ya es humano, mediatizado. Y su comportamiento es, por tanto, igualmente mediatizado o humano, tanto frente a las cosas como ante los otros hombres, que en ltima instancia son Esclavos para l]. El Amo se relaciona con los dos elementos constitutivos siguientes: por una parte, con una cosa tomada en tanto que tai, es decir, el objeto-cosificado del Deseo, y por otra, con la conciencia por la cual la cosidad es la entidad-esencial, es decir, con el Esclavo que por el rechazo del riesgo se solidariza con las cosas de las cuales depende. Por el contrario, el Amo no ve en esas cosas ms que un simple medio de satisfacer su Deseo. Y las destruye satisfacindolo. Dado, 1, que el Amo, tomado en tanto que concepto de la autoconciencia, es la relacin inmediata del Serpara-s, y 2, que existe ahora [es decir, despus de la victoria lograda sobre el Esclavo] al mismo tiempo en tanto que mediacin, esto es, en tanto que un Ser-para-s que slo existe para l por una entidad-distinta, [puesto que el Amo no es Amo sino por el hecho de tener un Esclavo que lo reconoce como Amo], el Amo se relaciona, 1 de una manera-inmediata con los dos [con la cosa y el Esclavo], y 2 de una.-manera-mediatizada con cada uno de ellos por el otro. El Amo se relaciona de manera mediatizada con el Esclavo, a saber, por el ser-dado-autnomo. Porque es precisamente con este ser-dado que el Esclavo se vincula. Este ser-dado es su cadena, de la que l no ha podido hacer abstraccin en la lucha, donde se revel a causa de ella como dependiente, como teniendo su autonoma en la cosidad. El Amo es, por el contrario, la potencia que reina sobre este serdado. Pues l ha revelado en la lucha que este ser-dado slo vale para l una entidadnegativa. Puesto que el Amo es la potencia que reina sobre este ser-dado, y que este serdado es la potencia que reina sobre el Otro, [es decir, sobre el Esclavo], el Amo tiene en ese silogismo [real o activo] a ese Otro bajo su dominio. Del mismo modo, el Amo se relaciona de una manera-mediatizada con la cosa, esto es, por el Esclavo. Tomado como Autoconciencia, en tantoque-tal, el Esclavo se vincula l tambin con la cosa de una-manera-negativa-o-negatriz, y la suprime [dialcticamente]. Pero, para l, la cosa es al mismo tiempo autnoma. A causa de ello no puede por su acto-de-negar, llegar al fin de la cosa, hasta el aniquilamiento [completo de la cosa, como lo hace el Amo que la consume]. Es decir, l no hace ms que transformarla-por-el-trabajo: [la prepara para el consumo, pero no la consume l mismo]. Para el Amo, por el contrario, la relacin inmediata [con la cosa] se constituye por esta mediacin [esto es, por el trabajo del Esclavo que transforma la cosa natural, la materia prima con miras a su consumo (por el Amo)], en tanto que negacin pura del objetocosificado, o sea en tanto que Goce. [Puesto que todo el esfuerzo fue hecho Por el Esclavo, el Amo no tiene ms que gozar de la cosa que el Esclavo ha preparado para l, y negarla. destruirla, consumindola. (Por ejemplo: l come un alimento bien aderezado).] Lo que no lograba en el Deseo [es decir, como hombre aislado antes de la laucha, en que se hallaba solo frente a la Naturaleza y cuyos deseos convergan directamente sobre esta Naturaleza], lo logra como Amo, [pues los deseos lo llevan hacia las cosas transformadas por el Esclavo]. El Amo consigue ir hasta el fin de la cosa y satisfacerse en el Goce. [Es pues nicamente gracias al trabajo del otro (de su Esclavo) que el Amo es libre frente a la Naturaleza y, por consiguiente, est satisfecho de s mismo. Mas l slo es el Amo del Esclavo porque se ha liberado previamente de la (y de su) naturaleza arriesgando su vida en una lucha por puro prestigio, y as, en tanto que tal, no tiene nada de natural]. El Deseo no se alcanza aqu a causa de la autonoma de la cosa. Por el contrario, el Amo que ha introducido al Esclavo entre la

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

78

cosa y l mismo, no se une, entonces, ms que al aspecto de dependencia de la cosa, y goza de ella, de una-manera-pura. En cuanto a la autonoma de la cosa la deja al Esclavo que transforma-la-cosa-por-el-trabajo. Es a travs de esos dos elementos-constitutivos que se establece para el Amo el hecho-de-ser-reconocido por otra Conciencia. Pues esta ltima se inserta en esos dos elementos constitutivos como una entidad-no-esencial: ella es no-esencial, por una parte en el acto-de-trabajar la cosa, y por otra, en la dependencia en que se encuentra frente a una existencia determinada. En los dos casos esta Conciencia [servil] no puede devenir Amo del ser-dado ni llegar a la negacin absoluta. Aqu aparece pues dado ese elemento constitutivo del acto-de-reconocer que consiste en el hecho de que la otra Conciencia se suprime en tanto que Ser-para-s y hace as ella misma lo que la otra Conciencia hace contra ella. [Es decir: no es solamente el Amo quien ve en el Otro su Esclavo: ese Otro se considera as mismo como tal]. El otro elemento constitutivo del acto-de-reconocer est igualmente implicado en la relacin considerada; ese otro elemento es el hecho de que esa actividad de la segunda Conciencia [es decir, de la Conciencia servil] es la actividad propia de la primera Conciencia [esto es, la del Amo]. Pues todo lo que hace el Esclavo es, hablando con propiedad, una actividad del Amo. [Puesto que el Esclavo slo trabaja para el Amo, para satisfacer los deseos del Amo y no los suyos propios, es el deseo del Amo el que acta en y por el Esclavo]. Para el Amo, el Ser-para-s es el nico que representa la realidad-esencial. Es la potencia-negativa-o-negadora pura, para la cual la cosa no es nada; y est por consiguiente, en esa relacin de Amo y Esclavo, la actividad esencial pura. El Esclavo, por el contrario, no es actividad pura, sino actividad no esencial. Pero, para que haya un reconocimiento autntico, debera hallarse aqu aun el tercer elemento-constitutivo, que consiste en que el Amo haga tambin contra s mismo lo que hace contra el otro y que el Esclavo haga tambin contra el Otro lo que hace contra s mismo. Es pues un reconocimiento desigual y unilateral que ha nacido para esa relacin de Amo y Esclavo. [Pues si el Amo trata al Otro como Esclavo, no se comporta l mismo como Esclavo: y si el Esclavo trata al Otro corno Amo, no se comporta l mismo como Amo. El Esclavo no arriesga su vida y el Amo es ocioso. La relacin entre Amo y Esclavo no es pues un reconocimiento propiamente dicho. Para verlo, analicemos la relacin desde el punto de vista del Amo. El Amo no es el nico en considerarse Amo. El Esclavo lo considera tambin como tal. Es pues reconocido en su realidad y en su dignidad humanas. Pero ese reconocimiento es unilateral, ya que no reconoce a su vez la realidad y la dignidad humanas del Esclavo. Es entonces reconocido por alguien a quien l no reconoce. Y all est la insuficiencia y lo trgico de su situacin. El Amo ha luchado y arriesgado su vida por el reconocimiento, pero slo ha obtenido un reconocimiento sin valor para l. Porque l no puede ser satisfecho sino por el reconocimiento de aquel a quien acepta como digno de reconocerlo. La actitud del Amo es, en consecuencia, un obstculo existencial. Por una parte, el Amo no es Amo ms que porque su Deseo ha recado no sobre una cosa sino sobre otro deseo, que ha sido as un deseo de reconocimiento; por otra, al haber devenido Amo, es en tanto que Amo que debe desear ser reconocido; y l no puede ser reconocido como tal sino haciendo del Otro su Esclavo. Mas el Esclavo es para l un animal o una cosa. El es pues reconocido por una cosa. De este modo, su Deseo se fija en conclusin sobre una cosa, y no como pareca al comienzo sobre un Deseo (humano). El Amo, por lo tanto, ha errado el camino. Despus de la lucha que ha hecho de l un Amo, l no es lo que quiso ser al emprender esta lucha: un hombre reconocido por otro hombre. Por tanto: si el hombre no puede ser satisfecho sino por el reconocimiento, el hombre que se conduce como Amo no lo ser jams. Y dado que, al principio, el hombre es ya Amo o Esclavo, el hombre satisfecho ser por necesidad esclavo: o ms exactamente, aquel que ha sido esclavo, que ha pasado por la Esclavitud, que ha suprimido dialcticamente su servidumbre. En efecto:] As, la Conciencia no-esencial [o servil] es para el Amo el objeto-cosificado que constituye la verdad (o realidad revelada) de la certeza subjetiva que l tiene de s mismo, [puesto que l no puede saberse Amo si no hacindose reconocer como tal por el Esclavo]. Pero es evidente que este objeto-cosificado no corresponde a su concepto. Porque ah donde el Amo se realiza se ha constituido para l algo distinto de una Conciencia autnoma, [puesto que l est en presencia de un

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

79

esclavo]. No es tal Conciencia autnoma, sino por el contrario, una Conciencia dependiente, la que existe para l. No est, por tanto, subjetivamente seguro del Ser-para-s como de una verdad o de una realidad objetiva revelada. Su verdad es, en cambio, la Conciencia no-esencial; y la actividad no-esencial de esta ltima. [Es decir: la verdad del Amo es el Esclavo y su Trabajo.???? En efecto, los otros no reconocen al Amo en tanto que Amo sino porque hay un Esclavo: y la vida del Amo consiste en el hecho de consumir los productos del Trabajo servil, de vivir de y por ese Trabajo]. Por consiguiente, la verdad de la conciencia autnoma es la Conciencia servil. Esta ltima aparece, es cierto, en primer trmino como existiendo fuera de s y no como siendo la verdad de la Autoconciencia [puesto que el Esclavo reconoce la dignidad humana no en s sino en el Amo, del cual depende en su existencia misma]. Pero del mismo modo que el Amo ha mostrado que su realidad-esencial es la imagen-invertida-y-falseada de lo que ella quiere ser, la Esclavitud tambin puede suponrselo devendr en su realizacin, lo contrario de lo que ella es de una-manera-inmediata. En tanto que Conciencia comprimida en s misma, la Esclavitud ha de penetrar en su propio interior y se trasformar-y-se-falsear hasta devenir autonoma verdadera. [El hombre integral, absolutamente libre, definitiva y completamente satisfecho con lo que es, el hombre que se perfecciona y se completa en y por esa satisfaccin, ser el Esclavo que ha suprimido su servidumbre. Si el Amo ocioso es un obstculo, el Esclavo laborioso es, por el contrario, la fuente de todo progreso humano, social, histrico. La Historia es la historia del Esclavo trabajador. Y para verlo, basta considerar la relacin entre el Amo y el Esclavo (es decir, el primer resultado del primer contacto humano, social, histrico) no ya desde el punto de vista del Amo, sino del Esclavo]. Hemos visto solamente lo que es la Esclavitud en relacin con el Dominio. Pero la Esclavitud es tambin Autoconciencia. En consecuencia es necesario considerar ahora lo que ella es, siendo sta en y para s misma. En primer trmino, el Amo es, para la Esclavitud, la realidad-esencial. La Conciencia autnoma existente para s es pues, para ella, la verdad [ o una realidad revelada ] , que sin embargo, para ella , no existe todava en ella. [El Esclavo se subordina al Amo. l estima, reconoce pues el valor y la realidad de la autonoma, de la libertad humana. Mas l no la halla realizada en l mismo. La encuentra en el Otro. Esa es su ventaja. El Amo, por no poder reconocer al Otro que lo reconoce, se encuentra en un callejn sin salida. El Esclavo, por el contrario, reconoce desde el principio al Otro (el Amo). Le bastar pues imponerse a l, hacerse reconocer por l, para que se establezca el reconocimiento mutuo y recproco, que slo puede realizar y satisfacer al hombre plena y definitivamente. Por cierto, para que eso sea as el Esclavo debe cesar de ser Esclavo: debe trascenderse, suprimirse en tanto que Esclavo. Pero si el Amo no tiene ningn deseo y por tanto ninguna posibilidad de suprimirse en tanto que Amo (puesto que significara para l devenir Esclavo), el Esclavo tiene el mayor inters en dejar de ser Esclavo. Adems, la experiencia de esa misma lucha que ha hecho de l un Esclavo, lo predispone a ese acto de autosupresin, de negacin de s, de su Yo dado que es un Yo servil. Por cierto, en primer trmino, el Esclavo que se solidariza con su Yo dado (servil) no tiene en s esa negatividad. No la ve sino en el Amo, que ha realizado la negatividad-negatriz pura al arriesgar su vida en la lucha por e! reconocimiento]. No obstante, en realidad, es en s misma donde la Esclavitud tiene esa verdad [o realidad revelada] de la negatividad-negatriz pura y del Serpara-s. Pues ha hecho en s misma la experiencia de esa realidad-esencial. A saber, esa conciencia servil ha tenido miedo no por esto o por aquello, no durante tal o cual momento, sino por su [propia] realidad-esencial completa. Pues ha experimentado la angustia de la muerte, del Amo absoluto. En esa angustia, la conciencia servil se ha diluido interiormente; se ha estremecido ntimamente en s misma y todo lo que es fijoy-estable ha temblado en ella. Pero ese movimiento [dialctico] universal puro, esa licuefaccin absoluta de toda estabilidad es la realidad-esencial simple-o-indivisa de la conciencia de s, la negatividad-negatriz absoluta, el Ser para s puro. Y ese Ser-para s existe slo en esta conciencia servil. [El Amo est petrificado en su Dominio. No puede superarse, cambiar, progresar. Debe vencer y devenir Amo o mantenerse en tanto que tal o morir. Se lo puede matar: no se lo puede transformar, educar. Ha arriesgado su vida para ser Amo. El Dominio es para l el valor supremo dado que no

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

80

puede superar. El Esclavo, por el contrario, no ha querido ser Esclavo. Ha devenido esclavo porque no ha querido arriesgar su vida para ser Amo. En la angustia mortal, ha comprendido (sin advertirlo) que una condicin dada, fija y estable, aunque sea la del Amo, no puede agotar la existencia humana. Ha comprendido la vanidad de las condiciones dadas de la existencia. No ha querido solidarizarse con la condicin de Amo, no se solidariza tampoco con la condicin del Esclavo. No hay nada fijo en l. Est dispuesto al cambio: en su mismo ser es cambio, trascendencia, transformacin, educacin: es devenir histrico desde su origen, en su esencia, en su existencia misma. Por una parte, no se solidariza con lo que es; quiere trascenderse por negacin de su estado dado. Por otra parte, tiene un ideal positivo para alcanzar: el ideal de la autonoma, del Ser-para-s, que encuentra en el origen mismo de su servidumbre, encarnado en el Amo]. Ese elemento constitutivo del Ser-para-s existe tambin para la Conciencia servil. Pues en el Amo, el Ser-para-s es, para ella, su objeto cosificado. [Un objeto que ella sabe que es exterior, opuesto a ella, y del cual tiende a apropiarse. El Esclavo sabe qu es ser libre. Sabe tambin que no es, y que quiere devenir libre. Y si la experiencia de la Lucha y su resultado predispone al Estado a la trascendencia, al progreso, a la Historia, su vida de Esclavo que trabaja al servicio del Amo realiza esa predisposicin]. Adems, la Conciencia servil no es solamente esa disolucin universal [de todo lo que es fijo, estable, y dado ] , tomado en-tanto-que-tal: al servicio del Amo, cumple esa disolucin de una-manera-objetivamente real [es decir, concreta]. En el servicio [en el trabajo forzado ejecutado al servicio de otro (del Amo)], la Conciencia servil suprime [dialcticamente] su nexo con la existencia natural en todos los elementos-constitutivos particulares-y-aislados; y elimina-por-el-trabajo esta existencia. [El Amo obliga al Esclavo a trabajar. Y trabajando, el Esclavo deviene amo de la naturaleza. Pero slo ha devenido el Esclavo del Amo porque en primer trmino era esclavo de la Naturaleza, solidarizndose con ella y subordinndose a sus leyes por la aceptacin del instinto de conservacin. Al devenir por el Trabajo. Amo de la Naturaleza, el Esclavo se libera por tanto de su propia naturaleza, del propio instinto que lo ataba a ella y que haca de l el Esclavo del Amo. Al liberar al Esclavo de la Naturaleza, el trabajo lo libera de s mismo, de su naturaleza de Esclavo y, en consecuencia, lo libera del Amo. En el mundo natural, dado, elemental, el Esclavo es esclavo del Amo. En el mundo tcnico, transformado por su trabajo l reina o por lo menos un da reinar como Amo absoluto. Y ese Dominio que nace del trabajo, de la transformacin progresiva del Mundo dado y del hombre dado en ese mundo, ser completamente distinto del Dominio inmediato del Amo. El porvenir de la Historia pertenece, por tanto, no al Amo guerrero que o bien muere o se mantiene indefinidamente en identidad consigo mismo, sino al Esclavo trabajador. ste, al transformar el Mundo dado mediante su trabajo, trasciende lo dado y lo que est determinado en l mismo por lo dado; l se supera, entonces, y supera, tambin, al Amo, quien est ligado a lo dado, lo que l deja intacto porque no trabaja. Si la angustia de la muerte encarnada para el Esclavo en la persona del Amo guerrero es la condicin sine qua non del progreso histrico, es nicamente el trabajo del Esclavo el que lo realiza y lo perfecciona]. No obstante, el sentimiento de potencia absoluta que el Esclavo ha experimentado en-tanto-que-tal en la lucha y que experimenta tambin en las particularidades del servicio [del Amo a quien teme], no es an sino la disolucin efectuada en s. [Sin ese sentimiento de potencia, es decir, sin la angustia, sin el terror inspirado por el Amo, el hombre no sera jams Esclavo y no podra por consiguiente alcanzar la perfeccin final. Pero esa condicin en s,, es decir, objetivamente real y necesaria, no basta. La perfeccin (que es siempre consciente de s misma) no puede ser alcanzada en y por el trabajo. Pues es slo en y por el trabajo que el hombre acaba por tomar conciencia de la significacin, del valor y de la necesidad de la experiencia que ha hecho por temor al poder absoluto que el Amo encarnaba para l. Slo despus de haber trabajado para el Amo comprende la necesidad de la lucha entre Amo y Esclavo y el valor del riesgo y de la angustia que ello comporta]. As, aunque la angustia inspirada por el Amo sea el comienzo de la sabidura, se puede decir solamente que en esa angustia la Conciencia existe para ella misma: pero ella no es an el Ser-para-s. [ En la angustia mortal el hombre toma conciencia de su realidad, del valor que tiene para l el simple hecho de vivir y es slo as que advierte lo serio de la existencia. Mas ni an con eso toma conciencia de su autonoma, del valor y de lo trascendente, de su libertad, de su dignidad humana ] . Sin embargo, por el trabajo la Conciencia llega a s misma. Parecera, en verdad, que es el aspecto de la relacin no esencial lo que frustra a la Conciencia servil [en el trabajo, es decir] en el elemento-

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

81

constitutivo que, en ella, corresponde al Deseo en la conciencia del Amo; parecera porque, en ese elemento, la cosa conserva su independencia. [Pareciera que en y por el trabajo el Esclavo es sometido a la Naturaleza, a la cosa, a la materia prima, mientras que el Amo, que se contenta con consumir la cosa preparada por el Esclavo y gozar de ella, es completamente libre frente a ella. Mas nada de esto es as en efecto. Ciertamente], el Deseo [del Amo] se ha reservado el puro acto-de-negar el objeto [consumindolo], y se ha reservado, por ello mismo, el sentimiento-de-s-y-de-su-dignidad no mezclada [experimentada en el goce]. Pero por igual causa esta satisfaccin es slo una evanescencia; porque le falta el aspecto objetivo-o-cosificado, es decir, la estabilidad. [El Amo, que no trabaja, no produce nada estable que se manifieste fuera de s. l destruye solamente los productos del trabajo del Esclavo. Su goce y su satisfaccin son as puramente subjetivos: no interesan ms que a l y no pueden por tanto ser reconocidos sino por l; carecen de verdad', de realidad objetiva revelada a todos. As, ese consumo ese goce ocioso del Amo que resulta de la satisfaccin inmediata del deseo, puede, a lo sumo, procurarle cierto placer al hombre; no logra darle jams la satisfaccin completa y definitiva]. El trabajo es, por el contrario, un Deseo rechazado, una evanescencia detenida; o en otros trminos l forma-y-educa. [ El trabajo trans-forma el Mundo y civiliza, educa al hombre. El Hombre que quiere, o debe, trabajar, debe rechazar su instinto que lo empuja a consumir inmediatamente el objeto bruto. Y el Esclavo no puede trabajar para el Amo, es decir, para otro que no sea l, si no rechaza sus propios deseos. l se trasciende entonces, trabajando: o si se prefiere, se educa, se cultiva, sublima sus instintos al rechazarlos. Por otra parte, no destruye la cosa tal como es dada. Posterga la destruccin de la cosa transformndola en primer lugar por el trabajo; la prepara para el consumo: esto es, la forma. En el trabajo modifica las cosas y se transforma al mismo tiempo l mismo: forma las cosas y el Mundo transformndose, educndose a s mismo; y l se educa, y se forma, se transforma, transformndose las cosas y el mundo. As,] el nexo negativo-o-negador con el objeto-cosificado se constituye en una forma de ese objeto y en una entidad-permanente, puesto que, para el trabajador, el objeto-cosificado tiene autonoma. A la vez ese trmino-medio negativo-o-negador, es decir, la actividad formadora [del trabajo], es la particularidad-aislada o el Ser-para-s puro de la Conciencia. Y ese Ser-para-s penetra ahora, por el trabajo, en aquello que est fuera de la Conciencia, en el elemento de la permanencia. La Conciencia trabajadora llega as por ello a tal contemplacin del serdado autnomo que ella se contempla en l a s misma. [El producto del trabajo es obra del trabajador. Es la realizacin de su proyecto, de su idea: es pues l quien se ha realizado en y por ese producto, y se contempla, en consecuencia, a s mismo contemplndolo. Mas, este producto artificial es al mismo tiempo, tan autnomo, tan objetivo, tan independiente del hombre como la cosa natural. Es pues por el trabajo, y slo por el trabajo, que el hombre se realiza objetivamente en tanto que hombre. No es sino despus de haber producido un objeto artificial que el hombre es l mismo real y objetivamente ms y otra cosa que un ser natural: y es slo en ese producto real y objetivo que l torna verdaderamente conciencia de su realidad humana subjetiva. A travs del trabajo el hombre llega a ser un ser sobrenatural, real y consciente de su realidad; porque trabaja l es Espritu encarnado, es Mundohistrico, es Historia objetivada. Es pues el trabajo el que forma-o-educa al hombre y lo rescata del animal. El hombre formado-o-educado, el hombre realizado y satisfecho por su realizacin es entonces necesariamente no Amo, sino Esclavo: o por lo menos, aquel que ha pasado por la Esclavitud. Pero no hay Esclavo sin Amo. El Amo es por tanto el catalizador del proceso histrico, antropgeno. El mismo no participa activamente en ese proceso: mas sin l, sin su presencia, ese proceso no sera posible. Porque si la historia del hombre es la historia de su trabajo y ese trabajo no es histrico, social, humano sino a condicin de efectuarse contra el instinto o inters inmediato del trabajador, el trabajo debe efectuarse al servicio de otro, y debe ser un trabajo forzado, estimulado por la angustia de la muerte. Es ese trabajo y solamente ese trabajo el que libera, es decir, humaniza al hombre (el Esclavo). Por una parte, ese trabajo crea un Mundo real objetivo, que es un Mundo nonatural, un Mundo cultural, histrico, humano. Y es slo en ese Mundo donde el hombre vive una vida esencialmente diferente de aquella que vive el animal (y el hombre primitivo) en el seno de la Naturaleza. Por otra parte, ese trabajo libera al Esclavo de la angustia que lo ligaba a la Naturaleza dada y a su propia naturaleza innata de animal. Es por el trabajo efectuado en la angustia, al servido del Amo, que el Esclavo se libera de la angustia que lo someta al Amo].

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

82

Pero, el acto-de-formar [la cosa por el trabajo] no tiene solamente esta significacin positiva que consiste en el hecho de que la Conciencia servil, tomada en tanto que puro Ser-para-s, se constituye all para s misma en una entidad-existente-como-un-ser-dado [es decir, el trabajo es algo distinto an que la accin por la cual el hombre crea un Mundo tcnico esencialmente humano, que es tan real como el Mundo natural donde vive el animal]. El acto-de-formar [la cosa por el trabajo] tiene adems una significacin negativa-o-negatriz propia de la Conciencia, es decir, su Ser-para-s no se constituye para ella en objeto-cosificado [o en Mundo] sino por el hecho de que ella suprime [dialcticamente] la forma opuesta existente-como-un-ser-dado [natural]. Pero esa entidad-negativa objetiva-ocosificada es precisamente la realidad-esencial extraa frente a la cual la Conciencia servil se ha estremecido. Ahora, por el contrario [en y por el trabajo] esta Conciencia destruye esa entidad-negativa extraa. Ella se pone a s misma en tanto que tal entidad-negativa en el elemento de la estabilidad; y se constituye por ello para s misma; ella deviene una entidadexistente-para-s. En el Amo el Ser-para-s es, para la Conciencia servil, otro Ser-para-s; o bien, el Ser-para-s existe all nicamente para-ella. En la angustia, el Ser-para-s existe [ya] en ella misma. Pero en la formacin [por el trabajo] el Ser-para-s se constituye para ella en tanto que suya propia, y llega a la conciencia del hecho que existe ella misma en y para s. La forma [la idea-proyecto concebida por la Conciencia], por el hecho de ser puesta-fuera [de la Conciencia de ser inserta por el trabajo en la realidad objetiva del Mundo], no deviene para la conciencia [trabajadora], una entidaddistinta que ella. Porque es precisamente esta forma que es su Ser-para-s puro; y, en esta forma, este Ser-para-s se constituye para ella en verdad [o en realidad objetiva revelada, consciente. El hombre que trabaja reconoce en el Mundo efectivamente transformado por su trabajo su propia obra: se reconoce en l: ve all su propia realidad humana: se descubre en l y revela a los otros la realidad objetiva de su humanidad, de la idea ante todo abstracta y puramente subjetiva que l se forma de s mismo]. Por este acto-de-hallarse a s misma por s misma, la Conciencia trabajadora deviene por tanto sentido-o-voluntad propia; y ella lo deviene precisamente en el trabajo, donde ella no pareca ser sino sentido-o-voluntad extraa. [El hombre no alcanza su autonoma verdadera, su liberad autntica, sino despus de haber pasado por la Esclavitud, despus de haber superado la angustia de la muerte por el trabajo efectuado en servicio de otro (que, para l, encarna esta angustia). El trabajo liberador es pues necesariamente, en primer trmino, el trabajo forzado de un Esclavo que sirve a un Amo omnipotente, que detenta todo poder real]. Para esta reflexin [de la Conciencia en s misma] son igualmente necesarios los dos elementos constitutivos [siguientes: primeramente el] de la angustia, y [en segundo lugar el] del servicio en-tantoque-tal, as como el de la formacin educadora [por el trabajo]. Y al mismo tiempo, los dos son necesarios de manera universal. Por una parte, sin la disciplina del servicio y la obediencia, la angustia se detiene en el dominio-de-lo-formal y no se propaga en la realidad-objetiva consciente de la existencia. [No basta haber tenido miedo, ni haber tenido miedo advirtiendo el hecho de que se ha temido a la muerte. Es necesario vivir en funcin de la angustia. Pero vivir as es servir a alguien a quien se teme, alguien que inspira o encarna la angustia: es servir a un Amo (real, es decir, humano, o al Amo sublimado, Dios). Y servir a un Amo, es obedecer a sus leyes. Sin ese servicio la angustia no podr transformar la existencia: y la existencia no podr pues jams sobrepasar su estado inicial de angustia. Sirviendo a otro, exteriorizndose, solidarizndose con los otros el hombre puede liberarse del terror esclavizante que inspira la idea de la muerte. Por otra parte], sin la formacin educadora [a travs del trabajo], la angustia sigue siendo interna-o-ntima y muda, y la Conciencia no se constituye para ella misma. [Sin el trabajo que transforma el mundo objetivo real, el hombre no puede transformarse realmente a s mismo. Si cambia, su cambio sigue siendo ntimo, puramente subjetivo, slo a l revelado, mudo, no se comunica con los otros. Y ese cambio interno lo hace disentir con el Mundo, que no ha cambiado, y con los otros que se solidarizan con ese Mundo no modificado. Ese cambio transforma, pues, al hombre en loco o criminal, quien tarde o temprano ser aniquilado por la realidad objetiva natural y social. Slo el trabajo, que finalmente permite hace concordar al Mundo objetivo con la idea subjetiva que lo supera desde el comienzo, anida el elemento de locura y de crimen que afecta la actitud de todo hombre que, impulsado por la angustia, trata de sobrepasar el Mundo dado al que teme, donde l se siente angustiado y donde, en consecuencia, no podra sentirse

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

83

satisfecho]. Mas si la Conciencia forma [la cosa por el trabajo] sin haber experimentado la angustia primordial absoluta, ella no pasa de ser sentido-o-voluntad propia vana-o-vanidosa. Porque la forma o la negatividad-negatriz de esta Conciencia no es la negatividadnegatriz en s. Y por consiguiente, su acto-de-formar no puede darle la autoconciencia como aquella que es la realidad-esencial. Si la Conciencia ha soportado no la angustia absoluta sino slo algn temor, la realidad-esencial negativa-o-negatriz, ha permanecido para ella como una entidad-exterior, y su [propia] sustancia no est contaminada en toda su extensin por esta realidad-esencial. Todas las plenitudes-o-realizaciones de la conciencia natural de esta Conciencia, por no haber devenido vacilantes, hacen que esta conciencia pertenezca todava en s al ser-dado determinado. El sentido-o-voluntad propia (der eigene Sinn) es entonces capricho-obstinado [Eigensinn]: una libertad que permanece an en el interior de la Esclavitud. La forma pura [impuesta a lo dado por ese trabajo] no puede constituirse, para esta Conciencia, en realidad-esencial. De igual modo, considerada en tanto que prolongacin de las entidades-particulares-y-aisladas, esta forma no es [una] formacin-educadora universal; ella no es Concepto absoluto. Esta forma es, por el contrario, una habilidad que slo domina ciertas-cosas, y no la potencia universal y el conjunto de la realidad-esencial objetiva-o-cosificada. [El hombre que no ha experimentado la angustia de la muerte no sabe que el Mundo natural dado le es hostil, que tiende a matarlo, a destruirlo, que no se dan all las condiciones esenciales que puedan satisfacerlo realmente. Ese hombre sigue siendo pues en el fondo, solidario con el mundo dado. Querr a lo sumo reformarlo, es decir, cambiar los detalles, hacer transformaciones particulares sin modificar sus caracteres esenciales. Ese hombre actuar como reformista hbil, es decir, como conformista, pero jams como revolucionario verdadero. Pero, el Mundo dado donde vive pertenece al Amo (humano o divino), y en ese Mundo es necesariamente Esclavo. No es pues la reforma sino la supresin dialctica, vale decir revolucionaria del Mundo, la que puede liberarlo, y por consiguiente, satisfacerlo. Pero esta transformacin revolucionaria del Mundo presupone la negacin, la no aceptacin del Mundo dado en su conjunto. Y el origen de esta negacin absoluta reside en el terror absoluto inspirado por el Mundo dado, o ms exactamente por ste o aqul que domina este Mundo, por el Amo de ese Mundo. Sin embargo, el Amo que engendra (involuntariamente) el deseo de la negacin revolucionaria, es el Amo del Esclavo. El hombre no puede, en consecuencia, liberarse del Mundo dado que no lo satisface sino a condicin de que ese Mundo, en su totalidad, pertenezca en efecto a un Amo (real o sublimado). Mas, en tanto que el Amo vive, l se halla tambin siempre sometido al Mundo del cual es Amo. Puesto que el Amo no trasciende el Mundo dado sino en y por el nesgo de su vida, nicamente su muerte realiza su libertad. Mientras l vive no alcanza jams la libertad que lo elevara por sobre el Mundo dado. El Amo no puede nunca desprenderse del Mundo donde vive, y si ese Mundo perece, sucumbe con l. Slo el Esclavo es capaz de trascender el Mundo dado (sometido al Amo) y no perecer. Slo el Esclavo puede transformar el Mundo que lo forma y lo fija en la servidumbre, y crear un Mundo formado por l en el que ser libre. Y el Esclaro slo llega a ello por el trabajo forzado y la angustia soportada en servicio del Amo. Ciertamente, ese trabajo no lo libera a l solo. Pero al transformar el Mundo mediante ese trabajo, el Esclavo se transforma a s mismo y genera as las condiciones objetivas nuevas que le permiten retomar la Lucha liberadora para el reconocimiento que rehus en el comienzo por temor a la muerte. Y as es que en conclusin todo trabajo servil realiza no la voluntad del Amo, sino aquella inconsciente en su origen del Esclavo que, por fin, triunfa all donde el Amo, necesariamente, fracasa. Es sin duda la Conciencia, en un principio dependiente, servidora y servil, la que realiza y revela en ltima instancia el ideal de la Autoconciencia autnoma, y que expresa as su verdad.]

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

84

ELRECONOCIMIENTO LAPOSICIONDEHEGELENLADIALECTICADELAMOYDELESCLAVO. El hombre se revela como humano arriesgando su vida para satisfacer su Deseo humano que tiene por objeto otro Deseo. Desear el Deseo de otro es desear que el valor que yo soy o que yo represento sea el valor deseado por ese otro; yo quiero que l reconozca mi valor como su valor, quiero que l me reconozcacomo un valorautnomo.Tododeseo humano se reduce al findecuentasaldeseodereconocimiento.Ylavidasearriesgaporestereconocimiento. Yo no soy una conciencia de s ms que si yo me hago reconocer por otra conciencia de s y si reconozcoalaotradela mismamanera.Estereconocimientorecprococreaelelementode la vidaespiritual. Pero al comienzo se quiere ser reconocido sin reconocer. Cada uno querr someter al otro, a todos los otros, por una accin negadora, destructiva. El hombre arriesgar as su vida biolgica natural para satisfacer su deseo no biolgico, sino histrico, social, y humano. Hegel dice que el ser que es incapaz de poner en peligro su vida, es decir, que no puede ni quiere arriesgarsuvidaenuna luchaporelReconocimiento,enuna luchade puroprestigio,no es un serverdaderamentehumano. Ser hombre es no ser retenido por ninguna existencia determinada. El hombre tiene la posibilidaddenegarlanaturalezaysupropianaturaleza:puedequerersumuerte,arriesgarsu vida.Talessusernegativo,negador:realizarlaposibilidaddenegarytrascendernegndolasu realidaddada,loquees,sermsyotracosaqueelserqueslovive. No se puede ser hombre mas que si se puede, si se es capaz de morir. Arriesgando as su vida por el reconocimiento pruebo al otro que no soy un mero ser, un animal; atentando contra la vida del otrole pruebo que loreconozco como hombre.Sin embargo,el hombre no quiereser reconocido por un cadver ni le basta ser reconocido por s mismo, necesita ser reconocido porotro. Para que la realidad humana, la conciencia de s, pueda constituirse como realidad "reconocida" es necesario que los dos adversarios queden con vida despus de la lucha. Y eso noesposibleamenosquesecomportendiferentementeenestalucha. Por actos de libertad irreductibles e imprevisibles (ninguno de los dos est predestinado a ser vencedornivencidoniaquedardefinitivamentetal)debenrelacionarsecomoseresdesiguales enyporestalucha.Unodebetenermiedodelotro,debecederalotro,deberechazarelriesgo de su vida. Debe abandonar su deseo de reconocimiento y satisfacer el deseo del otro. Debe reconocerlo sin ser reconocido por l. Ahora bien, este reconocimiento implica que l reconocealotrocomosuAmoysereconoceasimismoysehacereconocercomoEsclavopor l, por el Amo. En sus orgenes el hombre no es nunca hombre simplemente. Es necesaria y esencialmente o bien Amo o bien Esclavo. La sociedad no es humana, cuando menos en sus orgenes, ms que a condicin de suponer un elemento de Dominio y un elemento de Servidumbre, existencias autnomas y existencias dependientes. Por eso hablar del origen de la conciencia de s es hablar de la autonoma y de la dependencia de la conciencia de s, del Amo y del Esclavo. Al hombre que lucha no le es til matar a su adversario. Debe slo suprimirlo dialcticamente. Es decir que debe dejarle la vida y la conciencia y no destruir ms que su autonoma. No debe suprimirlo sino en tanto le es opuesto y acta contra l. Debe esclavizarlo.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

85

El vencido ha subordinado su deseo humano de reconocimiento al deseo biolgico de conservacin de la vida; es lo que determina y revela, a l y al vencedor, su inferioridad. El vencedor ha arriesgado su vida por un fin no vital, y es lo que determina y revela, a l y al vencido, su superioridad sobre la vida biolgica. As la diferencia entre Amo y Esclavo se ha realizadoenlaexistenciadelvencedorydelvencidoyellaesreconocidaporlosdos. El Amo es un ser para s. Todo el resto no es para l ms que un medio. Se reconoce a s mismo a travs del reconocimiento del otro pero no reconoce a este otro. Pero advirtase que la conciencia por la cual es reconocido no es ms que la conciencia de un Esclavo. Existe para unhombreperoestehombrenoesmsqueunEsclavo. El Amo no es pues un hombre verdadero, no es ms que una etapa hacia l. Este reconocimiento nunca le satisfar pues slo los Esclavos le reconocen. De su parte el Esclavo depende de la vida, de las cosas. Sin embargo su repudio de la muerte es tambin una actitud humana. Su dependencia de las cosas es asimismo humana porque es negadora, transformadora de las cosas. Las domina pero depende tambin de ellas. Su trabajo tiene un ladopositivo,creador,yunladonegativoquelesubordinaalmundonatural.ElEsclavotrabaja paraunAmo.LaactituddelAmorespectodelascosasdelmundonaturalestmediatizadapor la conciencia y la actividad del Esclavo. El Amo vive as en un mundo tcnico, histrico, humanizado por el trabajo y no en un mundo natural. No depende de ese mundo pues el Esclavo trabajador le libera, le protege de l. La superioridad del Amo sobre la naturaleza, fundadasobreelriesgodelavidaenlaluchadeprestigio,serealizaysefunda enelhechodel trabajo del Esclavo. Este trabajo se interpone entre el Amo y la Naturaleza. El Esclavo transforma las condiciones dadas de la existencia de modo de tornarlas conformes a las exigenciasdelAmo.LaNaturalezatransformadaporeltrabajodelEsclavosirvealAmosin que este tenga necesidad de servirla. Subordinando a s al Esclavo y forzndolo a trabajar, el Amo esclaviza la naturaleza y realiza as su libertad en la naturaleza. La existencia del Amo puede puesserexclusivamenteguerrera.Luchaperonotrabaja.EncuantoalEsclavo suexistenciase reducealtrabajoqueejecutaal serviciodelAmo.Eltrabajaperonolucha.Ysegn Hegel es la accin al servicio de otro lo que caracteriza al trabajo en el sentido especfico y propio de la palabra, lo que hace de l una accin esencialmente humana o humanizada. El ser que acta para satisfacer sus propios instintos y quecomo tales son siempre naturales, no se eleva por encima de la naturaleza, contina siendo un ser natural, no humano. Pero actuando para satisfacer un instinto que no es mo acto en funcin de lo que no espara mi instinto. Acto en funcin de una idea, de un fin no biolgico. Y es esta transformacin de la Naturaleza en funcin de una idea lo que constituye la esencia del trabajo. Trabajo que crea el mundo no natural, tcnico, humanizado, adaptado al deseo humano de un ser que ha demostrado y realizadosusuperioridadsobrelanaturalezaporelriesgodesuvida,porelfinnobiolgicodel Reconocimiento. El Amo combate como hombre por este reconocimiento, pero consume sin haber trabajado, es decir, como un mero ser viviente, como un animal. Tal es su inhumanidad. No puede superar este estado porque es ocioso. Puede morir como hombre, pero no puede vivir ms que como animal. La situacin existencial, la actitud del Amo, no tiene salida; no obtiene el reconocimiento que querra obtener, pues es reconocido por una conciencia que no es libre y se apercibe de ello. Por lo contrario el Esclavo reconoce la libertad del Amo. Le bastar liberarse l mismo, hacindose reconocer por el Amo, para encontrarse en la situacin del reconocimiento verdadero, es decir, mutuo. La existencia del Amo est justificada en la medida en que transformapor la lucha a animales conscientes en Esclavos que se volvern un da hombres libres.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

86

Elproductodeltrabajoeslaobradeltrabajador.Eslarealizacindesuproyecto,desuidea.El serealiza, pues, en este productoy se contempla porconsiguientea s mismocontemplndolo, adquiere conciencia de s como creador a travs de su producto, del producto de su trabajo. Ahora bien, este producto artificial es al mismo tiempo tan autnomo, tan objetivo y tan independiente del hombre como la cosa natural. De ah que sea por el trabajo y nicamente por l que el hombre se realiza objetivamente en tanto que hombre. No es sino despus de haberproducidounobjetoartificialqueelhombreesrealyobjetivamentealgoms,otracosa que un ser natural. (Produciendo se produce a s mismo como hombre). Y es en este producto real y objetivo que cobra verdaderamente conciencia de su realidad humana subjetiva. Es mediante el trabajo que el hombre se vuelve un ser sobrenatural real, y consciente de su realidad. Trabajando l es espritu encarnado, mundo histrico, historia objetiva.El trabajo es pues lo que forma o educa al hombre a partir del animal. El hombre formado y educado, el hombreacabadoysatisfechodesuacabamientonoespueselAmosinoelEsclavo,oalmenos aquel que ha pasado por la servidumbre. Pero el Esclavo no es todava consciente del valor liberador del trabajo. La vida del Amo es pues esencialmente perezosa y vaca. De los dos el Esclavofielllegaaestardespusdetodomuchomscercadelapersonalidadgenuina.Puesla autoconciencia es prctica, activa y depende del dominio que logra sobre la experiencia. El Esclavo dice Hegel reconstruye, rehace (crea), las cosas de la experiencia. Por tanto, mediante su trabajo conquista el mundo de la experiencia, crea el mundo del Yo. El Esclavo es potencialmente o en germen el hombre que se respeta a s mismo, que al fin tiene que enorgullecerse del verdadero poder que su obra le da. Cuando este carcter esencial del Esclavo, el hecho de que l como trabajador es el nico hombre verdadero en esta sociedad primitiva, llegue a su propia conciencia, el Yo pasar de la esclavitud a una etapa ms alta de conciencia.SehaliberadodelaNaturaleza,seliberardelAmo.

phylosajvg - @filodac

MaterialesdeUsodidctico AntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

87

Nietzsche: Moral de Noble y Moral de Esclavo.-

Nietzsche considera que hay dos clases de hombres: los seores y los esclavos, que han dado distinto sentido a la moral. Para los seores, el binomio bien-mal equivale a noble-despreciable. Desprecian como malo todo aquello que es fruto de la cobarda, el temor, la compasin, todo lo que es dbil y disminuye el impulso vital. Aprecian como bueno, en cambio, todo lo superior y altivo, fuerte y dominador. La moral de los seores se basa en la fe en s mismo, el orgullo propio. Por el contrario, la moral de los esclavos nace de los oprimidos y dbiles, y comienza por condenar los valores y las cualidades de los poderosos. Una vez denigrado el podero, el dominio, la gloria de los seores, el esclavo procede a decretar como buenas las cualidades de los dbiles: la compasin, el servicio propios del cristianismo, la paciencia, la humildad. Los esclavos inventan una moral que haga ms llevadera su condicin de esclavos. Como tienen que obedecer a los seores, los esclavos dicen que la obediencia es buena y que el orgullo es malo. Dado que los esclavos son dbiles, promueven valores como la mansedumbre y la misericordia. La rebelin de los esclavos en la moral comienza cuando el resentimiento mismo se vuelve creador y engendra valores: se desquitan nicamente con una venganza imaginaria. Mientras que toda moral noble nace de un triunfante s dicho a si mismo, la moral de los esclavos dice no, a un otro, un no-yo. Esta inversin de la mirada que establece valores, el dirigirse hacia fuera en lugar de mirar al si mismo, forma parte del resentimiento: Para surgir la moral de los esclavos

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO necesita siempre primero de un mundo opuesto y externo, necesita de estmulos
exteriores para poder en absoluto actuar, su accin es, de raz, reaccin. Lo contrario ocurre en la manera noble de valorar: sta acta y, enonces, brota espontneamente, su concepto negativo, lo bajo, lo vulgar, es tan solo un plido contraste de su concepto bsico positivo: nosotros los nobles, nosotros los felices. Los nobles no saban distinguir la actividad de la felicidad, en contraposicin a la felicidad al nivel de los esclavos a quienes la felicidad les aparece esencialmente como quietud, paz, algo pasivo. Mientras que el noble vive con confianza frente a s mismo, tiene un carcter franco e ingenuo, el esclavo no es no honesto ni derecho consigo mismo, su alma mira de reojo. Una raza de tales hombres del resentimiento acabar necesariamente por ser ms inteligente que cualquier raza noble, venerar la inteligencia como la ms importante condicin de existencia, mientras que para los nobles no es la inteligencia ni mucho menos tan esencial como lo es la perfecta seguridad funcional de los instintos inconcientes reguladores. El resentimiento del noble, cuando en l aparece, envenena. se consuma es el y se agota, no propio de Tal signo

88

naturalezas fuertes: una sobreabundancia de fuerza regeneradora, que hace olvidar, cual Mirabeau que no tena memoria para los insultos que se cometan con l y que no poda perdonar por la nica razn de que olvidaba. El noble se destaca por un autntico amor a sus enemigos, el noble reclama para s a sus enemigos como una distincin suya, no soporta otro enemigo que aquel en el que no hay nada que despreciar. En cambio el enemigo del esclavo es concebido como malvado a partir del cual concibe tambin como anttesis un bueno, el mismo.-

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

89

ARTUROJAURETCHE LACOLONIZACIONPEDAGOGICA
As como en El medio pelo en la sociedad argentina (Apuntes para una sociologa nacional) he querido contribuiralavisindelpasdesdeelngulosocial,()
Aqullamamos

Sealar por qu es intelligentzia y no inteligencia la


Diferenciacin

Ahoramepropongohacerlodesdelacultura. Pero debo limitar el alcance de la expresin cultura pues mi propsito es pragmtico, con lo que evitar irme por la tangente, de nuestra realidad inmediata hacia lucubraciones de valor universal, pretexto frecuente de los ensayistas y profesores para considerar los problemas argentinos de un modo estratosfrico y al margen del compromiso con las urgenciasnacionales.

Cultura?
Relacione

culturay universalismo tomandoen consideracinel concepto Foucaultianode dispositivo.

conceptualy pragmticade Inteligenciae Inteligentzia Especifiqueel sentidodecada unodeesos trminosy relacineloconel conceptode Ideologa aportadopor Zizek Busqueel conceptode superestructura queapareceen laliteratura Marxista

constituida por gran parte de los nativos que a s mismos se califican como intelectuales y cmo han conformado sumentalidad, cmose comportanysobre todo cmo est constituido el aparato cultural que la dirige y difunde para evitar la creacin de un pensamientopropiodelosargentinos. La amplia expresin superestructura cultural, que Supondra un anlisis de la cultura, con mayscula, se reduce as a la determinacin de los modos y el instrumental que opera en la formacin de la intelli gentzia. Adems, considero un bizantinismo confron tarla con una cultura propia, mientras en el hecho no sean removidos los factores que determinan aqulla como expresin colonialista. La inteligencia, ya liberada de esos factores que la deforman en intelligentza, es la que tiene que cumplir, y lo est haciendo

La colonizacin pedaggica y Desubicacin

fragmentariamente, latarea dedefinir, por sudesarrollo natural,sucarctercomoculturanacional. Definirlo a priori sera incurrir en el mismo error que sealamos. Y en esto, ms liberal que los liberales, confo en los hechos que son los que la generarn una vez removidos los obstculos que se oponen a su

de la intelligentzia constituyen los captulos I y II de La yapa. colonizacin pedaggica, segunda parte de Los profetas del odio. Tomado de la 3" edicin. Buenos Aires, Pea Lillo,1967.

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

i
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

90

espontnea manifestacin y recordando que ya es


Expliqueporqu

estn asegurados por la persuasin de su artillera. La formacin de una conciencia nacional en ese tipo de pases no encuentra obstculos, sino que, por el Contrario, es estimulada por la simple presencia de la potencia extranjera en el suelo natal... En la medida que la colonizacin pedaggica segn la feliz expresin de Spranger, un imperialista alemn no se ha realizado,
Sepueden

Inteligentziay colonizacin Pedaggicaestn, segnelautor, relacionadas causalmente. Busqueejemplosen diversasprcticas educativas.

nuestro lo que fue ajeno, en la medida que ya est incorporado a nuestra naturaleza. (Sarmiento es tan nuestro como Hernndez, como factor determinante hoy, pero lo que no es nuestro es el sarmientismo en cuanto impide que lo otro cumpla su labor naturalmente y que la realidad sea la creadora y no un instrumentalsuperpuestodestinadoadeformarla.) La intelligentzia es el fruto de una colonizacin pedaggica y esto es muy distinto a la espontnea incorporacin de valores universales a una cultura nacional, y recprocamente, como pretenden los asp ticos expertos en el tema, que prescinden del anlisis delascondicionesobjetivas. Esto de la colonizacin pedaggica me parece que estcentradoensusverdaderostrminosenellibrode Jorge Abelardo Ramos, Crisis y resurreccin de la literaturaargentina(Ed.Indoamrica,1954),quedice: En las naciones coloniales, despojadas del poder poltico directo y sometidas a las fuerzas de ocupacin extranjeras, los problemas de la penetracin cultural pueden revestir menos importancia para el
Seleccione

encontrar ejemplos actualesde ficcinjurdica enrelacinala problemticade Gnero,detect cules?

solo predomina en la colonia el inters econmico fundado en la garanta de las armas. Pero en las semicolonias, que gozan de un status poltico independiente decorado por la ficcin jurdica, aquella 'colonizacin pedaggica' se revela esencial, pues no disponedeotrafuerzaparaasegurarlaperpetuacindel dominio imperialista, y ya es sabido que las ideas, en cierto grado de su evolucin, se truecan en fuerza material. De este hecho nace la tremenda importancia de un estudio circunstanciado de la cultura argentina o pseudoargentina, forjada por un siglo de dictadura espiritual oligrquica... La cuestin est planteada en los hechos mismos, en la europeizacin y alienacin escandalosa de nuestra literatura, de nuestro pensamiento filosfico, de la crtica histrica, del cuento ydelensayo.Trasciendea todos los dominiosdelpensa

algunospasajes delTextode Dusselpara reforzarla conceptualizacin deltrmino europeizacin

imperialismo, puesto que sus privilegios econmicos

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

ii
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

91

miento y de la creacin esttica y su expansin es tan generalquerechazalaideadeunatendenciaefmera. Es en este sentido que legtimamente puede ha blarse de una verdadera devastacin espiritual de las nuevas generaciones intelectuales. (Recordemos que esto est publicado en 1954 y no corresponde ya a este momento en lo que se refiere a las nuevas gene raciones, como se ver ms adelante.) La juventud universitaria, en particular, ha asimilado los peores rasgosdeuna culturaantinacionalporexcelencia.Bajo estas condiciones histricas se form nuestra lite intelectual. Agrega que la funcin de una cultura as es ser fideicomisaria de valores transmitidos por sus mandanteseuropeos. Necesidaddeunpensamientoagresivo Deaququelacrticaaunaculturaestablecidasobre dichas bases, consiste en el primer paso para restituir los valores sumergidos de la cultura colonizada, preexistente o con posibilidades de nacer. La palabra cultura pierde su acepcin asptica para transformarse en una poltica cultural opuesta a la poltica cultural que se nos presenta como cultura. Es una

beligerancia imprescindible para obtener la sntesis como resultado frente a la pretensin de seguirnos imponiendo una cultura marginada de toda elaboracin propia. As, en la Argentina, el establecimiento de una verdadera cultura lleva necesariamente a combatir la cultura ordenada por la dependencia colonial. Implica, por lo pronto, una revisin respecto del pasado nacida de la bsqueda de las propias races que obliga a restaurar el prestigio de quienes fueron sumergidos por no ingresara las jerarquas oficializadas; el impulso que destruye los falsos hroes consagra paralelamente a otros que responden a las exigencias de una verdadera cultura nacional. Es una especie de Renacimiento, de fe en la genuinidad de lo nacional que vertebra la violenta crtica a la intelligentzia colonizada, que solo tiene un valor sucedneo, carente de originalidad como simple repeticin de ajenos repertorios. El combate contra la superestructura establecida abre nuevos rumbos a la indagacin, otorga otro sentido creador a la tarea inte lectual, ofrece desconocidos horizontes a la inquietud espiritual,enfin,enriquecelaculturaaunensuasptico

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

iii
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

92

significadoalproveerladeotropuntodevistabrindado porlaspeculiaridadesnacionales. Soloporlavictoriaenesacontiendaevitaremosque bajo la apariencia de los valores universales se sigan introduciendo como tales los valores relativos correspondientes solo a un momento histrico o lugar geogrfico, cuya apariencia de universalidad surge exclusivamente del poder de expansin universal que les dan los centros donde nacen, con la irradiacin que surge de su carcter

de ms amplia rbita, producto de una lenta elaboracin de elementos indgenas con los proporcionados por la conquista espaola y catlica. En algunos casos, cuando las sociedades indgenas preexistentes ya haban salido del estado salvaje y constituan por s culturas, esta simbiosis estaba lejos de haberse realizado, y haba ms bien una superposicin de culturas, como entre los aztecas y el incario. En otro la fusin se haba realizado dando una muy particular configuracin cultural, como en el caso de los pueblos guaranes del Paraguay con el aporte de los elementos hispnicos y jesuticos, de tan fuerte individualidad que ha sobrevivido sin alterarse con la implacable destruccin de que fue

metropolitano. Tomar como absolutos esos valores relativos es un defecto que est en la gnesis de nuestra intelligentzia y de ah su colonialismo.

Gnesis de la Intelligentzia Desde el principio nuestra intelligentzia identific con cultura los valores universales consagrados por los centros del poder, con exclusin de toda otra cultura. Las naciones que se separaban de la colonia espaola tenan su propia cultura, dentro de una

objeto con la guerra civilizadora de la Triple Alianza. El contacto de la cultura preexistente con la Europa triunfante del siglo XIX, que deba generar a su vez una nueva elaboracin por la asimilacin de nuevos valores a los elementos culturales propios, no fue visto as por la intelligentzia que desde el principio defini sus caractersticas,

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

iv
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

93

deslumbrada por la civilizacin europea cuyo


Reflexionesobre

Europa en Amrica trasplantando el rbol y destruyendo al indgena que poda ser obstculo al mismo para su crecimiento segn Europa, y no segn Amrica. El gran desarrollo tcnico del siglo XIX facilit el error. Aprender la tcnica y practicarla era civi lizarse y civilizarse, culturizarse, considerando los trminos como inseparables, lo que es incierto, como lo demostr Japn, que hizo suya la tcnica de la civilizacin europea asimilndola a sus formas culturales. (Tambin el Paraguay de los Lpez lo intent, y se lo civiliz a la fuerza para impedirlo.) As la intelligentzia facilit el proceso de la estructuracin de los nuevos pases como pases dependientes, derogando todos los valores autctonos que podan servir para el proceso de filtro y asimilacin; mucho menos admiti la posibilidad de una creacin original, nacida de esa convivencia y de una recproca penetracin. As el proceso de europeizacin que se practic desde 1853 en adelante no consisti en la incorporacin a la cultura preexistente de los valores europeos

lasiguiente afirmacinLos docentesdebenser formadoscomo intelectuales (Giroux)tomando comoejela caracterizacinque Jauretchehace sobreintelectual

espectculo se presentaba ante los ojos azorados de los intelectuales. (Se llama intelectual, no al que ejercita la inteligencia, sino al que es ilustrado en cosas nuevas.) Para este intelectual lo preexistente, la cultura que tena en la raz, fue incultura en cuanto no coincida con lo nuevo. Ocurri aqu lo inverso que entre los griegos, para los cuales lo brbaro era lo extico a la Hlade, y lo culto lo propio" La frmula civilizacin y barbarie Esta es la raz del dilema sarmientino de civiliza cin o barbarie que sigue rigiendo a la intelligentzia. Se confundi civilizacin con cultura, como en la escuela se sigue

confundiendo instruccin con educacin. La idea no fue desarrollar Amrica segn Amrica, incorporando los elementos de la civilizacin moderna; enriquecer la cultura propia con el aporte externo asimilado, como quien abona el terreno donde crece el rbol. Se intent crear

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

v
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

94

universales si se quiere, sino en la derogacin lisa y llana de aqulla, lo que fue facilitado por esa identificacin del concepto civilizacin con el concepto cultura, muy propio del siglo XIX. La incomprensin de lo nuestro preexistente como hecho cultural, o mejor dicho, el entenderlo como hecho anticultural, ayud a que lo preexistente fuera privado de todos los medios de expresin. No bast con la masiva sustitucin de la poblacin nativa por el torrente inmigratorio que se volc sobre el litoral, ni conla distorsin econmica que impuso una civilizacin para hacernos una prolongacin abastecedora del modelo que se propona imitar. La inteligencia se hizo intelligentzia y dando por resuelto que la cultura era exclusivamenteloimportadoseconvirtien uno de los ms eficaces instrumentos para extirpar de raz los elementos locales de cultura preexistentes. Solo la tradicin oral y los hbitos cuya perdurabilidad es lentamente afectada por el cambio de condiciones parecieron subsistir como factores yacentes de la cultura derogada y con preferencia en aquellos lugares

no tiles a los fines concretos perseguidos por la civilizacin,enremotosrinconesdeprovincias. En el terreno de la cultura la intelligentzia se impusomasivamentedespusdeCaseros.Amedidaque la incorporacin de la Argentina al mercado mundial iba creando intereses vinculados con ella y la poltica del imperio dominante profundizaba su penetracin econmica, esta disposicin de la intelligentzia se acentuaba con el desplazamiento hacia el litoral de la riqueza y la postergacin de los ncleos interiores de poblacin, donde la configuracineconmica y social de la colonia espaola haba enraizado con ms profundidad la cultura preexistente. El litoral, ms despoblado y menos importante en la economa de autosatisfaccin anterior a la libertad de comercio, dispona de menos elementos autctonos para compensar,asimilandolainfluenciapostizaquevenade afuera;prcticamentefuehijodelasnuevascondiciones que lo favorecan en su desarrollo material y sobre este hecho cabalg la intelligentzia que pareci encontrar durante largos aos la confirmacin de su misin civilizadora, porque la nueva sociedad que lo compona

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

vi
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

95

en hombres y tcnicas era en su mayor parte hija del planteamientocivilizadorlogrado. Laintelligentzia Pero pronto la conformacin de la intelligentzia en cierto modo espontnea, como se ha explicado con la alucinacin de los intelectuales, se constituy en sistema,enlamismarelacinenqueseconsolidabany agrandaban los instrumentos materiales de la influencia exterior que constituan factores de poder mucho ms poderosos que el mismo Estado, o que la posibleconjuncindeinteresesnacionales.As,elerror delaintelligentziarevertisobreellamisma,yya no pudo salir de l, porque todo el aparato a travs del cual poda expresarse y a travs del cual se elaboraba el intelectual, se fue conformando a la poltica dominante cuya proyeccin se diriga a estabilizar el pas en las condiciones ms ptimas para su aprovechamiento, que, desde luego, no poda trascender los fines para los cuales fue civilizado. De tal manera la intelligentzia qued prisionera de lo que haba promovido, y se tuvo que conformar definitivamente como instrumento colonial. Aquello

mismo que haba promovido para civilizar. Se apoder deellacompletandoelcrculodesudominio,ylahizosu instrumento. As, los que haban sido apstoles de un error doctrinario se vieron convertidos en simples instrumentos divulgadores, cumpliendo en el campo de la cultura la funcin que el poder material cumpla en el campo de los intereses materiales. De apstoles devinieron, en su prolongacin histrica, vendedores de comercio: una mezcla de viajantes y visitadores mdicos.

Laderrotadelaintelligentzia Ya carece de objetivo el debate con la intelligentzia en el terreno de las ideas, donde ni siquiera el intelectual es el ilustrado en cosas nuevas como se dijoantes.Estanoesmsqueunasimplerepetidorade envejecidas o exticas afirmaciones dogmticas, cuyo poder de conviccin reside exclusivamente en el de la propaganda. Es simplemente un instrumento de la misma sin otra fuerza que la que surge de su utilizacin, por el aparato de difusin. No hay problema intelectual. Esunacuestindehecho,porqueelconflictonoeselde

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

vii
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

96

las ideas, ampliamente superado, sino el de la imposibilidadenqueseencuentralaintelligentziade actualizarsuideariodeimportacinen presenciadeun pas(...)queyatienesupropiaversindelacultura(...)

ACTIVIDADDEINTEGRACIN: Seleccionealmenoscincodelosautoresvistosytrabajadosenclaseyrelevandosusideasprincipales, organiceunmapaconceptualenelquepuedanserrelacionadosconlasideasprincipalesdeJauretche. Busqueunasecuenciadeimgenesquepermitailustrardichasconexiones. BusqueunaImagenconlacualpuedaexplicardemanerasencillaelconceptodeintelligentzia Escribaunensayocrticodenomsdedoscarillasenelcualustedpuedafundamentarunaposturaa favoroencontradelosplanteospropuestosporJauretche Busqueinformacinsobreelautoryconfeccioneunafichabiogrfica.

MATERIALDEEXCLUSIVOUSODIDCTICOEditMk

viii
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

97

MICHELFOUCAULT ELOJODELPODER
Elojodelpoder,EntrevistaconMichelFoucault,enBentham,Jeremas:ElPanptico, Ed.LaPiqueta,Barcelona,1980.TraduccindeJuliaVarelayFernandoAlvarezUra. JeanPierreBarou:ElPanpticodeJeremasBenthamesunaobraeditada a finalesdelsigloXVIIIque ha permanecido desconocida. Sin embargo, t has escrito una serie de frases sobre ella tan sorprendentes como stas: Un acontecimiento en la historia del espritu humano, Una especie de huevo de Coln en el campo de lapoltica.Porloque serefiere a suautor, eljurista inglsJeremas Bentham, lo has presentado como el Fourier de una sociedad policial.(1) Para nosotros es un misterio.Pero,explcanos,cmohasdescubiertoElPanptico. Michel Foucault: Estudiando los orgenes de la medicina clnica; haba pensado hacer un estudio sobre la arquitectura hospitalaria de la segunda mitad del siglo XVIII, en la poca en la que se desarrolla el gran movimiento de reforma de las instituciones mdicas. Quera saber cmo se haba institucionalizado la mirada mdica; cmo se haba inscrito realmente en el espacio social; cmo la nueva forma hospitalaria era a la vez el efecto y el soporte de un nuevo tipo de mirada. Y examinando los diferentes proyectos arquitectnicos posteriores al segundo incendio del HotelDieu en 1972 me di cuenta hasta qu punto el problema de la total visibilidad de los cuerpos, de los individuos, de las cosas, bajo una mirada centralizada, haba sido uno de los principios bsicos ms constantes. En el caso de los hospitales este problema presentaba una dificultad suplementaria: era necesario evitar los contactos, los contagios, la proximidad y los amontonamientos, asegurando al mismo tiempo la aireacin y la circulacin del aire; se trataba a la vez de dividir el espacio y de dejarlo abierto, de asegurar una vigilancia que fuese global e individualizante al mismo tiempo, separando cuidadosamente a los individuos que deban ser vigilados. Haba pensado durante mucho tiempo que estos eran problemas propios de la medicina del siglo XVIII y de sus concepciones tericas. Despus, estudiando los problemas de la penalidad, he visto que todos los grandes proyectos de remozamiento de las prisiones (que dicho sea de paso aparecen un poco ms tarde, en la primera mitaddelsigloXIX),retornabanalmismotema,peroahorarefirindosecasisiempreaBentham.Casi no existan textos ni proyectos acerca de las prisiones en los que no se encontrase el invento de Bentham,esdecir,elpanptico. El principio era: en la periferia un edificio circular; en el centro una torre; sta aparece atravesada porampliasventanasqueseabrensobrelacarainteriordelcrculo.Eledificioperifricoestdividido enceldas,cadaunadelascualesocupatodoelespesordeledificio.Estasceldastienendosventanas: una abierta hacia el interior que se corresponde con las ventanas de la torre; y otra hacia el exterior quedejapasarlaluzdeunladoalotrodelacelda. Bastapuessituarunvigilanteenlatorrecentraly encerrar en cada celda un loco, un enfermo, un condenado, un obrero o un alumno. Mediante el efecto de contraluz se pueden captar desde la torre las siluetas prisioneras en las celdas de la periferia proyectadas y recortadas en la luz. En suma, se invierte el principio de la mazmorra. La plena luz y la miradadeunvigilantecaptanmejorquelasombraqueenltimo trminocumplauna funcinprotectora. SorprendeconstatarquemuchoantesqueBenthamestapreocupacinexistaya.Parecequeunode los primeros modelos de esta visibilidad aislante haba sido puesto en prctica en la Escuela militar de Pars en 1755 en lo referente a los dormitorios. Cada uno de los alumnos deba disponer de una celdaconcristaleraatravsdelacualpodaservistotodalanochesintenerningncontactoconsus condiscpulos,nisiquieraconloscriados.Existaademsunmecanismomuycomplicadoconelnico fin de que el peluquero pudiese peinar a cada uno de los pensionistas sin tocarlo fsicamente: la cabeza del alumno pasaba a travs de un tragaluz, quedando el cuerpo del otro lado de un tabique de cristales que permita ver todo lo que ocurra. Bentham ha contado que fue su hermano el que

phylosajvg - @filodac

MaterialesdeUsodidcticoAntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

98

visitando la Escuela militar tuvo la idea del panptico. El tema de todas formas estaba presente. Las realizaciones de ClaudeNicolas Ledoux, concretamente la salina que construye en ArcetSenans, se dirigen al mismo efecto de visibilidad, pero con un elemento suplementario: que exista un punto central que sea el lugar del ejercicio y, al mismo tiempo, el lugar de registro del saber. De todos modos si bien la idea del panptico es anterior a Bentham, ser l quien realmente la formule, y la bautice.Elmismonombredepanpticoparecefundamental.Designaunprincipioglobal.Bentham no ha pues simplemente imaginado una figura arquitectnica destinada a resolver un problema concreto, como el de la prisin, la escuela o el hospital. Proclama una verdadera invencin que l mismo denomina huevo de Coln. Y, en efecto, lo que buscaban los mdicos, los industriales, los educadoresylospenalistas,Benthamselofacilita:haencontradounatecnologadepoderespecfica para resolver los problemas de vigilancia. Conviene destacar una cosa importante: Bentham ha pensadoydichoquesuprocedimientopticoeralagraninnovacinparaejercerbienyfcilmenteel poder. De hecho, dicha innovacin ha sido ampliamente utilizada desde finales del siglo XVIII. Sin embargo los procedimientos de poder puestos en prctica en las sociedades modernas son mucho ms numerosos, diversos y ricos. Sera falso decir que el principio de visibilidad dirige toda la tecnologadepoderdesdeelsigloXIX. Michelle Perrot: Pasando por la arquitectura! Qu pensar por otra parte de la arquitectura como modo de organizacin poltica? Porque en ltimo trmino todo es espacial, no solo mentalmente, sinomaterialmenteenestepensamientodelsigloXVIII. Foucault: Desde finales del siglo XVIII la arquitectura comienza a estar ligada a los problemas de poblacin,desalud,deurbanismo.Antes,elartedeconstruirrespondasobretodoalanecesidadde manifestar el poder, la divinidad, la fuerza. El palacio y la iglesia constituan las grandes formas a las que hay que aadir las plazas fuertes: se manifestaba el podero, se manifestaba el soberano, se manifestaba Dios. La arquitectura se ha desarrollado durante mucho tiempo alrededor de estas exigencias. Pero, a finales del siglo XVIII, aparecen nuevos problemas: se trata de servirse de la organizacindelespacioparafineseconmicopolticos. Surge una arquitectura especfica. PhilippeAriesha escrito cosas que me parecen importantes sobre el hecho de que la casa, hasta el siglo XVIII, es un espacio indiferenciado. En este espacio hay habitaciones en lasque se duerme, secome,se recibe..., en finpocoimporta.Despus, pocoapoco, el espacio se especifica y se hace funcional. Un ejemplo es el de la construccin de las ciudades obrerasenlosaos18301870.Sefijarala familiaobrera;se levaaprescribiruntipodemoralidad asignndole un espacio de vida con una habitacin que es el lugar de la cocina y del comedor, otra habitacin para los padres, que es el lugar de la procreacin, y la habitacin de los hijos. Algunas veces, en el mejor de los casos, habr una habitacin para las nias y otra para los nios. Podra escribirse toda una historia de los espacios que sera al mismo tiempo una historia de los poderes que comprendera desde las grandes estrategias de la geopoltica hasta las pequeas tcticas del habitat, de la arquitectura institucional, de la sala de clase o de la organizacin hospitalaria, pasando por las implantaciones econmicopolticas. Sorprende ver cunto tiempo ha hecho falta para que el problema de los espacios aparezca como un problema histricopoltico, ya que o bien el espacio se reenviaba a la naturalezaa lo dado, a las determinaciones primeras, a la geografa fsica es decir a una especie de capa prehistrica, o bien se lo conceba como lugar de residencia o de expansin de un pueblo, de una cultura, de una lengua, o de un Estado. En suma, se lo analizaba o bien como suelo , o bien como aire; lo que importaba era el sustrato o las fronteras. HansidonecesariosMarcBlochyFernandBraudelparaquesedesarrolleunahistoriadelosespacios rurales o de los espacios martimos. Es preciso continuarla sin decirse simplemente que el espacio predetermina una historia que a su vez lo remodela y se sedimenta en l. El anclaje espacial es una forma econmicopoltica que hay que estudiar en detalle. Entre todas las razones que han inducido durante tanto tiempo a una cierta negligencia respecto a los espacios, citar solamente una que concierne al discurso de los filsofos. En el momento en el que comenzaba a desarrollarse una polticareflexiva de los espacios (finales del siglo XVIII), lasnuevas adquisiciones de la fsicatericay experimental desalojaron a la filosofa de su viejo derecho de hablar del mundo, del cosmos, del

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

99

espacio finito e infinito. Esta doble ocupacin del espacio por una tecnologa poltica y por una prctica cientfica ha circunscrito la filosofa a una problemtica del tiempo. Desde Kant, lo que el filsofo tiene que pensar es el tiempo Hegel, Bergson, Heidegger, con una descalificacin correlativa del espacio que aparece del lado del entendimiento, de lo analtico, de lo conceptual, de lo muerto, de lo fijo, de lo inerte. Recuerdo haber hablado, hace una docena de aos de estos problemas de una poltica de los espacios, y se me respondi que era bien reaccionario insistir tanto sobre el espacio, que el tiempo, el proyecto, era la vida y el progreso. Conviene decir que este reprochevenadeunpsiclogoverdadyvergenzadelafilosofadelsigloXIX. M. P.: De paso, me parece que la nocin de sexualidad es muy importante tal como seal Ud. a propsito de la vigilancia en el caso de los militares; de nuevo aparece este problema con la familia obrera;essindudafundamental. Foucault:Totalmentedeacuerdo.Enestostemasdevigilancia,yenparticulardelavigilanciaescolar, los controles de la sexualidad se inscriben en la arquitectura. En el caso de la Escuela militar las paredeshablandelaluchacontralahomosexualidadylamasturbacin. M. P.: Siguiendo con la arquitectura, no le parece que individuos como los mdicos, cuya participacin social es considerable a finales del siglo XVIII, han desempeado de algn modo un papel de organizadores del espacio? La higiene social nace entonces; en nombre de la limpieza, la salud, se controlan los lugares que ocupan unos y otros. Y los mdicos, con el renacimiento de la medicina hipocrtica, se sitan ente los ms sensibilizados al problema del entorno, del lugar, de la temperatura,datosqueencontramosenlaencuestadeHowardsobrelasprisiones.(2) Foucault: Los mdicos eran entonces en cierta medida especialistas del espacio. Planteaban cuatro problemas fundamentales: el de los emplazamientos (climas regionales, naturaleza de los suelos, humedad y sequedad: bajo el nombre de constitucin, estudiaban la combinacin de los determinantes locales y de las variaciones de estacin que favorecen en un momento dado un determinadotipodeenfermedad);el delascoexistencias(yaseadeloshombresentres:densidady proximidad; ya sea de los hombres y las cosas: aguas, alcantarillado, ventilacin; ya sea de los hombresentres:densidadyproximidad;yaseadeloshombresylosanimales:mataderos,establos; ya sea de los hombres y los muertos: cementerios); el de las residencias (habitat, urbanismo); el de los desplazamientos (emigracin de los hombres, propagacin de las enfermedades). Los mdicos han sido con los militares, los primeros gestores del espacio colectivo. Pero los militares pensaban sobre todo el espacio de las campaas (y por lo tanto el de los pasos) y el de las fortalezas. Los mdicoshanpensadosobretodoelespaciodelasresidenciasyeldelasciudades.Norecuerdoquin ha buscadoen Montesquieu y en Augusto Comtelas grandes etapasdelpensamiento sociolgico.Es serbienignorante.Elsabersociolgicoseformamsbienenprcticastalescomolasdelosmdicos. Guepin ha escrito en los mismos comienzos del siglo XIX un maravilloso anlisis de la ciudad de Nantes. De hecho, si la intervencin de los mdicos ha sido tan capital en esta poca, se debe a que estaba exigida por todo un conjunto de problemas polticos y econmicos nuevos: la importancia de los hechosdepoblacin. M. P.: Es chocante adems la gran cantidad de personas que se ven concernidas por la reflexin de Bentham. En distintos sitios dice haber resuelto los problemas de disciplina planteados por un gran nmerodeindividuosacargodeunospocos. Foucault: Al igual que sus contemporneos Bentham se encuentra con el problema de la acumulacin de hombres. Pero mientras que los economistas planteaban el problema en trminos de riqueza (poblacinriqueza ya que mano de obra, fuente de actividad econmica, consumo; y poblacinpobrezayaqueexcedenteuociosa),Benthamplantealacuestinentrminosdepoder:la poblacin como blanco de las relaciones de dominacin. Se puede decir, creo, que los mecanismos

phylosajvg - @filodac

MaterialesdeUsodidcticoAntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

100

de poder, que intervenan incluso en una monarqua administrativa tan desarrollada como la francesa,dejabanaparecerhuecosbastanteamplios:sistemalacunar,aleatorio,global,quenoentra en detalles, que se ejerce sobre grupos solidarios o practica el mtodo del ejemplo (como puede verse claramente en el sistema fiscal o en la justicia criminal); el poder tena pues una dbil capacidad de resolucin como se dira en trminos de fotografa, no era capaz de practicar un anlisis individualizante y exhaustivo del cuerpo social. Ahora bien, las mutaciones econmicas del siglo XVIII han hecho necesaria una circulacin de los efectos de poder a travs de canales cada vez ms finos, hasta alcanzar alospropios individuos,su cuerpo, sus gestos, cadaunade sus habilidades cotidianas. Que el poder, incluso teniendo que dirigir a una multiplicidad de hombres, sea tan eficaz comosiseejerciesesobreunosolo. M. P.: Los crecimientos demogrficos del siglo XVIII han contribuido sin duda al desarrollo de un podersemejante. J.P. B.: No es sorprendente entonces saber que la Revolucin francesa a travs de personas como La Fayette, ha acogido favorablemente el proyecto del panptico? Se sabe que Bentham, como premioasusdesvelos,hasidohechoCiudadanofrancsen1791. Foucault: Yo dira que Bentham es el complemento de Rousseau. Cul es, en efecto, el sueo rousseauniano que ha animado a tantos revolucionarios?: el de una sociedad transparente, visible y legible a la vez en cada una de sus partes; que no existan zonas oscuras, zonas ordenadas por los privilegios del poder real o por las prerrogativas de tal o tal cuerpo, o incluso por el desorden; que cada uno, desde el lugar que ocupa, pueda ver el conjunto de la sociedad; que los corazones se comuniquenunosconotros,quelasmiradasnoencuentrenyaobstculos,quelaopininreine,lade cadaunosobrecadauno.StarobinskihaescritopginasmuyinteresantesrespectoaestetemaenLa TransparenciayelobstculoyenLainvencindelalibertad. Benthames alavezestoy todolocontrario.Planteaelproblemadelavisibilidad,peropensandoen una visibilidad totalmente organizada alrededor de una mirada dominadora y vigilante. Hace funcionar el proyecto de una visibilidad universal, que actuara en provecho de un poder riguroso y meticuloso. As, sobre el gran tema rousseauniano que es en alguna medida el lirismo de la Revolucin se articula la idea tcnica del ejercicio de un poder omnicontemplativo que es la obsesin de Bentham. Los dos se unen y el todo funciona: el lirismo de Rousseau y la obsesin de Bentham. M.P.:HayunafraseenelPanptico:Cadacamaradaseconvierteenunvigilante. Foucault:Rousseauhabradichojustamenteloinverso:quecadavigilanteseauncamarada.VaseEl Emilio:elpreceptordeEmilioesunvigilante,esnecesarioqueseatambinuncamarada. J.P.B.:LaRevolucinfrancesanoslonohaceunalecturaprximaalaquehacemosahorasinoque inclusoencuentraenelproyectodeBenthammirashumanitarias. Foucault: Justamente, cuando la Revolucin se pregunta por una nueva justicia el resorte para ella serlaopinin.Suproblema,denuevo,nohasidohacerquelasgentesfuesencastigadas;sinohacer que ni siquiera puedan actuar mal en la medida en que se sentiran sumergidas, inmersas, en un campodevisibilidadtotalenelcuallaopinindelosotros,lamiradadelosotros,eldiscursodelos otros, les impidan obrar mal o hacer lo que es nocivo. Esto est presente constantemente en los textosdelaRevolucin. M. P.: El contexto inmediato ha jugado tambin su papel en la adopcin del panptico por la Revolucin: en este momento el problema de las crceles est a la orden del da. A partir de 1770 tanto en Inglaterra como en Francia existe una fuerte inquietud respecto a este tema como puede constatarse a travs de la encuesta de Howard sobre las prisiones traducida al francs en 1788.

phylosajvg - @filodac

MaterialesdeUsodidcticoAntropologaSocialyC

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

101

Hospitales y crceles son dos grandes temas de discusin en los salones parisinos, en los crculos ilustrados.Sehaconvertidoenalgoescandalosoelquelasprisionesseanloqueson:unaescueladel vicio y del crimen; y lugares tan desprovistos de higiene que en ellos se muere uno. Los mdicos comienzan a decir cmo se deteriora el cuerpo, cmo se dilapida en semejantes sitios. Llegada la Revolucin francesa, emprende a su vez una encuesta de alcance europeo. Un tal Duquesnoy es el encargado de hacer un informe sobre los establecimientos llamados de humanidad, vocablo que comprendehospitalesyprisiones. Foucault: Un miedo obsesivo ha recorrido la segunda mitad del siglo XVIII: el espacio oscuro, la pantalla de oscuridad que impide la entera visibilidad de las cosas, las gentes, las verdades. Disolver los fragmentos de noche que se oponen a la luz, hacer que no existan ms espacios oscuros en la sociedad, demoler esas cmaras negras en las que se fomenta la arbitrariedad poltica, los caprichos del monarca, las supersticiones religiosas, los complots de los tiranos y los frailes, las ilusiones de ignorancia, las epidemias. Los castillos, los hospitales, los depsitos de cadveres, las casas de correccin, los conventos, desde antes de la Revolucin han suscitado una desconfianza o un odio que no fueron subestimados; el nuevo orden poltico y moral no puede instaurarse sin su desaparicin. Las novelas de terror en la poca de la Revolucin, desarrollan todo un mundo fantstico de la muralla,de la sombra, delo oculto,de lamazmorra,detodo aquello que protege en una complicidad significativa, a los truhanes y a los aristcratas, a los monjes y a los traidores: los paisajes deAnnRadcliffe son montaas,bosques,cuevas,castillosenruinas,conventosen losque la oscuridadyelsilenciodanmiedo.Ahorabien,estosespaciosimaginariossoncomolacontrafigura de las transparencias y de las visibilidades que se intentan establecer entonces. Este reino de la opininquese invocacontantafrecuencia enesta poca, esunmodo defuncionamientoenelque el poder podra ejercerse por el solo hecho de que las cosas se sabrn y las gentes sern observadas por una especie de mirada inmediata, colectiva y annima. Un poder cuyo recorte principal fuese la opinin no podra tolerar regiones de sombra. Si se han interesado por el proyecto de Bentham se debe aque,siendoaplicableatantoscampos diferentes,proporcionabalafrmula de unpoderpor transparencia, de un sometimiento por proyeccin de claridad. El panptico es un poco la utilizacin de la forma castillo: (torren rodeado de murallas) para paradjicamente crear un espaciodelegibilidaddetallada. J.P. B.: Son en definitiva los rincones ocultos del hombre lo que el Siglo de las Luces quiere hacer desaparecer. Foucault:Indudablemente. M. P.: Sorprenden tambin las tcnicas de poder que funcionan en el interior del panptico. La mirada fundamentalmente, y tambin la palabra puesto que existen esos famosos tubos de acero extraordinaria invencin que unen el inspector central con cada una de las celdas en las que se encuentran, nos dice Bentham, no un prisionero sino pequeos grupos de prisioneros. En ltimo trmino, la importanciadela disuasinestmuypresenteenel textodeBentham:sprecisodice estar incesantemente bajo la mirada de un inspector; perder la facultad de hacer el mal y casi el pensamiento de quererlo. Nos encontramos de lleno con las preocupaciones de la Revolucin: impediralasgentesobrarmal,quitarleslasganasdedesearlo,enresumen:nopoderynoquerer. Foucault: Estamos hablando de dos cosas: de la mirada y de la interiorizacin. Y, en el fondo, no se trata del problema del precio del poder? El poder, de hecho, no se ejerce sin gastos. Existe evidentemente el coste econmico, y Bentham lo dice. Cuntos vigilantes hacen falta? Cunto, en definitiva,costarlamquina?Peroestademselcostepropiamentepoltico.Siseesmuyviolento se corre el riesgo de suscitar insurrecciones; si se interviene de forma discontinua se arriesga uno a dejar quese produzcan, en los intervalos, fenmenosderesistenciadeuncostepolticoelevado.As funcionaba el poder monrquico. Por ejemplo, la justicia que detena una proporcin irrisoria de criminales, argumentaba diciendo: conviene que el castigo sea espectacular para que los dems tengan miedo. Poder violento por tanto que deba, mediante el ejemplo, asegurar las funciones de

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

102

continuidad. A esto contestan los nuevos tericos del siglo XVIII: es un poder demasiado costoso y con muy pocos resultados. Se hacen grandes gastos de violencia que en realidad no tienen valor de ejemplo, se ve uno incluso obligado a multiplicar las violencias, de forma tal, que se multiplican las rebeliones. M.P.:Estoesloquesucediconlasinsurreccionescontraelpatbulo. Foucault:Por elcontrario,se cuentaconlamiradaquevaaexigirpocos gastos.Nohaynecesidadde armas,deviolenciasfsicas,decoaccionesmateriales.Bastaunamirada.Unamiradaquevigile,yque cadauno,sintindolapesarsobres,terminepor interiorizarlahastaelpuntodevigilarseasmismo; cada unoejercer esta vigilancia sobre ycontra smismo.Frmulamaravillosa: unpodercontinuo y de un coste, en ltimo trmino, ridculo! Cuando Bentham considera que l lo ha conseguido, cree que es el huevo de Coln en el orden de la poltica, una frmula exactamente inversa a la del poder monrquico. De hecho, en las tcnicas de poder desarrolladas en la poca moderna, la mirada ha tenido una importancia enorme, pero como ya he dicho, est lejos de ser la nica ni siquiera la principalinstrumentacinpuestaenprctica. M.P.:Pareceque,respectoaesto,Benthamseplanteael problemadelpoderenfuncinsobretodo de grupos pequeos. Por qu? Por qu piensa que la parte es el todo, y que si se logra el xito a nivel de grupos puede luego extenderse al todo social? O bien es que el conjunto social, el poder a niveldetodosocialesalgoqueentoncesnoseconcebarealmente?Porqu? Foucault: El problema consiste en evitar los obstculos, las interrupciones; al igual que ocurra en el Antiguo Rgimen, con las barreras que presentaban a las decisiones de poder los cuerpos constituidos, los privilegios de determinadas categoras, desde el clero, hasta las corporaciones, pasando por los magistrados. Del mismo modo que las barreras que, en el Antiguo Rgimen presentaban los cuerpos constituidos, los privilegios de determinadas categoras a las decisiones de poder. La burguesa comprende perfectamente que una nueva legislacin o una nueva Constitucin no son garanta suficiente para mantener su hegemona. Se da cuenta de que debe inventar una tecnologa nueva que asegure la irrigacin de todo el cuerpo social de los efectos de poder llegando hasta sus ms nfimos resquicios. Y en esto precisamente la burguesa ha hecho no slo una revolucin poltica sino que tambin ha sabido implantar una hegemona social que desde entonces conserva. Esta es la razn por la que todas estas invenciones han sido tan importantes y han hecho deBenthamunodelosinventoresmsejemplaresdelatecnologadepoder. J.P. B.: No obstante, no se sabe a quin beneficia el espacio organizado tal como Bentham preconiza, si a los que habitan la torre central o a los que vienen a visitarla. Se tiene la sensacin de estaranteunmundoinfernaldelquenoescapanadie,nilosquesonobservadosnilosqueobservan. Foucault: Esto es sin duda lo que hay de diablico en esta idea como en todas las aplicaciones a que ha dado lugar. No existe en ella un poder que radicara totalmente en alguien y que ese alguien ejercera l solo y de forma absoluta sobre los dems; es una mquina en la que todo el mundo est aprisionado, tanto los que ejercen el poder como aquellos sobre los que el poder se ejerce. Pienso que esto es lo caracterstico de las sociedades que se instauran en el siglo XIX. El poder ya no se identificasustancialmenteconunindividuoqueloejerceraoloposeeraenvirtuddesunacimiento, se convierte en una maquinaria de la que nadie es titular. Sin duda, en esta mquina nadie ocupa el mismo puesto, sin duda ciertos puestos son preponderantes y permiten la produccin de efectos de supremaca. De esta forma, estos puestos pueden asegurar una dominacin de clase en la misma medidaenquedisocianelpoderdelapotestadindividual. M.P.:Elfuncionamientodelpanpticoes,desdeestepuntodevista,untantocontradictorio.Estel inspector principal que desde la torre central vigila a los prisioneros. Pero, al mismo tiempo, vigila a sus subalternos, es decir, al personal; este inspector central no tiene ninguna confianza en los

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

103

vigilantes,einclusoserefiere aellosdeunmodountantodespectivopeseaque,enprincipio,estn destinadosaserleprximos.Pensamiento,pues,aristocrtico! Pero, al mismo tiempo, quisiera hacer esta observacin en lo que se refiere al personal subalterno: ha constituido un problema para la sociedad industrial. No ha sido cmodo para los patronos encontrarcapataces,ingenieroscapacesdedirigirydevigilarlasfbricas. Foucault: Es un problema considerable que se plantea en el siglo XVIII. Se puede constatar claramente en el caso del ejrcito, cuando fue necesario fabricar suboficiales que tuviesen conocimientos autnticos para organizar eficazmente las tropas en caso de maniobras tcticas, con frecuencia difciles, tanto ms difciles cuanto que el fusil acababa de ser perfeccionado. Los movimientos,losdesplazamientos,lasfilas,lasmarchasexiganestepersonaldisciplinario.Mstarde los talleres vuelven a plantear a su modo el mismo problema; tambin la escuela con sus maestros, sus ayudantes, sus vigilantes. La iglesia era entonces uno de los raros cuerpos sociales en el que existan pequeos cuadros competentes. Elreligioso,ni muy alfabetizadoni totalmente ignorante,el cura, el vicario entraron en lid cuando se necesit escolarizar a centenas de millares de nios. El Estado no se dot con pequeos cuadros similares hasta mucho ms tarde. Igual sucedi con los hospitales. No hace an mucho que el personal subalterno hospitalario continuaba estando constituidoensumayoraporreligiosas. M. P.: Estas mismas religiosas han desempeado un papel considerable en la aplicacin de las mujeres altrabajo: aqu se sitan los famosos internados del siglo XIXenlosque vivaytrabajaba un personal femenino bajo el control de religiosas formadas especialmente para ejercer la disciplina de lasfbricas. El Panptico est lejos de estar exento de estas preocupaciones ya que se puede constatar la existencia de esta vigilancia del inspector principal sobre el personal subalterno, y esta vigilancia sobre todos, a travs de las ventanas de la torre, sucesin ininterrumpida de miradas que hace pensaren cada camaradaseconvierteenunvigilante,hastaelpuntodequese tienela impresin, un poco vertiginosa, de estar en presencia de una invencin que en alguna medida se va de las manos de su creador. Bentham, en un principio, quiere confiar en un poder nico: el poder central. Pero, leyndolo uno se pregunta, a quin mete Bentham en la torre? Al ojo de Dios? Sin embargo Diosestpocopresenteensutexto;lareliginnodesempeasinounpapeldeutilidad.Entonces,a quin?EndefinitivaesprecisodecirqueelmismoBenthamnovemuyclaroaquienconfiarelpoder. Foucault: Bentham no puede confiar en nadie en la medida en que nadie debe ser lo que era el rey en el antiguo sistema, es decir, la fuente del poder y de la justicia. La teora de la monarqua lo supona.Eraprecisoconfiarenelrey.Porsupropiaexistencia,queridaporDios,leralafuentedela justicia,delaley,delpoder.Elpoderqueradicabaensupersonanopodasinoserbueno;unmalrey equivala a un accidente de lahistoria oauncastigo delsoberanoabsolutamente perfecto, Dios.Por el contrario, no se puede confiar en nadie cuando el poder est organizado como una mquina que funcionasegnengranajescomplejos,enlaqueloqueesdeterminanteeselpuestodecadauno,no su naturaleza. Si la mquina fuese tal que alguien estuviese fuera de ella, o que tuviese l solo la responsabilidad de su gestin, el poder se identificara a un hombre y estaramos de nuevo en un poder de tipo monrquico. En el Panptico, cada uno, segn su puesto, est vigilado por todos lo dems, o al menos por alguno de ellos; se est en presencia de un aparato de desconfianza total y circulanteporquecarecedeunpuntoabsoluto.Laperfeccindelavigilanciaesunasumadeinsidias. J.P. B.: Una maquinaria diablica, como has dicho, que no perdona a nadie. La imagen quiz del poder de hoy. Pero, cmo crees que se ha llegado hasta aqu? Por voluntad de quin y con qu objeto? Foucault: La cuestin del poder se simplifica cuando se plantea nicamente en trminos de legislacin o de Constitucin; o en trminos de Estado o de aparato de Estado. El poder es sin duda ms complicado, o de otro modo, ms espeso y difuso que un conjunto de leyes o un aparato de Estado. No se puede comprender el desarrollo de las fuerzas productivas propias del capitalismo, ni

phylosajvg - @filodac

MaterialesdeUsodidcticoAntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

104

imaginar su desarrollo tecnolgico, si no se conocen al mismo tiempo los aparatos de poder. En el caso, por ejemplo, de la divisin de trabajo en los grandes talleres del siglo XVIII, cmo se habra llegado a este reparto de tareas si no hubiese existido una nueva distribucin del poder al propio nivel del remodelamiento de las fuerzas productivas? Lo mismo sucede con el ejrcito moderno: no basta con que exista otro tipo de armamento, ni otra forma de reclutamiento, fue necesario que se produjera a la vez esta nueva distribucin de poder que se llama disciplina, con sus jerarquas, sus cuadros, sus inspecciones, sus ejercicios, sus condicionamientos y domesticaciones. Sin esto, el ejrcitotalcomohafuncionadodesdeelsigloXVIIInohubierasidoposible. J.P.B.:Detodosmodos,existealguienoalgunosqueimpulsaneltodo? Foucault: Se impone una distincin. Est claro que en un dispositivo como el ejrcito, el taller o cualquier tipo de institucin, la red del poder adopta una forma piramidal. Existe pues una cspide. Sin embargo incluso en un caso as de simple, esta cspide no es la fuente o el principio de donde se derivara todo el poder como de un centro luminoso (esta es la imagen segn la cual se representa a la monarqua). La cspide y los elementos inferiores de la jerarqua estn en una relacin de sostn y de condicionamiento recprocos; se sostienen (el poder como chantaje mutuo e indefinido). Pero si lo que me preguntas es si esta nueva tecnologa de poder tiene histricamente su origen en un individuo o en un grupo de individuos determinados, que habran decidido aplicarla para servir sus propios intereses y utilizar as, en su beneficio, el cuerpo social, te responder: no. Estas tcticas han sido inventadas, organizadas, a partir de condiciones locales y de urgencias concretas. Se han perfilado palmo a palmo antes de que una estrategia de clase las solidifique en amplios conjuntos coherentes. Hay que sealar adems que estos conjuntos no consisten en una homogeneizacin sino ms bien en un juego complejo de apoyos que adoptan los diferentes mecanismos de poder unos sobre otros permaneciendo sin embargo en su especificidad. As, actualmente, la interrelacin entre medicina, psiquiatra, psicoanlisis, escuela, justicia, familia, en lo que se refiere a los nios, no homogeneiza estas distintas instancias sino que establece entre ellas conexiones, reenvos, complementariedades, delimitaciones, lo que supone que cada una conservahastaciertopuntolasmodalidadesquelesonpropias. M. P.: Ud. rechaza la idea de un poder que sera una superestructura, pero no la idea de un poder quees,enciertomodo,consustancialaldesarrollodelasfuerzasproductivas,queformapartedel. Foucault: Por supuesto. Y el poder se transforma continuamente con estas fuerzas. El Panptico era una utopaprograma.Peroya en lapocadeBenthameltema de un poderespacializante,vigilante, inmovilizante, en una palabra, disciplinario, estaba desbordado por mecanismos mucho ms sutiles que permitan la regulacin de los fenmenos de poblacin, el control de sus oscilaciones, la compensacin de sus irregularidades. Bentham es arcaizante por la importancia que da a la mirada,esmuyactualporlaimportanciaqueconcedealastcnicasdepoderengeneral. M.P.:NoexisteunEstadoglobal,existenmicrosociedades,microcosmosqueseinstauran. J.P. B.: Es preciso entonces, frente al despliegue del panptico, poner en cuestin la sociedad industrial?Oconvienehacerresponsablealasociedadcapitalista? Foucault:Sociedadindustrialosociedadcapitalista?Nosabrarespondersinoesdiciendoqueestas formas de poder se encuentran tambin en las sociedades socialistas: la transferencia ha sido inmediata.Pero,sobreestepunto,preferiraqueintervengalahistoriadora. M. P.: Es cierto que la acumulacin de capital surge por una tecnologa industrial y por la puesta en marchadetodounaparatodepoder.Peronoesmenosciertoqueunprocesosemejanteaparecede nuevo en la sociedad socialista sovitica. El estalinismo, en cierto modo, corresponde tambin a un perododeacumulacindecapitalydeinstauracindeunpoderfuerte.

phylosajvg - @filodac

MaterialesdeUsodidctico

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

105

J.P.B.:Denuevoencontramos,comodepasada, lanocin debeneficio;enestesentido,la mquina inhumanadeBenthamsemuestracomoalgomuyvalioso,almenosparaalgunos. Foucault: Evidentemente! Habra que tener el optimismo un poco ingenuo de los dandys del siglo XIX para imaginarse que la burguesa es tonta. Por el contrario, conviene tener en cuenta sus golpes de genio. Y, entre ellos justamente, est el hecho de que ha sido capaz de construir mquinas de poder que posibilitan circuitos de beneficios los cuales, a su vez, refuerzan y modifican los dispositivos de poder, y esto de forma dinmica y circular. El poder feudal, funcionando por deducciones y gasto, se minaba a s mismo. El de la burguesa se mantiene no por la conservacin sino mediante transformaciones sucesivas. De aqu se deriva que la posibilidad de su cada y de la Revolucinformenpartedesuhistoriaprcticamentedesdesuscomienzos. M. P.: Se puede sealar que Bentham concede una enorme importancia al trabajo, al que se refiere unayotravez. Foucault: Ello responde al hecho de que lastcnicasde poder se han inventado pararesponder a las exigencias de la produccin. Me refiero a la produccin en un sentido amplio (puede tratarse de producirunadestruccin,comoenelcasodelejrcito). J.P.B.:Cuando,dichoseadepaso,empleaseltrminotrabajoentuslibros,raramentelohacesen relacinaltrabajoproductivo. Foucault: Porque se da el caso de que me he ocupado de gentes que estaban situadas fuera de los circuitos del trabajo productivo: los locos, los enfermos, los prisioneros, y actualmente los nios. El trabajoparaellos,talcomodebenrealizarlo,tieneunvalorpredominantedisciplinario. J.P.B.:Eltrabajocomoformadedomesticacin.Nosedasiempre? Foucault: Por supuesto. Siempre se ha hablado de la triple funcin del trabajo: funcin productiva, funcin simblica y funcin de domesticacino disciplinaria. La funcin productiva es sensiblemente igual a cero para las categoras de las que me ocupo, mientras que las funciones simblica y disciplinariasonmuyimportantes.Pero,lomsfrecuente,esquecoexistenlostrescomponentes. M.P.: Bentham, en todo caso, me parece muy seguro de s, muy confiado en el poder penetrante de la mirada. Se tiene incluso la sensacin de que no calibra muy bien el grado de opacidad y de resistencia del material que ha de corregir, que ha de integrar en la sociedad los famosos prisioneros.Adems,noeselpanpticodeBentham,enciertomodo,lailusindelpoder? Foucault: Es la ilusin de casi todos los reformadores del siglo XVIII que han concedido a la opinin un poder considerable. Puesto que la opinin necesariamente era buena por ser la conciencia inmediata de cuerpo social entero, los reformadores creyeron que las gentes se haran virtuosas por el hecho de ser observadas. La opinin era para ellos como la reactualizacin espontnea del contrato. Desconocan las condiciones reales de la opinin, los media, una materialidad que est aprisionadaenlosmecanismosdelaeconomaydelpoderbajolaformadelaprensa,delaedicin,y mstardedelcineydelatelevisin. M. P.: Cuando dices que han desconocido los media, quieres decir que no se han dado cuenta de quelesharafaltautilizarlos. Foucault:Yqueesosmediaestarannecesariamentedirigidosporintereseseconmicospolticos.No percibieron los componentes materiales y econmicos de la opinin. Creyeron que la opinin sera justa por naturaleza, que se extendera por s misma, y que sera una especie de vigilancia democrtica. En el fondo, es el periodismo innovacin capital del siglo XIX el que ha puesto de manifiestoelcarcterutpicodetodaestapolticadelamirada.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

106

M. P.: En general los pensadores desconocen las dificultades que van a encontrar para hacer prender su sistema. Ignoran que siempre habr escapatorias y que las resistencias jugarn su papel. En el terreno de las crceles, los detenidos no han sido gente pasiva; es Bentham quien nos hacepensarlocontrario.Eldiscursopenitenciariosedespliegacomosinoexistiesenadiefrenteal, como si no existiese ms que una Tbula rasa, gente que hay que reformar para arrojar luego al circuito de la produccin. En realidad hay un material los detenidos que resiste de un modo formidable. Lo mismo se podra decir del taylorismo, sistema que constituye una extraordinaria invencin de un ingeniero que quiere luchar contra la gandulera, contra todo lo que hace ms lento el ritmo de produccin. Pero en ltima instancia, se puede uno preguntar:ha funcionado realmente algunavezeltaylorismo? Foucault: En efecto, otro de los elementos que sita tambin a Bentham en lo irreal es la resistencia efectiva de las gentes. Cosas que Vd., Michelle Perrot, ha estudiado. Cmo se ha opuesto la gente en los talleres, en las ciudades, al sistema de vigilancia, de pesquisas continuas? Tenan conciencia del carcter coactivo, de sometimiento insoportable de esta vigilancia? O lo aceptaban como algo natural?Ensuma,hanexistidoinsurreccionescontralamirada? M. P.: S, han existido insurrecciones contra la mirada. La repugnancia de los trabajadores a habitar las ciudades obreras es un hecho patente. Lasciudadesobreras, durante mucho tiempo, hansidoun fracaso. Lo mismo sucede con la distribucin del tiempo tan presente en el Panptico. La fbrica y sus horarios han suscitado durante largo tiempo una resistencia pasiva que se traduca en el hecho de que, simplemente, no se iba. Es la prodigiosa historia del San Lunes en el siglo XIX, da que los obreros haban inventado para tomar aire cada semana. Han existido mltiples formas de resistencia al sistema industrial obligando a los patrones a dar marcha atrs en el primer momento. Otro ejemplo: los sistemas de micropoderes no se han instaurado de forma inmediata. Este tipo de vigilanciaydeencuadramientosehadesarrollado,enunprimertiempo,enlossectoresmecanizados que contaban mayoritariamente con mujereso nios,es decir, con personashabituadas a obedecer: lamujerasumarido,elnioasufamilia.Peroenlossectoresdigamosviriles,comolametalurgia,se observa una situacin muy distinta. La patronal no llega a implantar inmediatamente su sistema de vigilancia, y debe, durante la primera mitad del siglo XIX, delegar sus poderes. Establece un contrato con el equipo de obreros a travs de su jefe que es generalmente el obrero ms anciano o ms cualificado. Se ejerce un verdadero contrapoder por parte de los obreros profesionales, contra poder que comporta algunas veces dos facetas:una contra la patronal en defensa de la comunidad obrera,laotra,aveces,contralosmismosobrerosyaqueeljefecillooprimeasusaprendicesoasus camaradas. En realidad, estas formas de contrapoder obrero existieron hasta el momento en que la patronal supo mecanizar las funciones que se le escapaban, pudiendo abolir as el poder del obrero profesional. Existen numerosos ejemplos: en el caso de los laminadores, el jefe de taller tuvo los medios para resistir al patrn hasta el momento en que entraron en escena mquinas casi automticas.Elgolpedeojodellaminadordenuevoaqulamiradaquejuzgabasilamateriaestaba apuntosersustituidoporelcontroltrmico;bastalalecturadeuntermmetro. Foucault: Sabido esto, hay que analizar el conjunto de las resistencias al panptico en trminos de tctica y de estrategia, pensando que cada ofensiva que se produce en un lado sirve de apoyo a una contraofensivadelotro.Elanlisisdelosmecanismosdepodernotienecomofinalidadmostrarque elpoderesannimoyalavezvictoriososiempre.Setrata,porelcontrario,desealarlasposiciones y los modos de accin de cada uno, las posibilidades de resistencia y de contraataque de unos y otros. J.P. B.: Batallas, acciones, reacciones, ofensivas y contraofensivas, hablas como un estratega. Las resistencias al poder, tendran caractersticas esencialmente fsicas? Qu pasa con el contenido de lasluchasylasaspiracionesquesemanifiestanenellas? Foucault:Enefecto,esaesunacuestintericaydemtodoimportante.Mesorprendeunacosa:se utiliza mucho, en determinados discursos polticos el vocabulario de las relaciones de fuerza; el

phylosajvg - @filodac

MaterialesdeUsodidcticoAntropologaSocialyCultural

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

107

trminoluchaesunodelosque aparecenconms frecuencia.Ahorabien, mepareceque seduda a la hora de sacar consecuencias, e incluso, a la de plantear el problema que subyace a este vocabulario. Quiero decir: Hay que analizar estas luchas en tanto que peripecias de una guerra? Hay que descifrarlas a partir de un cdigo que sera el de la estrategia y de la tctica? La relacin de fuerzas en el orden de la poltica es una relacin de guerra? Personalmente no me siento de momentopreparado pararesponders ono de una formadefinitiva. Pienso solamente que la puray simple afirmacin de una lucha no puede servir de explicacin primera y ltima en los anlisis de las relaciones de poder. Este tema de la lucha no es operativo ms que si se establece concretamente, y respecto a cada caso: quinest en la lucha,enqu lugar,con qu instrumentos y con qu racionalidad. En otros trminos, si se toma en serio la afirmacin de que la lucha est en el corazn de las relaciones de poder, hay que tener presente que la brava y vieja lgica de la contradiccinnobasta,niconmucho,paradesembrollarlosprocesosreales. M. P.: Dicho de otro modo, y para volver al panptico, Bentham no proyecta slo una sociedad utpica,describetambinunasociedadexistente. Foucault:Describeenlautopaunsistemageneraldemecanismosconcretosqueexistenrealmente. M.P.:Y,paralosprisioneros,tienesentidotomarlatorrecentral? Foucault: S, con la condicin de que ste no sea el sentido final de la operacin. Los prisioneros haciendo funcionar el panptico y asentndose en la torre, cree Ud. que entonces sera mucho mejorqueconlosvigilantes? NOTAS (1)MichelFoucaultdescribeasElPanpticoyaJeremasBenthamensuobraVigilarycastigar.SigloXXI, Mxico,1976. (2)JohnHowardpublicalosresultadosdesuencuestaensulibro:TheStateofthePrisionsinEnglandand Wales,withPreliminaryObservationsandanAccountofsomeForeignPrisionsandHospitals(1777).

Observeatentamentelaimagenypropongaunainterpretacindeella, recurriendoalusodelascategorasconceptualesqueapareceneneltexto.Para elloprimeroidentifquelas,luegoelaboreunalistasealandosusentido principal.


phylosajvg - @filodac

FOUCAULT, M. CONFERENCIAS SOBRE EL PODER


MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO 108

I. LA CUESTIN DEL SUJETO


Las ideas que me gustara exponer ahora no pretenden pasar por una teora o una metodologa. Primero quisiera sealar cul ha sido el objetivo de mi trabajo durante estos ltimos veinte aos. No ha sido analizar los fenmenos del poder, ni poner las bases de tal anlisis. He intentado hacer una historia de los diferentes modos de subjetivacin del ser humano que se han dado en nuestra cultura; desde esta perspectiva he abordado tres modos de objetivacin que transforman a los seres humanos en sujetos. Primero estn los diferentes modos de investigacin que tratan de acceder al estatus de ciencia; pienso, por ejemplo, en la objetivacin del sujeto parlante en gramtica general, en filologa y en lingstica. O bien, siempre en este primer modo, en la objetivacin del sujeto productivo, del sujeto que trabaja, en economa y en el anlisis de las riquezas. O tambin, para dar un tercer ejemplo, en la objetivacin por el slo hecho de estar vivos en historia natural o en biologa. En la segunda parte de mi trabajo, he estudiado la objetivacin del sujeto en lo que llamara las prcticas dividientes. El sujeto se encuentra ya sea escindido en su interior, ya escindido de los otros. Este proceso lo convierte en un objeto. La divisin entre el loco y el hombre cuerdo, el enfermo y el individuo de buena salud, el criminal y el muchacho amable, ilustra esta tendencia. Por ltimo, he intentado estudiar ste es mi trabajo en curso la manera en que un ser humano se transforma en sujeto; he orientado mis investigaciones hacia la sexualidad, por ejemplo la manera en que el hombre aprendi a reconocerse como sujeto de una sexualidad. No es por tanto el poder sino el sujeto, lo que constituye el tema general de mis investigaciones. Es cierto que he tenido que interesarme de cerca en la cuestin del poder. Rpidamente me pareci que si el sujeto humano est atrapado en relaciones de produccin y relaciones de sentido, igualmente se encuentra atrapado en relaciones de poder de una gran complejidad. Ahora bien, nosotros contamos, gracias a la historia y a las teoras econmicas, con instrumentos adecuados para estudiar las relaciones de produccin; asimismo, la lingstica y la semitica ofrecen instrumentos para el estudio de las relaciones de sentido. Pero en lo que respecta a las relaciones de poder, no existe ningn instrumento definido, recurrimos a maneras de pensar el poder que se basan ya sea en modelos jurdicos (qu es lo que legitima el poder?), ya en modelos institucionales (qu es el Estado?). Por lo tanto, era necesario ampliar las dimensiones de una definicin del poder si se quera utilizar esta definicin para estudiar la objetivacin del sujeto. Necesitamos una teora del poder? Puesto que toda teora supone una objetivacin previa, ninguna puede servir de base al trabajo de anlisis. Pero no puede realizarse el trabajo de anlisis sin una conceptualizacin de los problemas tratados. Y esta conceptualizacin implica un pensamiento crtico, una verificacin constante. Ante todo es preciso asegurarse de lo que llamar las necesidades conceptuales. Con esta expresin quiero sealar que la conceptualizacin no debe fundarse en una teora del objeto: el objeto conceptualizado no es el nico criterio de validez de una conceptualizacin. Debemos conocer las condiciones histricas que motivan tal o cual tipo de conceptualizacin. Debemos tener conciencia histrica de la situacin en la que vivimos. En segundo lugar, debemos asegurarnos del tipo de realidad que debemos confrontar. Un periodista de un importante diario francs manifestaba un da su sorpresa: Por qu tanta gente se plantea la cuestin del poder en la actualidad? Es ste un tema tan importante?. Y tan independiente que se pueda hablar de l sin tener en cuenta otros problemas? Tal sorpresa me dej estupefacto. Me resulta difcil creer que hayamos tenido que esperar hasta el siglo XX para plantear esta cuestin. De todos modos, para nosotros el poder no es slo una cuestin histrica, sino algo que forma parte de nuestra experiencia. Slo utilizar, como pruebas esas dos formas patolgicas, esas dos enfermedades del poder, que son el fascismo y el stalinismo. Una de las numerosas razones por las que son tan desconcertantes para nosotros, es que a pesar de su singularidad histrica no son del todo originales. El fascismo y el stalinismo utilizaron y difundieron mecanismos ya presentes en la mayora de las sociedades. No slo eso, sino que a pesar de su locura interna, en gran medida utilizaron las ideas y 1os procedimientos de nuestra racionalidad poltica. Nos hace falta una nueva economa de las relaciones de poder y utilizo el trmino economa en su sentido terico y prctico. Para expresar las cosas de otra manera: desde Kant, la funcin de la filosofa es impedir a la razn que exceda los lmites de lo que se da en la experiencia; pero tambin desde aquella poca es decir, desde el desarrollo del Estado moderno y de la gestin poltica de la sociedad la filosofa tiene tambin la funcin de agitar los poderes excesivos de la racionalidad poltica. Y esto es pedirle mucho. 2
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

109

Estos son hechos extremadamente banales que todo el mundo conoce. Pero no debemos desconocer su existencia por el hecho de que sean banales. Lo que hay que hacer con los hechos banales es descubrir o por lo menos intentar descubrir que problema especfico, y quiz original, est ligado a ellos. La relacin nutre la racionalizacin y los excesos del poder poltico es evidente. Y no fue necesario esperar el advenimiento de la burocracia o de los campos de concentracin para reconocer la existencia de estas relaciones. Pero el problema consiste entonces en saber qu hacer con un hecho tan evidente. Vamos a hacer el juicio' a la razn? En mi opinin, no hay nada ms estril. En primer lugar. porque en este terreno no existe ni culpa ni inocencia. En segundo lugar, porque es absurdo invocar la razn como la entidad contraria de la no-razn. Y, finalmente, porque un proceso semejante sera una trampa que nos obligara a adoptar el papel arbitrario y tedioso del racionalista o del irracionalista. Vamos a analizar este tipo de racionalismo que al parecer es especfico de nuestra cultura moderna y que encuentra su punto de anclaje en la Aufklrung? Este fue el acercamiento de algunos miembros de la escuela de Francfort. Mi propsito no es emprender una discusin sobre sus obras que son muy importantes y de gran valor, sino proponer otra manera de analizar las relaciones entre la racionalizacin y el poder. Sin lugar a dudas es ms prudente no abordar globalmente la racionalizacin de la sociedad o de la cultura, sino ms bien analizar ese proceso en diversos terrenos cada uno de ellos tiene sus races en una experiencia fundamental: locura, enfermedad, muerte, crimen, sexualidad, etctera. Pienso que el trmino racionalizacin es peligroso. Lo que hay que hacer es analizar racionalidades especficas ms que invocar incesantemente los progresos de la racionalizacin en general. 1 A pesar de que la Aufklrung fue una fase muy importante de nuestra historia y del desarrollo de la tecnologa poltica, creo que es preciso remontarnos a procesos ms alejados si se quiere comprender a travs de qu mecanismos nos convertimos en prisioneros de nuestra propia historia. Quisiera sugerir aqu otra manera de avanzar hacia una nueva economa de las relaciones de poder, que sea a la vez ms emprica, que tenga una relacin ms directa con nuestra situacin presente, y que implique ms relaciones entre la teora y la prctica. Este nuevo modo de investigacin consiste en tomar como punto de partida las formas de resistencia contra los diferentes tipos de poder. O, para utilizar otra metfora, consiste en utilizar esa resistencia como un catalizador qumico que permita poner en evidencia las relaciones de poder, ver en dnde se inscriben stas, descubrir sus puntos de aplicacin y los mtodos que utilizan. Ms que analizar el poder desde el punto de vista de su racionalidad interna, se trata de analizar las relaciones de poder a travs de la confrontacin de las estrategias. Por ejemplo, quizs sera necesario analizar lo que pasa en el terreno de la alienacin para comprender lo que la sociedad entiende por ser sensato. Y, asimismo, investigar lo que ocurre en el terreno de la ilegalidad para comprender lo que queremos decir cuando hablamos de legalidad. Por otro lado, para comprender en qu consisten las relaciones de poder, quiz fuera preciso analizar las formas de resistencia y los esfuerzos desplegados para tratar de disociar estas relaciones. Como punto de partida propondr una serie de oposiciones que se han desarrollado en estos ltimos aos: la oposicin al poder de los hombres sobre las mujeres; de los padres sobre sus hijos; de la psiquiatra sobre los enfermos mentales; de la medicina sobre la poblacin; de la administracin sobre la manera en que vive la gente. No basta con decir que estas oposiciones son luchas contra la autoridad; hay que tratar de definir con mayor precisin qu tienen en comn. 1. Son luchas transversales; con ello quiero decir que no se circunscriben a un pas particular. Es cierto que algunos pases favorecen su desarrollo, facilitan su difusin, pero no estn restringidas a un tipo particular de gobierno poltico o econmico. 2. El objetivo de estas luchas son los efectos, como tales, del poder. Por ejemplo, no se le reprocha a la profesin mdica ser una empresa con objetivo lucrativo, sitio que sin control ejerza un poder sobre los cuerpos, la salud de los individuos, su vida y su muerte. 3. Son luchas inmediatas, y esto por dos razones. Primero porque la gente critica la instancia del poder que le es ms prxima, las que ejercen su accin sobre los individuos. No busca al enemigo nmero uno sino al enemigo inmediato. En segundo lugar, no creen que la solucin a su problema pueda residir en un futuro incierto (es decir, en una promesa de liberacin, de revolucin, en el fin del conflicto de clases). En relacin con una escala terica de explicacin o con el orden revolucionario que polariza el historiador, se trata de luchas anrquicas.

Estos mismos conceptos fueron utilizados por Foucault en la introduccin ala conferencia en que investiga la naturaleza del poder. Cf. infra. [N. del T.]

3
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

110

Pero stas no son sus caractersticas ms originales. Su especificidad se define de la siguiente manera: 4. Son luchas que ponen en tela de juicio el estatus del individuo: por un lado, afirman el derecho a la diferencia y subrayan todo aquello que puede hacer a los individuos verdaderamente individuales. Por otra parte, atacan todo lo que puede aislar al individuo, separarlo de los otros, escindir la vida comunitaria, obligar al individuo a replegarse sobre s y ligarlo a su propia identidad. Estas luchas no estn exactamente en favor o en contra del individuo, pero se oponen a lo que se podra llamar el gobierno por individualizacin. 5. Estas luchas oponen una resistencia a los efectos del poder que estn ligados al saber, a la competencia y a la calificacin. Luchan contra los privilegios del saber. Pero tambin se oponen al misterio, a la deformacin y a todo lo que puede ser mistificador en las representaciones que se impone a la gente. No hay nada cientista en todo ello (es decir, ninguna creencia dogmtica en el valor del saber cientfico), pero tampoco hay rechazo escptico y relativista de cualquier verdad comprobada. Lo que se pone en tela de juicio es la manera en la que el saber circula y funciona, sus relaciones con el poder. En una palabra, el rgimen del saber. 6. Por ltimo, todas las luchas actuales giran en torno de la misma cuestin: quines somos? Son un rechazo a estas abstracciones, un rechazo a la violencia ejercida por el Estado econmico e ideolgico que ignora quines somos individualmente, y tambin un rechazo a la inquisicin cientfica o administrativa que determina nuestra identidad. En resumen, el principal objetivo de estas luchas no es tanto atacar tal o cual institucin de poder o grupo o clase o lite, sino atacar una tcnica particular, una forma de poder. Esta forma de poder se ejerce sobre la vida cotidiana inmediata que clasifica a los individuos en categoras, los designa por su individualidad propia, los liga a su identidad, les impone una ley de verdad que se ven obligados a reconocer y que los otros tienen que reconocer en ellos. Es una forma de poder que transforma a los individuos en sujetos. El trmino sujeto tiene dos acepciones: sujeto sometido al otro por el control y la dependencia: sujeto ligado a su propia identidad por la conciencia o el conocimiento de s. En los dos casos, este trmino sugiere una forma de poder que subyuga y somete. Se puede decir, de manera general, que existen tres tipos de luchas: las que se oponen a las formas de dominacin (tnicas, sociales y religiosas); las que denuncian las formas de explotacin que separan al individuo de lo que produce; y las que combaten todo lo que liga al individuo consigo mismo y asegura de esta forma su sumisin con los dems (luchas contra el sometimiento, contra las diversas formas de subjetividad y de sumisin). La historia prodiga ejemplos (le estos tres tipos de luchas sociales, ya se produzcan de manera aislada o conjunta. Pero incluso cuando estas luchas se entremezclan, casi siempre predomina alguna. En las sociedades feudales, por ejemplo, prevalecen las luchas contra las formas de dominacin tnica, aun cuando la explotacin econmica hubiera podido constituir un factor de rebelin muy importante. Fue en el siglo XIX cuando la lucha contra la explotacin pas a primer plano. Actualmente prevalece la lucha contra las formas de sujecin contra la sumisin de la subjetividad incluso si las luchas contra la dominacin y la explotacin no han desaparecido, por el contrario. Tengo la impresin de que no es la primera vez que nuestra sociedad se ve confrontada a este tipo de lucha. Todos esos movimientos que tuvieron lugar en el siglo XV y XVI, que encontraron su expresin y su justificacin en la Reforma, deben ser comprendidos como los ndices de una crisis mayor que afect la experiencia occidental de la subjetividad y de una rebelin contra el tipo de poder religioso y moral que haba dado forma, durante la Edad Media, a esa subjetividad. La necesidad que se experimentaba de participar directamente en la vida espiritual, en la labor de la salvacin, en la verdad del Gran Libro, pone de manifiesto una lucha por una nueva subjetividad. S qu objeciones pueden hacerse. Se puede decir que todos los tipos de sujecin no son ms que fenmenos derivados, consecuencias de otros procesos econmicos y sociales: las fuerzas de produccin, los conflictos de clases y las estructuras ideolgicas determinan el tipo de subjetividad al que se recurre. Es evidente que no se puede estudiar los mecanismos de sujecin sin tener en cuenta sus relaciones con los mecanismos de explotacin y de dominacin. Pero estos mecanismos de sumisin no constituyen simplemente la terminal de otros mecanismos ms fundamentales. Mantienen relaciones complejas y circulares con otras formas. Este tipo de lucha tiende a prevalecer en nuestra sociedad debido a una nueva forma de poder poltico que se desarroll desde el siglo XVI. Esta nueva estructura poltica es, como todo mundo sabe, el Estado. Pero, por lo general, el Estado es percibido como un tipo de poder poltico que ignora a los

4
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

111

individuos, y que slo se ocupa de los intereses de la comunidad o, debera decir, de una clase o de un grupo de ciudadanos escogidos. Es totalmente cierto. Sin embargo, me gustara subrayar el hecho de que el poder del Estado y sta es una de las causas de su fuerza es una forma de poder a la vez globalizante y totalizadora. En la historia de las sociedades humanas, creo que nunca se ha encontrado, dentro de las mismas estructuras polticas, una combinacin tan compleja de tcnicas de individualizacin y de procesamientos totalizadores, ni siquiera en la antigua sociedad china. Esto se debe al hecho de que el Estado occidental moderno integr, con una nueva forma poltica, una antigua tcnica de poder que haba surgido en las instituciones cristianas. Llamaremos a esta tcnica de poder, el poder pastoral. Y para comenzar, algunas palabras sobre este poder pastoral. Con frecuencia se ha afirmado que el cristianismo cre un cdigo de tica fundamentalmente diferente del cdigo que prevaleca en el mundo antiguo. Pero en general se insiste menos en el hecho de que el cristianismo propuso y difundi en todo el mundo antiguo nuevas relaciones de poder. El cristianismo es la nica religin que se organiz como Iglesia. Y un tanto que Iglesia, el cristianismo postula como teora que ciertos individuos son aptos, debido a su calidad religiosa, para que sirvan a otros, no como prncipes, magistrados, profetas, adivinos, benefactores o educadores, sino coreo pastores. Esta palabra designa una forma de poder muy particular. 1. Es una forma de poder cuyo objetivo final es lograr la salvacin de los individuos en el otro mundo. 2. El poder pastoral no es simplemente una forma de poder que ordena: tambin debe estar listo para sacrificarse por la vida y la salvacin del rebao. En esto se distingue del poder soberano que exige un sacrificio por parte de sus vasallos para salvar el trono. 3. Es una forma de poder que no slo se preocupa del conjunto de la comunidad, sino de cada individuo en particular, durante toda su vida. 4. Por ltimo, no puede ejercerse esta forma de poder sin conocer lo que pasa por la cabeza de la gente, sin forzarla a revelar sus ms ntimos secretos. Implica un conocimiento de la conciencia y una aptitud para dirigirla. Esta forma de poder est orientada hacia la salvacin (por oposicin con el poder poltico). Es oblativa (por oposicin al principio de soberana) e idividualizante (por oposicin con el poder jurdico). Es coextensiva a la vida y a su prolongacin; est ligada a una produccin de la verdad la verdad del mismo individuo. Pero, me dirn ustedes, todo eso pertenece a la historia; la forma pastoral, si no desapareci, por lo menos perdi lo esencial de lo que la haca eficaz. Es verdad, pero pienso que hay que distinguir dos aspectos del poder pastoral: la institucionalizacin eclesistica que desapareci, o por lo menos perdi su fuerza desde del siglo XVIII, y la funcin de esta institucionalizacin que se propag y desarroll fuera de la institucin eclesistica. Hacia el siglo XVIII se produjo un fenmeno importante: una nueva distribucin, una nueva organizacin de este tipo de poder individualizante. No creo que se pueda considerar al Estado moderno como una entidad que se desarroll haciendo caso omiso de los individuos, ignorando quines son e incluso su existencia, en la cual los individuos pueden ser integrados con una condicin: que se asigne a esta individualidad una forma nueva y que se le someta a un conjunto de mecanismos especficos. En un sentido, se puede ver en el Estado una matriz de la individualizacin o una nueva forma de poder pastoral. Quisiera agregar algunas palabras a propsito de este nuevo poder pastoral. 1. En el curso de su evolucin se observa un cambio de objetivo. Se pasa de la preocupacin de guiar a la gente a la salvacin en el otro mundo a la idea de que es preciso asegurarla aqu abajo. Y en este contexto el trmino salvacin 2 adquiere muchas acepciones: quiere decir salud, bienestar (es decir, nivel de vida aceptable, recursos suficientes), seguridad, proteccin contra los accidentes. Algunos objetivos terrestres reemplazan tos objetivos religiosos de la pastoral tradicional, y esto con mayor facilidad, en la medida en que esta ltima, por diversas razones, siempre se ha adjudicado algunos de estos objetivos de manera accesoria. Basta pensar en el papel de la medicina y en su funcin social que desde hace mucho tiempo tienen la Iglesia catlica y la protestante.

En francs el trmino salut tiene los sentidos que seala el pensador francs. [N. del T.]

5
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

112

2. Conjuntamente se ha producido un reforzamiento de la administracin del poder pastoral. En ocasiones, el aparato del Estado ejerci esta forma de poder o, por lo menos, una institucin pblica como la polica. No olvidemos que la polica fue inventada en el siglo XVIII no slo para vigilar y mantener el orden y la ley y para ayudar a las gobiernos a luchar contra sus enemigos, sino para asegurar el suministro de las ciudades, proteger la higiene y la salud, as como todos los criterios considerados como necesarios para el desarrollo del artesano y del comercio. En ocasiones el poder fue ejercido por empresas privadas, sociedades de asistencia, benefactores y, de manera general, por filntropos. Por otra parte, las instituciones antiguas, como por ejemplo la familia, fueron tambin movilizadas para llenar funciones pastorales. Por ltimo, el poder fue ejercido por estructuras complejas como la medicina, que inclua a la vez a instituciones privadas (la venta de servicios sobre la base de la economa de mercado) y algunas instituciones pblicas como los hospitales. 3. Por ltimo, la multiplicacin de los objetivos y de los agentes del poder pastoral permiti que el desarrollo del saber sobre el hombre se concentrara en torno a dos polos: uno globalizante y cuantitativo, concerna a la poblacin; el otro, analtico, concerna al individuo. Una de las consecuencias es que el poder pastoras, que durante siglos de hecho durante ms de un milenio haba estado relacionado a una institucin religiosa muy particular, se difundi repentinamente a todo el cuerpo social; encontr apoyo en una multitud de instituciones. Y, en lugar de tener un poder pastoral y un poder poltico ms o menos ligados uno a otro, ms o menos rivales, se observ cmo se desarroll una tctica individualizante caracterstica de toda una serie de poderes mltiples: el de la familia, de la medicina, de la psiquiatra, de la educacin, de los empleados, etctera. A fines del siglo XVIII, Kant publica en un diario alemn el Berliner Monatschrift un texto muy corto, que lleva el ttulo de: Was heisst Aufklrung? 3 Durante mucho tiempo este texto se ha considerado y an se le considera como relativamente menor. Pero no puedo dejar de encontrar este texto sorprendente e interesante a la vez, porque, por vez primera, un filsofo propone corno tarea de la filosofa el analizar no solamente el sistema o los fundamentos metafsicos del saber cientfico, sino un acontecimiento histrico un acontecimiento reciente, de actualidad. Cuando Kant se pregunta, en 1784, Was heisst Aufklrung?, quiere decir: Qu sucede en este momento? Qu nos pasa? Qu es este mundo, este periodo, este momento preciso en el que vivimos? O, para decir las cosas de otra manera: Quines somos? Quines somos, en tanto que Aufklrer, en tanto que testigos de este Siglo de las Luces? Comparemos con la pregunta cartesiana: Quin soy? Yo, en tanto que sujeto nico, pero universal y no histrico? Quin soy yo?, yo, pues Descartes es todo el mundo, en donde sea y en cualquier momento. Pero la cuestin que plantea Kant es diferente: Quines somos en este momento preciso de la historia? Esta cuestin analiza al mismo tiempo a nosotros y a nuestra situacin presente. Este aspecto de la filosofa adquiri paulatinamente importancia. Pinsese en Hegel, en Nietzsche... El otro aspecto, el de la filosofa universal, no ha desaparecido. Pero el anlisis crtico del mundo en el que vivimos constituye cada vez ms la gran tarea filosfica. Sin duda el problema filosfico ms imprescindible es el de la poca presente, lo que somos en este momento preciso. Sin duda, el objetivo principal actualmente no es descubrir sino rechazar lo que somos. Debemos imaginar y construir lo que podramos ser para desembarazarnos de esta doble presin poltica que son la individualizacin y la totalizacin simultneas de las estructuras del poder moderno. Se podr decir, como conclusin, que el problema, a la vez poltico, tico, social y filosfico, que se nos plantea actualmente no es tratar de liberar al individuo del Estado y de sus instituciones, sino liberarnos a nosotros del Estado y del tipo de individualizacin que se relaciona con l. Debemos promover nuevas formas de subjetividad, rechazando el tipo de individualidad que se nos ha impuesto durante muchos siglos.

En alemn, Qu significa Ilustracin? [N. del T.]

6
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

113

II. CMO SE EJERCE EL PODER?


Para algunos, interrogarse sobre el cmo del poder consiste en limitarse a describir sus efectos sin ponerlos nunca en relacin con una naturaleza ni con sus causas. Esto significa transformar este poder en una sustancia misteriosa a la que se cuidan de interrogar, seguramente por que prefieren no ponerla en tela de juicio. Suponen que en todo este engranaje existe un fatalismo del cual no se ofrece explicacin alguna. Pero, acaso su desconfianza no muestra que incluso ellos mismos suponen que el Poder es algo que existe con su origen, por un lado, su naturaleza, por el otro, y, por ltimo, sus manifestaciones? Si concedo, por mi parte, un privilegio provisional a la cuestin del cmo, no es porque quiera eliminar la cuestin del qu y del por qu. Es tan slo para plantearlas de otra manera; o mejor, para saber si es legtimo imaginar un Poder al cual se una un qu, un por qu, un cmo. Para expresarlo de manera tajante, se puede decir que iniciar el anlisis por el cmo es introducir la sospecha de que el Poder no existe; en todo caso es preguntarse qu contenidos asignables puede uno descubrir cuando se usa este trmino majestuoso, globalizante y sustantificador; es sospechar que se deja escapar un conjunto de realidades demasiado complejas cuando uno se estanca indefinidamente ante la doble interrogante: qu es el Poder? De dnde viene el Poder? La pregunta tan llana y emprica cmo es? utilizada para explorar el terreno no tiene como funcin el obligar a aceptar de manera fraudulenta una 'metafsica o una ontologa del poder; sino intentar hacer una investigacin crtica en la temtica del poder. 1. Cmo?, no en el sentido de cmo se manifiesta?, sino cmo se ejerce?, qu sucede cuando unas personas ejercen su poder sobre otras? Primeramente es necesario diferenciar este poder de aquel que se ejerce sobre las cosas y que da la capacidad de modificarlas, de utilizarlas, de consumirlas, de destruirlas un poder que remite a aptitudes directamente inscritas en el cuerpo o mediatizadas por instrumentos. En este caso se trata de capacidad. En cambio, lo que caracteriza al poder que nosotros analizamos es que pone en juego relaciones entre personas (o entre grupos). No hay que engaarse: si se habla del poder de las leyes, de las instituciones o de las ideologas, si se habla de estructuras o de mecanismos de poder, slo es en la medida en que se supone que alguien ejerce un poder sobre otros. El trmino de poder designa relaciones entre miembros asociados (al decir esto no pienso en un sistema de juego; sino, simplemente, y permaneciendo por el momento en lo ms general, en un conjunto de acciones que se inducen y que responden unas a otras). Tambin es necesario diferenciar las relaciones de poder de las relaciones de comunicacin que transmiten una informacin a travs de una lengua, de un sistema de signos o de cualquier otro medio simblico. Comunicar siempre es, sin lugar a dudas, una determinada manera de actuar sobre el otro o los otros. Pero la produccin y el poner en circulacin elementos significantes puede tener tambin por objetivo, o como consecuencia, ciertos efectos de poder que no son simplemente un aspecto de los primeros. Las relaciones de poder tienen su especificidad, pasen o no por sistemas de comunicacin. Por lo tanto, no se debe confundir relaciones de poder, relaciones de comunicacin, capacidades objetivas. Lo cual no quiere decir que se trata de tres terrenos separados; y que por un lado existe el terreno de las cosas, de la tcnica dotada de un fin, del trabajo y de la transformacin de la realidad; del otro, el terreno de los signos, de la comunicacin, de la reciprocidad y de la fabricacin del sentido; y, por ltimo, el de la dominacin de los medios de coercin de la desigualdad y de la accin de los hombres sobre los hombres. 4 Se trata de tres tipos de relacin que, de hecho, estn siempre imbricados, dndose un apoyo recproco y sirvindose de instrumentos mutuamente. El empleo de capacidades objetivas en sus formas ms elementales implica relaciones de comunicacin (ya sea que se trate de informacin previa o de trabajo compartido); tambin est ligado a relaciones de poder (ya sea que se trate de tareas obligatorias, de actitudes impuestas por una tradicin o por un aprendizaje, de subdivisiones o de distribucin ms o menos obligatoria de trabajo). Las relaciones de comunicacin implican actividades dotadas de un fin (aunque slo sea la utilizacin correcta de elementos significantes) y producen efectos de poder por el slo hecho de que modifican el campo informativo de quienes participan en ella. Por su parte, las relaciones de poder se ejercer, en una medida extremadamente importante, a travs de la produccin y el intercambio de signos; y tampoco se pueden disociar las actividades dotadas de un fin, ya sea que se trate de las que permiten ejercer ese poder (como las tcnicas de amaestramiento, los procedimientos de dominacin, las maneras de obtener la
Cuando Habermas distingue dominacin, comunicacin y actividad dotada de un fin, no las concibe, en mi opinin, como tres territorios diferentes, sino como tres trascendentales.
4

7
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

114

obediencia) o las que son necesarias para que se lleven a cabo relaciones de poder (como en la divisin del trabajo y la jerarqua de las tareas). Evidentemente, la coordinacin entre estos tres tipos de relaciones no es uniforme ni constante. En ninguna sociedad hay un tipo general de equilibrio entre las actividades dotadas de un fin, los sistemas de comunicacin y las relaciones de poder. Ms bien existen diversas formas, diversos lugares, diversas circunstancias u ocasiones en las que estas interrelaciones se establecen segn un modelo especfico. Pero tambin existen bloques en los cuales el ajuste de capacidades, las redes de comunicacin y las relaciones de poder constituyen sistemas regulados y concertados. Sirva de ejemplo una institucin escolar: su disposicin espacial, el reglamento meticuloso que rige su vida interna, las diferentes actividades que se organizan en ella, los diversos personajes que viven o se renen all, cada uno con una funcin, un lugar, un rostro bien definido todo esto constituye un bloque de capacidad-comunicacin-poder. La actividad que permite el aprendizaje y la adquisicin de las aptitudes o de los tipos de comportamiento se desarrolla a travs de todo un conjunto de comunicaciones ordenadas (clases, preguntas y respuesta, rdenes, exhortaciones, signos codificados de obediencia, signos que permiten distinguir el valor de cada uno, y de los niveles de saber) y a travs de toda una serie de procedimientos de poder (vigilancia, recompensa y castigo, jerarqua piramidal, el hecho de que. sea una organizacin cerrada). Estos bloques en los que el uso de capacidades tcnicas, el juego de las comunicaciones y las relaciones de poder se ajustan unas a otras, de acuerdo con frmulas pensada, constituyen lo que se puede llamar, ampliando un poco el sentido del trmino, disciplinas. El anlisis emprico de algunas disciplinas tal y como se constituyeron histricamente presenta por eso mismo cierto inters. Ante todo porque las disciplinas muestran, de acuerdo con esquemas artificialmente claros y decantados, la manera en que los sistemas de finalidad objetiva, de comunicaciones y de poder pueden articularse unos con otros. Tambin porque muestran diferentes modelos de articulaciones (ya con supremaca de las relaciones de poder y obediencia, como en las disciplinas ele tipo monstico o de tipo penitenciario; ya con supremaca de actividades dotadas de un fin como en las disciplinas de talleres o de hospitales; ya con supremaca de las relaciones de comunicacin, como en el caso de la disciplinas de aprendizaje, ya incluso con una saturacin de los tres tipos de relaciones como en la disciplina militar en la que una pltora de signos marca hasta la redundancia relaciones de poder rigurosa y cuidadosamente calculadas para procurar un cierto nmero de efectos tcnicos). Por disciplinarizacin de las sociedades en Europa desde el siglo XVIII ciertamente no debe entenderse que los individuos se hayan vuelto cada vez ms obedientes, ni que, tengan cierta semejanza con cuarteles, escuelas o crceles; sino que en ellas se ha buscado un ajuste cada vez mejor controlado cada vez ms racional y econmico entre las actividades productivas, las redes de comunicacin y el juego de relaciones de poder. Por lo tanto, abordar el tema del poder a travs de un anlisis del cmo significa efectuar diversos desplazamientos crticos en relacin con el hecho de suponer un poder fundamental. Es poner como objeto de anlisis relaciones de poder y no un poder; relaciones de poder que son distintas de las capacidades objetivas tanto corno de las relaciones de comunicacin; relaciones de poder que se pueden captar en la diversidad de su encadenamiento con esas capacidades y esas comunicaciones.

2. En qu consiste la especificidad de las relaciones de poder? El ejercicio del poder no es simplemente una relacin entre miembros individuales o colectivos; es un modo de accin de unos sobre otros. Lo cual quiere decir, evidentemente, que no existe algo como el Poder o cierto poder que pudiera existir globalmente, en bloque o difusamente, concentrado o distribuido: slo existe el poder que ejercen unos sobre otros; el poder existe nicamente en acto, incluso si ste se inscribe en un campo de posibilidad disperso que se apoya en estructuras permanentes. Esto quiere decir tambin que el poder no pertenece al orden del consentimiento; en s mismo no es renuncia a una libertad, transferencia de derecho, poder de cada uno de los miembros delegado en algunos (lo cual no impide que el consentimiento pueda ser una condicin para que la relacin de poder exista y se mantenga); la relacin de poder puede ser el efecto de un consentimiento anterior o permanente; no est en su naturaleza propia la manifestacin de un consenso. Quiere esto decir que es preciso buscar el carcter propio de las relaciones de poder del lado de una violencia que sera su forma primitiva, su secreto permanente y su ltimo recurso lo cual aparece en ltima instancia como su verdad, cuando se ve obligado a quitarse la mscara y a mostrarse tal como es? De hecho, lo que define una relacin de poder es un modo de accin que no acta directa e inmediatamente sobre los 8
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

115

otros, sino que acta sobre su propia accin. Una accin sobre la accin, sobre acciones eventuales o concretas, futuras o presentes. Una relacin de violencia acta sobre un cuerpo, sobre cosas: fuerza, doblega, quiebra, destruye; contiene todas las posibilidades. Por lo tanto, no tiene cerca de ella otro polo que el de la pasividad; y si encuentra resistencia no tiene ms remedio que reducirla. Por el contrario, una relacin de poder se articula sobre dos elementos que le son indispensables para que sea justamente una relacin de poder: que el otro (aquel sobre el cual se ejerce) sea reconocido y permanezca hasta el final como sujeto de la accin; y que se abra ante la relacin de poder todo un campo de repuestas, reacciones, efectos, invenciones posibles. Es obvio que hacer uso de relaciones de poder no es exclusivamente emplear la violencia u obtener el consentimiento. Sin duda alguna, ningn ejercicio del poder puede prescindir de uno o de otro, y con frecuencia de ninguno de los dos. Pero aunque constituyen sus instrumentos o sus efectos, no por ello se puede decir que sean su principio o su naturaleza. El ejercicio del poder puede suscitar toda la aceptacin que se quiera: puede acumular los muertos y protegerse detrs de todas las amenazas que pueda imaginar. En s mismo no es una violencia que en ocasiones logra ocultarse ni un consentimiento que renueva su vigencia implcitamente. Es un conjunto de acciones sobre acciones posibles: opera en el terreno de la posibilidad al cual se inscribe el comportamiento de los sujetos que actan: incita, induce, desva, facilita o dificulta, ampla o limita, hace que las cosas sean ms o memos probables: en ltima instancia obliga o impide terminantemente; pero siempre es una manera de actuar sobre uno o sobre varios sujetos activos, y ello mientras stos actan o son susceptibles de actuar. Una accin sobre acciones. El trmino de conduite, 5 incluso con el equvoco que encierra, quiz sea uno de los que mejor permiten captar lo especfico de las relaciones de poder. La conduite es tanto el acto de llevar a los otros (de acuerdo con mecanismos de coercin ms o menos estrictos) y la manera de comportarse en un terreno ms o menos abierto de posibilidades. El ejercicio del poder consiste en conducir conductas y en preparar la probabilidad. En el fondo, el poder se encuentra menos en el orden del enfrentamiento entre dos adversarios o en el compromiso de uno frente a otro, que en el orden del gobierno. Hay que dejar a este trmino el amplio significado que tena en el siglo XVII. No slo se refera a estructuras polticas y a la administracin de los Estados; sino que designaba la manera de dirigir la conducta de personas o de grupos: gobierno de los nios, de las almas, de las comunidades, de las familias, de los enfermos. No slo inclua formas instituidas y legtimas de sujecin poltica o econmica; sino modos de accin ms o meros pensados y calculados, destinados todos a actuar sobre las posibilidades de accin de otros individuos. En este sentido, gobernar es estructurar el campo de accin eventual de otros. Por lo tanto, el modo de relacin propio del poder no debe buscarse del lado de la violencia o de la lucha, ni del lado del contrato o del nexo voluntario (que a lo sumo pueden ser slo instrumentos); sino del lado de ese modo de accin singular ni blico ni jurdico que es el gobierno. Cuando se define el ejercicio del poder como un modo de accin sobre las acciones de los otros, citando se le caracteriza como el gobierno de unos hombres sobre otros en el sentido ms amplio de esta palabra se debe incluir un elemento importante; la libertad. El poder slo se ejerce sobre sujetos libres y mientras son libres por ello entendemos sujetos individuales o colectivos que tienen frente a s un campo de posibilidad en el cual pueden dar diversas conductas, diversas reacciones y diversos modos de comportamiento. Cuando las determinaciones estn saturadas, no existe relacin de poder; la esclavitud no es una relacin de poder cuando el hombre est encadenado (en este caso se trata de tata relacin fsica de coercin), sino cuando ste puede desplazarse, y en ltima instancia escaparse. Por lo tanto, no hay un enfrentamiento de poder y libertad, ni stos mantienen una relacin de exclusin (cada vez que se ejerce poder, desaparece la libertad), sino un juego mucho ms complejo: en ese juego, la libertad aparece efectivamente como condicin de existencia del poder (es tanto condicin previa, ya que es necesario que exista libertad para que se ejerza el poder; tanto como su apoyo permanente, ya que si se sustrajera por completo al poder que se ejerce sobre ella, ste desaparecera inmediatamente y tendra que buscar un sustituto en la coercin pura y llana de la violencia); pero, al mismo tiempo, la libertad tiene que presentar una oposicin a un ejercicio del poder que en ltima instancia tiene a determinarla enteramente. Por lo tanto, no se puede separar la relacin de poder y la insumisin de la libertad. La servidumbre voluntaria no es el problema central del poder (cmo podramos desear ser esclavos?): la tenaz resistencia de la voluntad y la intransitividad de la libertad se encuentran en el centro de la relacin de poder y sin cesar la provocan. Sera ms conveniente hablar de un agonismo (de una relacin que es de lucha y de

El trmino conduite, significa al mismo tiempo conduccin y conducta, homnimos que no era posible conservar en espaol. [N. del T.]

9
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

116

incitacin recproca al mismo tiempo), que de un antagonismo esencial; de una provocacin permanente, que de una oposicin que los asla en su enfrentamiento.

3. Cmo analizar la relacin de poder? Se puede mejor dicho, es perfectamente legtimo analizarla en instituciones bien determinadas. stas constituyen un observatorio privilegiado para captarlas diversificadas, concentradas, ordenadas y, al parecer, llevadas a su ms alto grado de eficacia. Como una primera aproximacin, se podra esperar que en ellas apareciera la forma y la lgica de sus mecanismos elementales. Sin embargo, el anlisis de las relaciones de poder en espacios institucionales cerrados presenta algunos inconvenientes. En primer lugar, el hecho de que una parte importante de los mecanismos empleados por su institucin tiene como objetivo asegurar su propia conservacin, comporta el riesgo de descifrar funciones esencialmente reproductoras, sobre todo en las relaciones de poder intra-institucionales. En segundo lugar, al analizar las relaciones de poder a partir de instituciones uno se expone a buscar en stas la explicacin y el origen de aqullas, es decir, a explicar al poder por el poder. Por ltimo, exista el riesgo de ver en las relaciones de poder nicamente modulaciones de la ley y de la coercin, en la medida en que las instituciones actan esencialmente a travs del empleo de dos elementos: reglas (explcitas o implcitas) y un aparato que corre el riesgo de otorgarles un privilegio exagerado en la relacin de poder. No se trata de negar la importancia de las instituciones en la disposicin de las relaciones de poder, sino de sugerir que ms bien es necesario analizar las instituciones a partir de las relaciones de poder y no lo contrario, y que el lugar fundamental donde se asientan stas debe ser buscado en otro sitio, aun cuando tornen forma y se cristalicen en una institucin. Recordemos la definicin que afirma que el ejercicio del poder es una manera para algunos de estructurar el campo posible ele accin de otros. De esta forma, lo propio de una relacin de poder es que es un modo de accin sobre otras acciones; es decir, que las relaciones de poder se arraigan profundamente en la trama social y que no forman por encima de la sociedad una estructura suplementaria, cuya desaparicin radical podra pensarse eventualmente. De todos modos, vivir en sociedad es vivir de tal manera que sea posible actuar sobre la accin de los otros. Una sociedad sin relaciones de poder no es ms que una abstraccin. Lo cual, sea dicho de paso, hace, desde un punto de vista poltico, mucho ms necesario el anlisis de su significado en una sociedad determinada, de su formacin histrica, de lo que les da solidez o las vuelve frgiles, de las condiciones que son necesarias para que unas se transformen y otras desaparezcan. Pues decir que no puede existir sociedad alguna sin relaciones de poder no quiere decir que las que existen sean necesarias, ni que de todas maneras el Poder constituye una fatalidad indefinible en el interior de las sociedades; sino que el anlisis, la elaboracin, el cuestionamiento de las relaciones de poder y del agonismo entre las relaciones de poder y la intransitividad de la libertad es una tarea poltica incesante y que esto es incluso la tarea poltica inherente a toda existencia social. Concretamente, el anlisis de las relaciones de poder exige que se establezca un cierto nmero de puntos: 1. El sistema de diferenciaciones que permite actuar sobre la accin de los dems: diferencias jurdicas o tradicionales, de estatus y de privilegios; diferencias econmicas en la apropiacin de las riquezas y de los bienes; diferencias de puesto en los procesos de produccin; diferencias lingsticas o culturales; diferencias en el savoir faire y las aptitudes, etc. Toda relacin de poder utiliza diferenciaciones que para ella constituyen al mismo tiempo condiciones y efectos. 2. El tipo de objetivos que persiguen aquellos que actan sobre la accin de los dems: conservacin de privilegios, acumulacin de ganancias, utilizacin de autoridad estatutaria, ejercicio de una funcin o de un oficio. 3. Las modalidades instrumentales: el poder puede ser ejercido a travs de la amenaza, de las armas, de los efectos de la palabra, de las disparidades econmicas, de los mecanismos ms o menos complejos de control, por sistemas de vigilancia, con o sin archivos, de acuerdo con reglas explcitas o no, permanentes o modificables, con o sin dispositivos materiales, etctera. 4. Las formas de institucionalizacin: stas pueden conjugar disposiciones tradicionales, estructuras jurdicas, fenmenos de costumbre o de moda (como se observa en las relaciones de poder que presenta la institucin familiar); tambin pueden adoptar el aspecto de un dispositivo cerrado sobre s mismo con sus lugares especficos, sus reglamentos propios, sus estructuras jerrquicas cuidadosamente definidas, y una relativa autonoma funcional (ejemplo de ellas son las instituciones escolares o militares); tambin pueden conformar sistemas muy complejos provistos de mltiples mecanismos, como en el caso del Estado que tiene 10
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

117

como funcin ser la envoltura general, la instancia de control global, el principio de regulacin y, tambin en cierta medida, de distribucin de todas las relaciones de poder en un conjunto social determinado. 5. Los grados de racionalizacin: ya que el empleo de relaciones de poder como accin sobre el campo de posibilidad puede ser ms o menos elaborado en funcin de la eficacia de los instrumentos y de la certeza del resultado (refinamientos tecnolgicos ms o menos grandes en el ejercicio del poder) o incluso en funcin del eventual costo (bien se trate del costo econmico de los medios empleados o del costo reaccional constituido por las resistencias que se presentan). El ejercicio del poder no es un hecho en bruto, un elemento institucional ni una estructura que se mantiene o que se rompe: se elabora, se transforma, se organiza, adquiere procedimientos adecuados. Ahora se entiende por qu el anlisis de las relaciones de poder en una sociedad no puede limitarse al estudio de una serie de instituciones, ni siquiera al estudio de todas aquellas que merecen el nombre de poltica. Las relaciones de poder se arraigan en el conjunto de la trama social. Sin embargo, esto no quiere decir que existe un principio de Poder, primitivo y fundamental, que domina hasta el ltimo elemento de la sociedad; sino que se definen formas diferentes de poder a partir de esta posibilidad de accin sobre la accin de los dems que es coextensiva a toda relacin social, de las formas mltiples de disparidad individual, de objetivos, de instrumentaciones que se ofrecen a los dems o a nosotros, de institucionalizacin ms o menos sectorial o global, de organizacin ms o menos pensada. Las formas y los lugares de gobierno de unos hombres por otros son mltiples en una sociedad: se superponen, se entrecruzan, se limitan, a veces se anulan y en otros casos se refuerzan. Es un hecho que el Estado en las sociedades contemporneas no es simplemente una de las formas o de los lugares aunque sea el ms importante del ejercicio del poder, sino que, de cierta forma, todos los otros tipos de relacin de poder se refieren a l. Pero no es porque deriven de l. Ms bien porque se ha producido una estatizacin continua de las relaciones de poder (aunque en el orden jurdico, pedaggico, econmico, familiar no haya adoptado la misma forma). Se podra afirmar, al referirse al sentido limitado del trmino gobierno, que las relaciones de poder han sido progresivamente gubernamentalizadas, es decir, elaboradas, racionalizadas y centralizadas en la forma o bajo la proteccin de las instituciones estatales.

4. Relaciones de poder .y relaciones estratgicas El trmino estrategia usualmente se utiliza en tres acepciones. En primer lugar para designar la eleccin de medios que se usan para llegar a una meta; se trata de la racionalidad empleada para alcanzar un objetivo. En segundo lugar, para designar la manera en la que una persona acta en un acto determinado en funcin de lo que estima que debe ser la accin de los dems y de lo que juzga que los dems pensarn de cmo debe ser la suya. En resumen, en la que se trata de tener influencia sobre los dems. Por ltimo, para designar el conjunto de procedimientos utilizados en un enfrentamiento para privar al adversario de sus medios de combate y obligarlo a renunciar a la lucha. En este caso, se trata de los medios que tienen por objetivo la victoria. Estos tres significados se renen en las situaciones de enfrentamiento guerra o juego en las cuales la finalidad es actuar sobre un adversario de tal manera que la lucha sea imposible para l. La estrategia se define entonces por la eleccin de las soluciones ganadoras. Pero es preciso tener presente que este caso es una situacin muy particular y que existen otras en las que es necesario conservar la distincin entre los diferentes sentidos de la palabra estrategia. Haciendo referencia al primer sentido indicado se puede llamar estrategia de poder al conjunto de medios utilizados para hacer funcionar o para mantener un dispositivo de poder. Tambin se puede hablar de estrategia propia de las relaciones de poder en la medida en que stas constituyen modos de accin sobre la accin posible, eventual, hipottica de los otros. Por lo tanto, se puede descifrar en trminos de estrategias los mecanismos empleados en las relaciones de poder. Pero lo ms importante es, evidentemente, el nexo entre las relaciones de poder y las estrategias de enfrentamiento. Ya que si es cierto que hay una insumisin y libertades esencialmente reluctantes en el centro de las relaciones de poder, y que son condicin permanente de su existencia, no hay relacin de poder sin resistencia, sin escapatoria o huida, sin eventual capitulacin. Por lo tanto, toda relacin de poder implica, por lo menos de manera virtual, una estrategia de lucha, sin que por ello se superpongan, pierdan su especificidad y finalmente se confundan. Una constituye para la otra una especie de lmite permanente, un punto de capitulacin posible. Una relacin de enfrentamiento llega a su trmino, a su momento final (y a la victoria de uno de los dos adversarios) cuando en el juego de las relaciones antagonistas se substituyen los mecanismos estables a travs de los cuales se puede dirigir la conducta de los dems con cierta constancia y con la suficiente certeza. Para una relacin de enfrentamiento, en vista de que no es una lucha a muerte, el establecimiento de una relacin de poder, 11
phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

118

constituye un punto de mira que al mismo tiempo que lo realiza, lo deja en suspenso. Para una relacin de poder, a su vez, la estrategia de lucha constituye tambin una frontera en la cual la induccin calculada de las conductas de los dems no puede ir ms all de la rplica a su propia accin. Ya no es posible que existan relaciones de poder sin puntos de insumisin que por definicin se les escapan; toda extensin de las relaciones de poder para someterlos slo pueden conducir a los lmites del ejercicio del poder; ste encuentra entonces su punto de contencin, ya sea en un tipo de accin que reduce a los dems a la impotencia total (una victoria sobre el adversario sustituye al ejercicio del poder), o bien es un cambio de los gobernantes que se transforman en adversarios. En resumen, toda la estrategia de enfrentamiento pretende convertirse en relacin de poder; y toda relacin de poder tiende, tanto si sigue su propia lnea de desarrollo como si encuentra resistencias frontales, a convertirse en estrategia vencedora. De hecho, existe atraccin recproca, encadenamiento indefinido y derrota perpetua entre relacin de poder y estrategia de lucha. La relacin de poder puede convertirse en todo momento, y en algunos se convierte efectivamente en un enfrentamiento entre adversarios. Asimismo, las relaciones de adversarios en una sociedad dan lugar, en cualquier momento, a la utilizacin de mecanismos de poder. Esta inestabilidad hace que se pueda disfrazar los mismos procesos, los mismos acontecimientos y las mismas transformaciones tanto en el interior de una historia de las luchas como en la de las relaciones y de los dispositivos del poder. No aparecern los mismos elementos significativos, ni los mismos encadenamientos, ni los mismos tipos de inteligibilidad, aunque se refieran a la misma trama histrica y aunque ambos anlisis se remitan mutuamente. Y es justamente la interferencia de las dos lecturas lo que hace evidentes estos fenmenos fundamentales de dominacin que presenta la historia de gran parte de las sociedades humanas. La dominacin es una estructura global de poder cuyas ramificaciones y consecuencias se pueden encontrar hasta en los ms sutiles nexos de la sociedad; pero al mismo tiempo es una situacin estratgica ms o menos adquirida y consolidada en un enfrentamiento de amplia duracin entre adversarios. Puede suceder que un hecho de dominacin slo sea la transcripcin de uno de los mecanismos de poder de una relacin de enfrentamiento y de sus consecuencias (una estructura poltica se deriva de una invasin); tambin puede ocurrir que una relacin de lucha entre dos adversarios sea efecto del desarrollo de las relaciones de poder con sus conflictos y las escisiones que trae como consecuencia. Pero un fenmeno central en la historia de las sociedades es que la dominacin de un grupo, de una casta, de una clase y las resistencias y las rebeliones a las que se enfrenta, revela con una forma global y compacta, que se encuentra en la escala de la sociedad en su conjunto el encadenamiento de las relaciones de poder con las relaciones estratgicas y sus efectos de causalidad recproca.

12
phylosajvg - @filodac

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

119

Slavoj iek
IDEOLOGA
UN MAPA DE LA CUESTIN

Introduccin
(fragmento)
Ideologa: el anlisis espectral de un concepto En todos estos anlisis ad hoc, sin embargo, ya hemos ejercido la crtica de la ideologa, mientras que nuestra pregunta inicial concerna al concepto de ideologa presupuesto en este ejercicio. Hasta ahora, nos hemos guiado por una precomprensin espontnea que, aunque nos llev a resultados contradictorios, no debe ser subestimada sino, por el contrario, desarrollada. Por ejemplo, implcitamente parecera que, de algn modo, sabemos lo que ya no es ideologa: mientras la Escuela de Francfort acept la crtica de la economa poltica como su base, permaneci dentro de las coordenadas de la crtica de la ideologa. En cambio, la nocin de razn instrumental ya no pertenece al horizonte de la crtica de la ideologa: la razn instrumental designa una actitud que no es simplemente funcional en relacin con la dominacin social sino, ms bien, acta como el fundamento mismo de la relacin de dominacin. 6 Una ideologa, entonces, no es necesariamente falsa: en cuanto a su contenido positivo, puede ser cierta, bastante precisa, puesto que lo que realmente importa no es el contenido afirmado como tal, sino el modo como este contenido se relaciona con la posicin subjetiva supuesta por su propio proceso de enunciacin. Estamos dentro del espacio ideolgico en sentido estricto desde el momento en que este contenido verdadero o falso (si es verdadero, mucho mejor para el efecto ideolgico) es funcional respecto de alguna relacin de dominacin social (poder, explotacin) de un modo no transparente: la lgica misma de la legitimacin de la relacin de dominacin debe permanecer oculta para ser efectiva. En otras palabras, el punto de partida de la crtica de la ideologa debe ser el reconocimiento pleno del hecho de que es muy fcil mentir con el ropaje de la verdad. Cuando, por ejemplo, una potencia occidental interviene en un pas del Tercer Mundo porque se conocen en ste violaciones de los derechos humanos, puede ser cierto que en este pas no se respetaron los derechos humanos
6

Por esa razn, los horizontes epocales de la precomprensin (el gran tema de la hermenutica) no pueden ser designados como ideologa. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

120

ms elementales y que la intervencin occidental puede ser eficaz en mejorar la situacin de los derechos humanos, y sin embargo, esa legitimacin sigue siendo ideolgica en la medida en que no menciona los verdaderos motivos de la intervencin (intereses econmicos, etc.). La forma ms notable de mentir con el ropaje de la verdad hoy es el cinismo: con una franqueza cautivadora, uno admite todo sin que este pleno reconocimiento de nuestros intereses de poder nos impida en absoluto continuar detrs de estos intereses. La frmula del cinismo ya no es la marxiana clsica ellos no lo saben, pero lo estn haciendo; es, en cambio, ellos saben muy bien lo que estn haciendo, y lo hacen de todos modos. Pero entonces, cmo podemos desarrollar nuestra precomprensin implcita? Cmo pasamos de la doxa a la verdad? El primer abordaje que se ofrece es, por supuesto, la transposicin histrico-dialctica hegeliana del problema en su propia solucin: en lugar de evaluar directamente la adecuacin o la verdad de las diferentes nociones de ideologa, uno debera leer esta multiplicidad misma de determinaciones de la ideologa como una seal de diferentes situaciones histricas concretas; es decir, uno debera considerar lo que Althusser, en su fase autocrtica, llamaba la topicalidad del pensamiento, la manera en que un pensamiento se inscribe en su objeto; o, como lo habra expresado Derrida, la manera en que el marco mismo es parte del contenido enmarcado. Cuando, por ejemplo, el leninismo-estalinismo adopt sbitamente el trmino ideologa proletaria a fines de la dcada de 1920, con el fin de designar no la distorsin de la conciencia proletaria bajo la presin de la ideologa burguesa, sino la propia fuerza subjetiva impulsora de la actividad revolucionaria del proletariado, este desplazamiento en la nocin de ideologa era estrictamente correlativo de la reinterpretacin del propio marxismo como una ciencia objetiva imparcial, como una ciencia que no contiene en s misma la posicin subjetiva proletaria: el marxismo primero, desde la distancia neutral del metalenguaje, se cerciora de la tendencia objetiva de la historia hacia el comunismo; luego, elabora la ideologa proletaria para inducir a la clase obrera a cumplir su misin histrica. Otro ejemplo de tal desplazamiento es el ya mencionado pasaje del marxismo occidental desde la crtica de la economa poltica hacia la crtica de la razn instrumental: desde Historia y conciencia de clase de Lukcs y la primera Escuela de Francfort, en la que la distorsin ideolgica se deriva de la forma de la mercanca, hasta la nocin de razn instrumental, que ya no se basa en una realidad social concreta sino que, en cambio, es concebida como una especie de constante primordial antropolgica, incluso cuasi trascendental, que nos permite explicar la realidad social de la dominacin y la explotacin. Este pasaje est enmarcado por la transicin desde el universo de la primera posguerra, en el que la esperanza en el resultado revolucionario de la crisis del capitalismo todava estaba viva, hacia el doble trauma de fines
SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

121

de la dcada de 1930 y la dcada de 1940: la regresin de las sociedades capitalistas hacia el fascismo y el giro totalitario del movimiento comunista.7 Sin embargo, un abordaje como se, aunque adecuado en su propio nivel, puede hacernos caer fcilmente en la trampa del relativismo historicista que suspende el valor cognitivo inherente del trmino ideologa y lo transforma en una mera expresin de las circunstancias sociales. Por esa razn, parece preferible comenzar con un abordaje diferente, sincrnico. En relacin con la religin (que, para Marx, era la ideologa por excelencia), Hegel distingua tres momentos: la doctrina, la creencia y el ritual; resulta tentador disponer la multitud de nociones asociadas al trmino ideologa alrededor de estos tres ejes: la ideologa como complejo de ideas (teoras, convicciones, creencias, procedimientos argumentativos); la ideologa en su apariencia externa, es decir, la materialidad de la ideologa, los Aparatos Ideolgicos de Estado (AIE); y, finalmente, el terreno ms elusivo, la ideologa espontnea que opera en el centro de la realidad social en s (es altamente cuestionable si el trmino ideologa es en alguna medida apropiado para designar este terreno: un buen ejemplo de esto es el hecho de que, en relacin con el fetichismo de la mercanca, Marx nunca haya utilizado el trmino ideologa). 8 Recordemos el caso del liberalismo: el liberalismo es una doctrina (desarrollada desde Locke hasta Hayek) materializada en rituales y aparatos (la prensa libre, las elecciones, el mercado, etc.) y activa en la experiencia espontnea (de s mismos) que los sujetos tienen como individuos libres. El orden de
7

Para una resea concisa de las consecuencias tericas de este doble trauma, vase Theodor W. Adorno, Mensajes en una botella, en este volumen. En cuanto a la forma en que la crtica del pensamiento identitario realizado por Adorno anuncia el deconstructivismo postestructuralista, vase Peter Dews, Adorno, el postestructuralismo y la crtica de la identidad, en este volumen. 8 En su libro La Philosophie de Marx (Pars, La Dcouverte, 1993; trad. esp.: La filosofa de Marx, Buenos Aires, Nueva Visin, 2000), tienne Balibar llam la atencin sobre el enigma que supone la completa desaparicin de la nocin de ideologa en los textos de Marx posteriores a 1850. En La ideologa alemana, la nocin (omnipresente) de ideologa se concibe como la quimera que complementa la produccin y la reproduccin sociales; la oposicin conceptual que funciona como su antecedente es la que distingue el proceso vital real y su reflejo distorsionado en las cabezas de los idelogos. Las cosas se complican, sin embargo, en el momento en que Marx aborda la crtica de la economa poltica: lo que encuentra aqu en la forma del fetichismo de la mercanca ya no es una ilusin que refleja la realidad, sino una extraa quimera que opera en el centro mismo del proceso real de produccin social. Un eclipse enigmtico similar puede ser detectado en muchos autores posmarxistas: Ernesto Laclau, por ejemplo, despus del uso casi inflacionario de ideologa en su Politics and Ideology in Marxist Theory: Capitalism, Fascism, Populism. (Londres, Verso, 1977; trad. esp.: Poltica e ideologa en la teora marxista. Capitalismo, fascismo, populismo, Madrid, Siglo XXI, 1978), renuncia por completo a l en Hegemony and Socialist Strategy (en coautora con Chantal Mouffe, Londres, Verso, 1985; trad. esp.: Hegemona y estrategia socialista. Hacia una radicalizacin de la democracia, Madrid, Siglo XXI, 1985). SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

122

las contribuciones de esta compilacin sigue esta lnea que, grosso modo, se adecua a la trada hegeliana en s -para s-en y para s. 9 Esta reconstruccin lgico-narrativa de la nocin de ideologa se centrar en el acontecimiento repetido de la transformacin de la no ideologa en ideologa: es decir, de la conciencia sbita de cmo el gesto mismo de apartarse de la ideologa nos arrastra nuevamente a su interior. 1. Entonces, para comenzar, tenemos a la ideologa en s: la nocin inmanente de la ideologa como una doctrina, un conjunto de ideas, creencias, conceptos y dems, destinado a convencernos de su verdad, y sin embargo al servicio de algn inters de poder inconfeso. El modo de la crtica de la ideologa que corresponde a esta nocin es el de lectura de sntomas: el objetivo de la crtica es descubrir la tendencia no confesada del texto oficial a travs de sus rupturas, sus espacios en blanco y sus deslices; descubrir en igualdad y libertad la igualdad y la libertad de los participantes del intercambio en el mercado que, por supuesto, privilegia al dueo de los medios de produccin, y as sucesivamente. Habermas, quizs el ltimo gran representante de esta tradicin, mide la distorsin y/o falsedad de una estructura ideolgica con el criterio de la argumentacin racional no coercitiva, una suerte de ideal regulador que, de acuerdo con l, es inherente al orden simblico como tal. La ideologa es una comunicacin distorsionada sistemticamente: un texto cuyo significado pblico oficial, bajo la influencia de intereses sociales (de dominacin, etc.) inconfesos, est abruptamente separado de su intencin real, es decir, un texto en el que nos enfrentamos a una tensin, sobre la que no se reflexiona, entre el contenido del texto explcitamente enunciado y sus presuposiciones pragmticas. 10 Hoy, sin embargo, la tendencia probablemente ms prestigiosa en la crtica de la ideologa, la que surgi del anlisis del discurso, invierte esta relacin: lo que la tradicin del Iluminismo descarta como una mera perturbacin de la comunicacin normal resulta ser su condicin positiva. El espacio intersubjetivo concreto de la comunicacin simblica est siempre estructurado por diversos dispositivos textuales (inconscientes) que no pueden reducirse a una retrica secundaria. Aqu no nos enfrentamos con un movimiento complementario del Iluminismo tradicional o del abordaje habermasiano, sino con su inversin inherente: lo que Habermas percibe como el apartamiento de la ideologa es
9

Para evitar un fatal malentendido, debemos insistir en que esta lnea de sucesin no debe leerse como un progreso jerrquico, como una negacin o supresin del modo precedente. Cuando, por ejemplo, abordamos la ideologa bajo el aspecto de los AIE, esto no implica de ninguna manera la obsolescencia o la irrelevancia del nivel de la argumentacin. Hoy, cuando la ideologa oficial se muestra cada vez ms indiferente hacia su propia coherencia, un anlisis de sus inconsistencias inherentes y constitutivas es crucial si queremos penetrar su autntico modo de funcionamiento. 10 Una presentacin ejemplar de la posicin habermasiana puede leerse en Seyla Benhabib, La crtica de la razn instrumental, en este volumen. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

123

denunciado aqu como ideologa por excelencia. En la tradicin iluminista, la ideologa representa la nocin velada (falsa) de la realidad surgida de diversos intereses patolgicos (el miedo a la muerte y a las fuerzas naturales, los intereses de poder, etc.); para el anlisis del discurso, la nocin misma de un acceso a la realidad sin el sesgo de dispositivos discursivos o conjunciones con el poder es ideolgica. El grado cero de la ideologa consiste en percibir (errneamente) una formacin discursiva como un hecho extradiscursivo. Ya en la dcada de 1950, en Mitologas, Roland Barthes propuso la nocin de ideologa como naturalizacin del orden simblico; esto es, como la percepcin que reifica los resultados de los procedimientos discursivos en propiedades de la cosa en s. La nocin de Paul de Man de la resistencia a la teora (deconstructivista) corre por los mismos carriles: la deconstruccin se encontr con esa resistencia porque desnaturaliza el contenido enunciado al sacar a la luz los procedimientos discursivos que engendran la evidencia del Sentido. Se puede argumentar que la versin ms elaborada de este abordaje es la teora de la argumentacin de Oswald Ducrot; aunque no emplea el trmino ideologa, su potencial ideolgico-crtico es enorme.11 La nocin bsica de Ducrot es que no se puede trazar una clara lnea de separacin entre los niveles descriptivo y argumentativo del lenguaje: no existe el contenido descriptivo neutral; toda descripcin (designacin) ya es un momento de algn esquema argumentativo; los predicados descriptivos mismos son, en definitiva, gestos argumentativos reificados/naturalizados. Esta arremetida argumentativa descansa en los topoi, en los lugares comunes que operan slo como naturalizados nicamente en la medida en que los aplicamos de un modo automtico, inconsciente; una argumentacin exitosa presupone la invisibilidad de los mecanismos que regulan su eficacia. Aqu tambin deberamos mencionar a Michel Pcheux, quien le imprimi un giro lingstico estricto a la teora althusseriana de la interpelacin. Su obra se centra en los mecanismos discursivos que generan la evidencia del Sentido. Es decir, una de las estratagemas fundamentales de la ideologa es la referencia a alguna certeza manifiesta: Mira, puedes ver por ti mismo cmo son las cosas!. Dejemos que los hechos hablen por s mismos es quizs el archienunciado de la ideologa: la cuestin es, precisamente, que los hechos nunca hablan por s mismos, sino que una red de dispositivos discursivos los hace hablar. Basta recordar la conocida pelcula antiabortista The Silent Scream [El grito silencioso]: all vemos a un feto que se defiende, que grita, etc.; y, sin embargo, lo que no vemos en este acto mismo de ver es que vemos todo esto contra el fondo de un espacio preconstruido discursivamente. La mayor fortaleza del anlisis
11

Vase Oswald Ducrot, Le dire et le dit, Pars, Minuit, 1986 [trad. esp.: El decir y lo dicho, Madrid, 1998]. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

124

del discurso reside, quiz, precisamente en la respuesta a esta pregunta: cuando un ingls racista dice Hay demasiados paquistanes en nuestras calles!, cmo desde qu lugar ve esto ? Es decir, qu hay en la estructuracin de su espacio simblico que lo haga percibir como un exceso perturbador el hecho de que un paquistan camine por una calle de Londres? En otras palabras, aqu debemos tener presente el lema de Lacan de que nada falta en lo real: toda percepcin de una falta o un exceso (demasiado poco de esto, demasiado de aqullo) siempre supone un universo simblico.12 Mencionemos, finalmente, a Ernesto Laclau y su abordaje innovador del fascismo y el populismo, cuyo resultado terico principal es que el significado no es inherente a los elementos de una ideologa como tal, sino que estos elementos funcionan, ms bien, como significantes flotantes cuyo significado es fijado por el modo de su articulacin hegemnica.13 La ecologa, por ejemplo, no es nunca la ecologa como tal; siempre est incluida en una cadena especfica de equivalencias: puede ser conservadora (cuando aboga por el retorno a las comunidades rurales equilibradas y a modos tradicionales de vida), estatista (slo una fuerte regulacin del Estado nos salvar de la catstrofe que se cierne sobre nosotros), socialista (la causa ltima de los problemas ecolgicos reside en la explotacin capitalista de los recursos naturales, orientada hacia el lucro), capitalista liberal (deberamos incluir en el precio del producto el dao provocado contra el ambiente, y dejar as que el mercado regule el equilibrio ecolgico), feminista (la explotacin de la naturaleza se deriva de la actitud masculina de dominacin), anarquista autogestiva (la humanidad podr sobrevivir slo si se reorganiza en pequeas comunidades autosuficientes que vivan en equilibrio con la naturaleza), y as sucesivamente. La cuestin, por supuesto, es que ninguna de estas cadenas de equivalencias es, en s misma, verdadera, ninguna est inscrita en la naturaleza misma de la problemtica ecolgica: cul de los discursos logre apropiarse de la ecologa depender de la lucha por la hegemona discursiva, cuyo resultado no est garantizado por ninguna necesidad subyacente o alianza natural. La otra consecuencia inevitable de la nocin de articulacin hegemnica es que ya sea estatista, conservadora, socialista, etc., la inscripcin de la ecologa no designa una connotacin secundaria que complemente su significado literal primario; como lo habra formulado Derrida, este complemento (re)define retroactivamente la naturaleza misma de la identidad literal:
12

Vase Michel Pcheux, El mecanismo del reconocimiento ideolgico, en este volumen. Aqu debe recordarse que la fuente clave de la crtica de las evidencias ideolgicas en el anlisis del discurso es El estadio del espejo como formador de la funcin del yo (je) tal como se nos revela en la experiencia psicoanaltica de Jacques Lacan (en este volumen), texto que introdujo el concepto de reconocimiento [reconnaissance] como desconocimiento [mconnaissance]. 13 Vase E. Laclau, Politics and Ideology, ob. cit. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

125

una cadena conservadora, por ejemplo, arroja luz especficamente sobre la problemtica ecolgica en s (debido a su falsa arrogancia, el hombre abandon sus races en el orden natural, etc.). 2. Lo que sigue es el paso del en s al para s , a la ideologa en su exteriorizacin/otredad: el momento sintetizado por la nocin althusseriana de AIE que designa la existencia material de la ideologa en prcticas ideolgicas, rituales e instituciones.14 La creencia religiosa, por ejemplo, no es meramente ni siquiera principalmente una conviccin interna, pero la Iglesia como institucin y sus rituales (la oracin, el bautismo, la confirmacin, la confesin) lejos de ser una mera exteriorizacin secundaria de la creencia interna, corresponden a los mecanismos mismos que la generan. Cuando Althusser repite, citando a Pascal, acta como si creyeras, ora, arrodllate, y creers, la fe vendr por s sola, delinea un mecanismo reflexivo intrincado de fundamentacin autopoitica retroactiva que excede de lejos la afirmacin reduccionista de que la creencia interna depende de la conducta externa. Es decir, la lgica implcita de su argumento es la siguiente: arrodllate y creers que te arrodillaste a causa de tu creencia; o sea, respetar el ritual es una expresin/efecto de tu creencia interna; en resumen, el ritual externo genera performativamente su propio fundamento ideolgico.15 Aqu volvemos a encontrar la regresin hacia la ideologa en el momento mismo en que nos hemos alejado aparentemente de ella. Con respecto a este punto, la relacin entre Althusser y Foucault presenta un inters especial. Los equivalentes foucaultianos de los AIE son los procedimientos disciplinarios que operan en el nivel del micropoder y designan el punto en el que el poder se inscribe directamente en el cuerpo, pasando por alto la ideologa : por esa precisa razn, Foucault nunca utiliza el trmino ideologa para referirse a estos mecanismos de micropoder. Este abandono de la problemtica de la ideologa produce una debilidad fatal en la teora de Foucault. Foucault nunca se cansa de repetir cmo el poder se constituye a s mismo desde abajo, cmo no emana de una nica cspide: esta apariencia misma de una Cspide (el Monarca u otra encarnacin de la Soberana) emerge como el efecto secundario de la pluralidad de microprcticas, de la compleja red de sus interrelaciones. Sin embargo, cuando se ve obligado a exponer el mecanismo concreto de esta emergencia, Foucault recurre a la muy
14

Vase Louis Althusser, Ideologa y Aparatos Ideolgicos de Estado, en este volumen. 15 Aqu reside la interrelacin entre el ritual que corresponde a los AIE y el acto de interpelacin: cuando creo que me he arrodillado a causa de mi creencia, simultneamente me reconozco en el llamado del Dios-Otro que me orden arrodillarme. Este punto fue desarrollado por Isolde Charim en su intervencin Dressur und Verneinung, en el coloquio Der Althusser-Effekt, Viena, 17 al 20 de marzo de 1994. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

126

sospechosa retrica de la complejidad, evocando la intrincada red de vnculos laterales, izquierda y derecha, arriba y abajo... Est claro que Foucault est tratando de tapar agujeros, ya que nunca se puede llegar al Poder de esta manera; el abismo que separa los microprocedimientos del espectro del Poder no puede ser franqueado. La ventaja de Althusser sobre Foucault parece evidente; Althusser avanza exactamente en la direccin contraria: desde el principio, concibe estos microprocedimientos como parte de los AIE; es decir, como mecanismos que, para ser operativos, para apropiarse del individuo, suponen siempre-ya la presencia masiva del Estado, la relacin transferencial del individuo con el poder del Estado, o en trminos de Althusser con el gran Otro ideolgico en el que se origina la interpelacin. Este desplazamiento althusseriano del nfasis de la ideologa en s a su existencia material en los AIE mostr su fecundidad en un nuevo abordaje del fascismo: la crtica que Wolfgang Fritz Haug le hace a Adorno es un buen ejemplo de esto. Adorno se niega a tratar el fascismo como una ideologa en el sentido propio del trmino, esto es, como legitimacin racional del orden existente. La llamada ideologa fascista ya no posee la coherencia de una construccin racional que requiere el anlisis conceptual y la refutacin ideolgico-crtica; es decir, ya no funciona como una mentira experimentada necesariamente como la verdad (el signo de reconocimiento de una verdadera ideologa). La ideologa fascista no es tomada en serio siquiera por sus promotores; su estatuto es puramente instrumental, y en definitiva, depende de la coercin externa.16 En su respuesta a Adorno, sin embargo, Haug demuestra en forma triunfal cmo esta capitulacin ante la primaca de la doctrina, lejos de implicar el fin de la ideologa, afirma el gesto fundador de lo ideolgico como tal: el llamado a la subordinacin incondicional y al sacrificio irracional.17 Lo que la crtica liberal percibe (errneamente) como la debilidad del fascismo es el recurso mismo de su fortaleza: dentro del horizonte fascista, incluso el reclamo de una argumentacin racional que proporcionara las bases para nuestra aceptacin de la autoridad es denunciado de antemano como una seal de degeneracin liberal del verdadero espritu de sacrificio tico; como lo formula Haug, al hojear los textos de Mussolini, no se puede evitar el extrao sentimiento de que Mussolini haba ledo a Althusser! La denuncia directa de la nocin fascista de la comunidad del pueblo [Volksgemeinschaft] como un seuelo engaoso que oculta la realidad de la dominacin y la explotacin no tiene en cuenta el hecho crucial de que esta Volksgemeinschaft se materializaba en una serie de rituales y prcticas (no slo concentraciones y desfiles masivos, sino tambin campaas de
16

Vase Theodor W. Adorno, Beitrag zur Ideologienlehre, en: Gesammelte Schriften: Ideologie, Francfort, Suhrkamp, 1972. 17 Vase Wolfgang Fritz Haug, Annherung an die faschistische Modalitt des Ideologischen, en: Faschismus und Ideologie 1, Argument-Sonderband 60, Berln, Argument Verlag, 1980. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

127

gran escala para ayudar a los hambrientos, deportes organizados y actividades culturales para los trabajadores, etc.) que produjeron performativamente el efecto de Volksgemeinschaft.18 3. En el paso siguiente de nuestra reconstruccin, esta exteriorizacin parece reflejarse sobre s misma: lo que se produce es la desintegracin, la autolimitacin y la autodispersin de la nocin de ideologa. La ideologa ya no se concibe como un mecanismo homogneo que garantiza la reproduccin social, como el cemento de la sociedad; se transforma en una familia wittgensteiniana de procedimientos heterogneos y relacionados vagamente unos con otros cuyo alcance es estrictamente localizado. En esta lnea, los crticos de la llamada Tesis de la Ideologa Dominante (TID) intentan demostrar que una ideologa o bien ejerce una influencia crucial pero restringida a algn estrato social limitado, o bien su papel en la reproduccin social es marginal. En los inicios del capitalismo, por ejemplo, el papel de la tica protestante del trabajo duro como un fin en s mismo y dems se limitaba al estrato de los capitalistas emergentes, mientras que los trabajadores y los campesinos, as como las clases altas, continuaban obedeciendo a otras actitudes ticas, ms tradicionales, de modo que de ninguna manera se le puede atribuir a la tica protestante la funcin de cemento de toda la estructura social. Hoy, en el capitalismo tardo, cuando la expansin de los nuevos medios masivos, en principio al menos, permite que la ideologa penetre eficazmente en cada poro del cuerpo social, el peso de la ideologa como tal ha disminuido: los individuos no actan como lo hacen a causa fundamentalmente de sus creencias o convicciones ideolgicas; es decir, el sistema, en su mayor parte, prescinde de la ideologa para su reproduccin y se sostiene, en cambio, en la coercin econmica, las regulaciones legales y estatales, y otros mecanismos. 19 Aqu, sin embargo, las cosas vuelven a confundirse, porque en el momento en que miramos ms de cerca estos mecanismos supuestamente extraideolgicos que regulan la reproduccin social, nos encontramos hundidos hasta las rodillas en ese oscuro terreno que mencionamos, en el que la realidad es indistinguible de la ideologa. Lo
18

El anlisis del discurso y la reconceptualizacin althusseriana de la ideologa tambin habilitaron un nuevo abordaje de los estudios feministas. Sus dos casos representativos son el anlisis del discurso posmarxista de Michle Barrett (vase su trabajo Ideologa, poltica, hegemona: de Gramsci a Laclau y Mouffe, en este volumen) y el deconstructivismo pragmtico de Richard Rorty (vase su trabajo Feminismo, ideologa y deconstruccin: una perspectiva pragmatista, en este volumen). 19 Vanse Nicholas Abercrombie, Stephen Hill y Bryan S. Turner, Determinacin e indeterminacin en la teora de la ideologa, y la respuesta crtica de Gran Therborn, Las nuevas cuestiones de la subjetividad, ambos en este volumen. Para una visin general del desarrollo histrico del concepto de ideologa que condujo a esta autodispersin, vase Terry Eagleton, La ideologa y sus vicisitudes en el marxismo occidental, en este volumen. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES Uso DE didctico USO EXCLUSIVAMENTE DIDACTICO nicamente

128

que encontramos aqu, entonces, es el tercer trastrocamiento de no ideologa en ideologa: de repente, tomamos conciencia de un para s de la ideologa que opera en el propio en s de la realidad extraideolgica. En primer lugar, los mecanismos de coercin econmica y regulacin legal siempre materializan algunas proposiciones o creencias que son inherentemente ideolgicas (la ley penal, por ejemplo, supone una creencia en la responsabilidad personal del individuo o la conviccin de que los delitos son un producto de las circunstancias sociales). En segundo lugar, la forma de conciencia que se adecua a la sociedad postideolgica capitalista tarda la actitud sobria, cnica, que aboga por la apertura liberal en cuestin de opiniones (todos somos libres de creer lo que queramos; esto nicamente incumbe a nuestra privacidad) pasa por alto las frases ideolgicas emocionantes y slo sigue motivaciones utilitarias y/o hedonsticas. En sentido estricto, sigue siendo una actitud ideolgica: implica una serie de presupuestos ideolgicos (sobre la relacin entre los valores y la vida real, sobre la libertad personal, etc.) que son necesarios para la reproduccin de las relaciones sociales existentes. Lo que se presenta entonces a nuestra vista es un tercer continente de fenmenos ideolgicos: ni la ideologa en tanto doctrina explcita (las convicciones articuladas sobre la naturaleza del hombre, la sociedad y el universo), ni la ideologa en su existencia material (las instituciones, los rituales y las prcticas que le dan cuerpo), sino la elusiva red de actitudes y presupuestos implcitos, cuasi espontneos, que constituyen un momento irreductible de la reproduccin de las prcticas no ideolgicas (econmicas, legales, polticas, sexuales...).20 La nocin marxiana de fetichismo de la mercanca es un buen ejemplo de esto: designa no una teora (burguesa) de la economa poltica, sino una serie de presupuestos que determinan la estructura de la prctica econmica muy real del intercambio en el mercado; en teora, un capitalista se aferra al nominalismo utilitario, y sin embargo, en su propia prctica (de intercambio, etc.) sigue caprichos teolgicos y acta como un idealista contemplativo... 21 Por esa razn, una referencia directa a la coercin extraideolgica (del mercado, por ejemplo) es un gesto ideolgico por excelencia: el mercado y los medios (masivos) estn interrelacionados dialcticamente; vivimos en una sociedad del espectculo (Guy Debord) en la que los medios estructuran de antemano nuestra percepcin de la realidad y hacen la realidad indistinguible de su imagen estetizada. 22

20

Para un abordaje de esta ideologa implcita, vase Pierre Bourdieu y Terry Eagleton, Doxa y vida cotidiana: una entrevista, en este volumen. 21 Para la nocin de ideologa que estructura la realidad (social), vase Slavoj iek, Cmo invent Marx el sntoma?, en este volumen. 22 Vase Fredric Jameson, La posmodernidad y el mercado, en este volumen. SLAVOJ IEK Ideologa. Un mapa de la cuestin FCE - Prohibida su reproduccin total o parcial

10

- @filodac INTRODUCCIN Aphylosajvg LA FILOSOFA

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

129

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

130

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

131

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

132

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

133

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

134

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

135

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

136

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

137

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

138

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

139

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

140

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

141

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

142

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

143

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

144

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

145

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

146

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

147

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

148

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

149

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

150

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

151

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

152

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

153

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

154

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

155

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

156

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

157

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

158

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

159

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

160

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

161

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

162

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

163

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

164

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

165

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

166

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

167

Gubernamentalidad, biopoltica, neoliberalismo: Foucault en situacin (Texto publicado en Sonia Arribas, Germn Cano y Javier Ugarte (coordinadores), Hacer vivir dejar morir. Biopoltica y capitalismo, Madrid, CSIC-La Catarata, 2010, pp. 85-108).

Jos Luis Moreno Pestaa Universidad de Cdiz

Resumen: Se reconstruye en este artculo, en primer lugar, el contexto poltico en el que Foucault dicta los cursos de 1977-1978 y 1978-1979. Seguidamente, se analizan tales cursos con especial atencin a la articulacin entre los significados tericos y polticos, sin olvidar los guios y diferenciaciones del autor en el campo intelectual (fundamentalmente respecto al marxismo y la sociologa). Se proponen, en tercer lugar, ciertas consideraciones acerca del significado histrico de lo que Foucault dijo y de su uso analtico en el presente. Palabras clave: Biopoltica, gubernamentalidad, marxismo, sociologa, Foucault Abstract: In this article I reconstruct, in the first place, the political context in which Foucault dictated the courses of 1977-1978 and 1978-1979. Next, I analyze these courses with special attention to the articulation between theoretical and political meanings, not forgetting the winks and the differentiations made by the author in the intelectual field (mainly, related to marxism and sociology). I propose, in the third place, some considerations about the historical meaning of what was said by Foucault and about his analitical use in the present. Key words: Biopolitic, gubernamentality, marxism, sociology, Foucault. La amplia literatura sobre biopoltica presenta un problema al explorador mejor intencionado. Los asuntos que se incluyen en el campo semntico del trmino se desbordan en mltiples direcciones. En unos casos, para m los mejores, se trata del anlisis de polticas sociales, pblicas o privadas, incorporando cuestiones novedosas y maneras originales de tratarlas1. La nica objecin que despierta algunos de estos acercamientos, es su olvido de una tradicin que ya exista y que desconocen sin complejos. Pareciera que el amparo de un trmino filosficamente noble, justificara
Mis agradecimientos a Javier Ugarte por su lectura cuidadosa y a Francisco Vzquez Garca por su discusin sincera. Ambos han mejorado este texto. Los errores slo son mos. 1 Vanse los interesantes balances de Ugarte Prez (2005, 43-72) y Vzquez Garca (2005, 159-225). Para una consideracin crtica de los estudios sobre el Estado de Bienestar pueden consultarse los exhaustivos trabajos de Alonso (1999 y 2007). Sobre la utilizacin de Foucault en los mbitos de gestin del proceso de trabajo vase la sugerente compilacin de Fernndez Rodrguez (2007).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

168

desentenderse de la inmensa literatura sociolgica, histrica, econmica o politolgica sobre el Estado de Bienestar, que se ha producido en la segunda mitad del siglo XX. En otros casos, cuando se habla de biopoltica, se asiste a un gnero literario peculiar de cuya necesidad nadie puede burlarse: se trata de profecas salvficas o apocalpticas2. Este tipo de discursos slo pueden ser estudiados por la sociologa de las religiones. Su tono impreciso los vuelve tiles tanto para un roto como para un descosido; la insercin estratgica de descripciones parciales de la realidad les permite introducir efectos de verdad, junto con otros de creencia o de sobrecogimiento. Los autores que reproducen tales discursos, repiten, junto al ncleo emprico de la profeca, intentos ms o menos logrados de generar lo que Wittgenstein (1992, 66-67)3 llamaba interjecciones, esto es, expresiones de gozo, de espanto, de sorpresa, de afirmacin/denegacin de s, etc. Los placeres intelectuales se componen de mltiples hebras (lgicas, estticas, de distincin, de constitucin ntima) por lo que tales discursos, en las formas extremas a las que me refiero, existieron, existen y existirn4. No tiene sentido discutirlos lgicamente sino analizar qu palpitaciones de un habitus comn pueden unir al emisor de los mismos con sus receptores. En el campo filosfico, ese ejercicio de produccin de efectos de sentido funciona, usualmente, mediante la conexin de autores. As, tenemos exposiciones sobre las conexiones de Foucault con Hannah Arendt, con Martin Heidegger, con Karl Marx, con Maquiavelo El porvenir, por qu no, quiz nos lo rena con Nicolai Hartmann, Xavier Zubiri o con Marsilio Ficino. Curiosamente, faltan bastantes estudios sobre la relacin de Foucault con los pensadores con los que comparti histricamente su experiencia: Robert Castel, Paul Veyne, Jean-Claude Passeron, Pierre Bourdieu Claro, que stos, al no ser filsofos, cotizan poco para la crtica filosfica. As marcha la siempre quejumbrosa filosofa y as se facturan los

Hay una consideracin justa y clarificadora de este tipo de trabajos (desde Agamben a Negri y Hardt) en la introduccin de Vzquez (2008). Por lo dems, tambin existen utilizaciones negativas del concepto bajo el que subsumen todos los demonios del anticomunismo. Vase una potente crtica a gnes Heller y Ferenc Fher en Campillo (1998, 167-175). En este trabajo se encuentra una discusin del significado del concepto de biopoltica (tal y como lo elabora Foucault antes de los cursos que analizo) entre la teora social contempornea. 3 Passeron (2006, 408) advirti sobre el valor para la sociologa del arte de estos materiales de Wittgenstein. Tambin son tiles, creo, para advertir los componentes plurales de los placeres tericos y del consumo que no son, ni mucho menos, reductibles a sus contenidos lgicos. 4 Los discursos profticos, deca Spinoza en el Tratado teolgico-poltico (I, 30) varan por la imaginacin y el temperamento corporal de cada profeta, por los signos variados (los aconteceres reales que se sobreinterpretan, podra decirse) en los que ve manifestarse el desastre o la salvacin, por la ideologa de cada uno. Es imposible discutir intelectualmente con los discursos profticos porque, como deca Spinoza, son de un gnero distinto a los discursos intelectuales guiados por el ideal de conocimiento.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

169

discursos interesantes. Dignos para ser ledos por lectores interesantes y que generan problemticas interesantes. El objetivo de este trabajo es analizar cmo se relacionan dos juegos de lenguaje, el poltico y el intelectual, en dos cursos de Foucault tericamente dedicados a la biopoltica, aunque, como se ver, Foucault habla escasamente de ella y su discurso tiende a dispersarse en encadenamientos conceptuales y polticos variados cuya lgica se intentar reconstruir. Me fijar fundamentalmente en discernir, lo que no es fcil, las relaciones que Foucault (no mi anlisis, jugando a la hermenutica crtica) establece entre sus problemas intelectuales y los conflictos del mundo poltico y el efecto de stos en el campo intelectual. Sostendr la idea de que tales conflictos se encontraban excesivamente presentes en los dos cursos de Foucault y que, a la endiablada complejidad que introduce el presente poltico (mediado, insisto, por sus efectos intelectuales) en el discurso terico, debemos las oscilaciones de Foucault. A pesar de ello, el anlisis puede distinguir, con cierta claridad, el encabalgamiento de la lgica terica de Foucault con, uno, las opciones de otros intelectuales y, dos, el mercado de los mensajes polticos con marchamo intelectual5. Fuego sobre el marxismo En bastantes ocasiones, Foucault, sea declarndolo explcitamente, sea realizando guios para entendidos, invoca ante sus oyentes la presencia de los conflictos intelectuales y polticos en sus lecciones. En esta poca, Foucault huye del izquierdismo, que tan fogosamente abraz en la primera mitad de los aos 1970. Como crtica al marxismo y al Partido Comunista pero tambin, debe recordarse cuando se leen tales textos, al capitalismo. Se conoce su ruptura con Gilles Deleuze, a quien en otros tiempos, y en coyunturas intelectuales concretas que cabra analizar, encomend nada menos que la custodia intelectual del siglo. Jacques Donzelot explica que Foucault
5

Paul Veyne (persona muy prxima y analista agudo de Michel Foucault) propone un retrato de ste como decisionista poltico. Es intil argumentar sobre las pasiones polticas. stas slo se dejan referir a una decisin existencial. Si con ello se quiere decir que las opciones morales y polticas, no se dejan racionalizar completamente, sea; si se quiere, como argumenta Veyne (2008, 180), reivindicar el esteticismo poltico Bizancio sin querellas bizantinas dan ganas de ponerse, entre tanta autocomplacencia paranietzscheana o cultivo de la resolucin heideggeriana, muy hegeliano y sealar que, tras los es as, o as somos, se revelan muchas mediaciones. El trabajo del anlisis, si merece ese nombre, es intentar sacarlas a la luz. De lo contrario, puede acabarse, como deca Hegel (2006, 171-172), sucumbiendo tericamente ante una filosofa con personalidad doble pero estratgicamente articulada: una, se explica en el clebre prefacio a la Fenomenologa del Espritu, en batn, repleta de opciones de lo ms mundano y domstico; otra, pomposa, donde se juega a hablar de lo esencial y eterno y en la que, bajo los ornamentos de sumo sacerdote, asoman los intereses humanos demasiado humanos de las pantuflas.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

170

alab el Antiedipo (con su Introduccin a una vida no fascista, prlogo a la edicin americana) por razones de diplomacia intelectual, pero que tena una opinin psima del libro. Lo consideraba, segn Jacques Donzelot, un efecto de lenguaje, algo como Cline (Dosse, 2007, 376). La diferencia sobre el papel de la nocin de deseo, expresada en el primer volumen de la Historia de la sexualidad, intensific la susceptibilidad de Foucault respecto a Deleuze. Esa diferencia terica latente se manifest en ruptura poltica con el desarrollo del affaire Croissant6 (Dosse, 2007, 373-378). Foucault ya haba tomado partido aunque con distancias crticas por el discurso antimarxista de los jvenes filsofos7 con una fruicin que ni el propio Raymond Aron, durante muchos aos analista y crtico liberal del pensamiento marxista, enemigo jurado del sovietismo y el comunismo, pero conocedor y lector profundo de Marx, se permita8. El mundo periodstico es uno de los sensores privilegiados de los vnculos entre el mundo intelectual y la poltica. Michel Foucault era el intelectual ms representativo de un grupo, unidos por afinidades de humor poltico e intelectual, congregado alrededor del semanario Nouvel Observateur y del poltico socialista Michel Rocard. Uno de los temas de predileccin, si no el tema por antonomasia, de dicho crculo en aquella poca, era la denuncia del discurso marxista por cerrado, dictatorial y carente de sentido de la novedad intelectual (Pinto, 1987, 139). Las referencias implcitas (Foucault 1994b, 613-614 y 2004a, 203-207) al PCF como estructura pastoral
6

Abogado de la Fraccin del Ejrcito Rojo (RAF), extraditado a Alemania en 1977. Foucault haba protestado por la extradicin pero rechaz considerar a Alemania en los trminos del comunicado que hizo circular Flix Guattari. Se encuentran referencias, ms o menos claras o veladas, al suceso en los cursos de Foucault (2004a, 270, 287, 288 y 2004b, 184) que constituyen el objeto de este texto. Vase Senellart (2004, 385). 7 El 9 de mayo de 1977 con el artculo titulado La grande colre des faits publicado en Nouvel Observateur). En este artculo poda leerse: Con el GULAG, se vea no las consecuencias de un desgraciado error, sino lo efectos de las teoras ms verdaderas en el orden de la poltica. A aquellos que queran salvarse oponiendo la verdadera barba de Marx a la falsa nariz de Stalin, no les gustar mucho (Foucault 1994a, 279). Aunque uno no comparta los anlisis de Foucault, puede muy bien identificarse con su apelacin (y encontrarla intelectual, moral y hasta estticamente afortunada), entre tanto bizantinismo vergonzoso de los marxistas ante los crmenes del socialismo real, a la gran clera de los hechos. 8 El viejo colega y concurrente de Sartre escribi en sus memorias que los los nuevos filsofos no representan una manera original de filosofar; no son comparables ni a los fenomenlogos, ni a los existencialistas, ni a los analistas. Escriben ensayos al margen de las normas universitarias. Su xito ha sido favorecido por los media, y por la ausencia, en el Pars de hoy, de una instancia crtica justa y reconocida (Aron, 1983, 705). Esta actitud de Aron puede verse como una confirmacin de la lgica autnoma del trabajo intelectual respecto del mundo poltico. A mayor inversin intelectual en un objeto, menos tendencia a permitir y a permitirse la falta de rigor. Incluso cuando sta confirma un compromiso poltico antiguo y, en las circunstancias del mundo intelectual francs, costoso para Aron. Vase tambin la referencia al asunto y su manera de plantear el problema en el prefacio de Aron (1978, XLIV) a la reedicin de su trabajo de 1937.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

171

escatolgica asimilable a la pastoral catlica9 y al poder sovitico como Estado centrado en la gestin pastoral de sus ciudadanos, testimonian la contribucin de Foucault a semejante humor anticomunista. Por lo dems, Foucault est, l y su crculo de prximos, en medio de un importante proceso de desinversin militante. Como se ha mostrado en otro trabajo (Moreno Pestaa, 2008) complementario de ste, todo un grupo intelectual se normaliza poltica y, los ms jvenes, acadmicamente. Se abandona un pblico de militantes y de profesionales de los organismos de poltica social y del campo de la justicia y se comienza una interseccin con el mundo poltico fundamentalmente, el partido socialista francs y la central sindical CFDT y el mundo universitario. Foucault tena la ambicin de influir en dicho partido, aunque parece que la falta de receptividad le acab frustrando. Algunos de los conceptos tericos facturados en estos cursos, se encontraban pensados como ofrendas intelectuales a la renovacin del socialismo francs: Cuando Foucault analiz esta historia de la gobernabilidad neoliberal que emerga ante sus ojos a finales de los aos setenta, acudi al partido socialista francs, especialmente a sus lderes ms innovadores al estilo de Michel Rocard, para decirles que ms all de la burocracia existente, era necesario inventar una gobernabilidad de izquierdas capaz de oponerse a las tcnicas de gobierno neoliberales (lvarez Ura y Donzelot, 2006, 53). En coherencia con tales intentos por convertirse en consejero del prncipe, Foucault (2004b, 93-95, 314-316) seala que los socialistas y el marxismo en general carecen de una gubernamentalidad propia. Foucault da dos versiones de esta carencia. Una, con la que recoge la experiencia histrica de la socialdemocracia y del socialismo real. Aqulla acta bajo la gubernamentalidad liberal, aunque sirvindole de contrapeso; la segunda convierte al aparato administrativo en gestor de la poblacin. Debido a dicha carencia, el socialismo slo sabe caracterizarse por la constitucin de un conjunto de textos sagrados y delimitarse segn la fidelidad o no a los mismos. En otra versin, Foucault considera que el socialismo slo es capaz de oponer a la lgica del gobierno, una profeca histrica. Hay que inventar, nos dice Foucault, la gubernamentalidad socialista. Sabemos que l se encontraba disponible para la tarea10.

Foucault (2004a, 225, 2004b, 197) parece suponer que el totalitarismo viene de la militancia en partidos. Walzer (2008), por ejemplo, haba situado la poltica radical como efecto del puritanismo. 10 Los sinsabores que padeci le llevaron a concebir un libro crtico sobre el socialismo francs al que acusaba, dice Paul Veyne (2008, 195) de carecer de poltica (tal y como Foucault y su grupo queran

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

172

En esa coyuntura, acompasada por toda una transicin generacional, no puede sorprender que el tema del biopoder y la biopoltica, enunciado por vez primera en La volont de savoir, se desborde continuamente. Y ello tanto en el campo semntico del concepto como en los objetos mismos de anlisis. En ocasiones seala que la biopoltica solo tiene sentido dentro de la lgica de gobierno liberal11 (Foucault, 2004a, 23-24 y 2004b, 25), sin preocuparse por confrontar dicha acepcin con los desarrollos anteriores. Estos situaban la biopoltica en otra escala de anlisis: ajuste de los procesos poblacionales como complemento del control disciplinario de los procesos individuales a las necesidades econmicas del capitalismo (Foucault, 1976, 187) o intervencin de los poderes en la definicin de la vida y de sus objetivos (Foucault, 1997, 221). A veces el anlisis, quiz obedeciendo a una exigencia de reafirmacin como filsofo (a la que como mostrar Foucault no era ajeno), se dirige hacia la antigedad clsica para resumir una tipologa de los efectos de las comunidades espirituales en los individuos. Los resultados no son sorprendentes: del lado bueno, las comunidades griegas, siempre vigilantes de la salvaguarda de la individualidad; del lado malo, la tradicin hebraica y sobre todo cristiana, siempre totalitaria y aniquiladora de la originalidad personal. En otras ocasiones, Foucault se entrega a comentarios de ciertos textos histricos, de cuyas condiciones de produccin y representatividad no nos informa (la cuestin no parece preocuparle), aunque saca de ellos conclusiones contundentes; en otros momentos, analiza ciertas propuestas polticas contemporneas. Si todo trabajo filosfico y de ciencias sociales y humanas tiene, por formalizado que est, alguna marca del autor y de su contexto, de sus intereses y de sus gustos variados, los cursos a los que nos referimos testimonian una problemtica terica convulsa y de una sensibilidad extrema ante los movimientos de su presente. Lo cual no los hace menos interesantes. Ms bien lo contrario12.

ofrecerla, cabra aadir). Segn el editor del curso de 1978-1979, Foucault (2004b, 103) no avanz mucho en la tarea. 11 Por la razn que se explicar ms adelante, slo la racionalidad liberal permitir la conversin de los hombres en una poblacin con sus regularidades propias que no puede ser objeto de penetracin disciplinaria. Evidentemente, esta explicacin no se compadece con lo que Foucault haba sealado hasta entonces. La nueva versin convierte a la biopoltica en el producto de una prctica de gobierno que se autocontrola a s misma. En versiones anteriores (Foucault, 1976, 183 y 1997, 216-221), la biopoltica era distinta pero complementaria (siempre con desajustes) con la disciplina individual (organizada por la anatomopoltica, nocin que Foucault olvida por el camino), su complementaria en la gestin de poblaciones. La biopoltica funcionaba segn un principio inagotable, capaz de intervenir en toda la vida. Su lmite solo era la muerte. 12 Que no se pueda entender el Tratado teolgico-poltico sin conocer a los hermanos de Witt o a Guillermo de Orange, ni La rebelin de las masas sin pensar en el empresario papelero Urgoiti o en el PSOE de Pablo Iglesias no disminuye un pice el inters intelectual de ambos textos. Exige situarlos

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

173

Una autoproteccin discursiva

Foucault mantiene en estos trabajos una poltica de delimitacin discursiva. Lo que l realiza, nos dice, es filosofa, no sociologa, historia o economa. La filosofa, segn la define Foucault (2004a: 5), es poltica de la verdad. No es fcil situar el radio de accin de semejante demarcacin; sabemos que con ella, Foucault se salva de la pertenencia a disciplinas infamantes. Foucault tena un desdn enorme por la psicologa, mucho ms respeto por la historia (Vzquez, 1988) y una relacin muy distante con la sociologa, sobre la cual haca constantes bromas a su amigo Jean-Claude Passeron13. A sus contemporneos socilogos no los cita nunca excepto de un texto de homenaje a Canguilhem y cuando alaba a Robert Castel se concentra en los resultados de ste, no en la forma sociolgica de su anlisis (Fabiani, 2004, 102). Se comprende bien que intente separarse de un territorio que le resultaba escasamente atractivo, toda vez que el mtodo de Foucault se diferencia poco de cualquier trabajo cientfico normal. Para ello, Foucault no encuentra otro remedio que inventarse un contendiente a su medida. Nos ensea, as, que la sociologa, la historia y la filosofa poltica parten de universales como el soberano, la soberana, el pueblo, los sujetos, el Estado, la sociedad civil (Foucault, 2004b, 4), mientras que su mtodo partira de los fenmenos concretos para llegar a los universales. Al auditorio entonces, y al lector hoy, quedaba por asumir que cientficos sociales ingenuos eran la norma y no la excepcin. Movido por semejante deseo de comenzar de cero (estrategia discursiva cara a cierto tipo de ejercicio filosfico), Foucault (2004b, 192) reconstruye la historia a partir de un sistema propio de categoras, reivindicando que su perspectiva permite una consideracin novedosa del conjunto de los problemas, a cualquier escala. stas van a permitir, nada menos, que retraducir en sus propios trminos todo el debate poltico. ste consiste en el debate interno de cada racionalidad gubernamental consigo misma o sea el conflicto externo de cada racionalidad con el resto. Una vez asumida la historia

constantemente en la coyuntura en la que nacen. Que los pensamientos sean circunstanciales no quiere decir que sean pura banalidad mundana: entre otras cosas, porque reflexionar en ciencias humanas quiere decir, como ha puesto de relieve Jean-Claude Passeron (2006) en su obra, comparar informaciones y conceptualizaciones de contextos emparentados en algunos aspectos y en otros no. Vase una crtica del textualismo y una defensa de la comprensin de las circunstancias como criterio de lectura de la obra de Ortega (que, en mi opinin, contienen enseanzas coincidentes con las de la sociologa de la filosofa) en Jaime de Salas (1994, 14-16). 13 Entrevista con Jean-Claude Passeron, marzo 2008.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

174

que Foucault nos narra, la realidad puede ser aprehendida completamente desde su propio marco de anlisis. ste se apoya en la distincin de tres fases, cada una de ellas constituida por la interaccin compleja de tres lgicas. Para quien conozca un mnimo el pensamiento francs de la segunda mitad del siglo XX, la estrategia analtica de Foucault resulta fcil de ubicar: se trata de huir de la creencia de que una poca histrica se encuentra dominada por una lgica nica que, montonamente, trasferira sus efectos a lo largo y ancho de la experiencia colectiva. Fue la empresa de Althusser14, recogida en sus crticas a la concepcin hegeliana de la historia y antes haba ocupado un papel central en un ensayo de Maurice Merleau-Ponty (1955, 68). El lector buscar en vano un reconocimiento de Foucault a sus antiguos maestros. Ello sera asumir, en el primer caso, que existieron formas de marxismo filosficamente elaboradas de las que muy probablemente, entre otras fuentes como la escuela de Annales, Foucault aprendi su modelo de totalidades complejas sobredeterminadas o, lo que viene a ser lo mismo, subdeterminadas (Althusser, 1967, 71-106 y 1969, 117) o, en el segundo caso, que la discusin filosfica con el marxismo exiga algo ms de matices en el tratamiento de la cuestin. Esta ceguera, sin duda, es estratgica. Porque este reconocimiento del carcter complejo de toda realidad histrica, que Foucault niega a un marxismo retratado como un sistema simple y monocorde, Foucault (2004b, 170-171) lo identificar elogiosamente en los liberales alemanes a los que estudia en 1978-1979. Gobierno, pastoral y resistencias: socialismo y fascismo

La primera lgica identificada por Foucault se organiza segn la lgica de la soberana legal de un territorio y prevaleci en el medioevo. La modernidad, sin embargo, se encuentra definida prioritariamente por la disciplina; el mundo contemporneo por la lgica de la seguridad. Foucault se interesa en diferenciar la lgica de la seguridad de la disciplinaria. La primera trabaja sobre series aleatorias abiertas en las cuales se fijan umbrales de probabilidades de que ocurra su suceso: slo en ese caso comienza el intento de frenarlas y regularlas. La segunda, por el contrario, pretenda reglamentarlo todo, no respetando la naturaleza de las cosas. Y la lgica del capitalismo no estriba,
La estructura de la existencia histrica en la totalidad social hegeliana permite lo que propongo llamar un corte de esencia, es decir, esta operacin intelectual por la cual se opera, en cualquier momento del tiempo histrico un corte vertical, un corte tal del presente que todos los elementos del todo relevado por este corte estn entre ellos en una relacin inmediata que exprese su esencia interna (Althusser, 1969: 104). Foucault (1994a, 611) consideraba en 1978, en consonancia con Bourdieu, que Althusser haba emprendido una tarea de purificacin escolstica del texto de Marx sin inters alguno.
14

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

175

como se anunciaba dramticamente en Surveiller et punir, en otorgar libertades a seres humanos previamente disciplinados. Foucault (2004a, 49-50) seala que el liberalismo se organiza segn la hegemona de la seguridad: respetando la dinmica propia de la realidad, renunciando a fijarla con un cdigo, respetando, pues la autonoma de los individuos y prohibindose intervenir hasta que sta haga peligrar la vida comn. El capitalismo se rige por dispositivos que asumen que la sociedad tiene una legalidad propia incapaz de ser sometida eficazmente a una ortopedia poltica de conjunto. Pero gobernar supone que el Estado ha incorporado tecnologas de poder que le preceden y, por ello, el trabajo histrico tiene que desenredarlas. Estas tecnologas de poder no se han formado en el mundo de la empresa, en la gestin de los partidos polticos, en la subjetividad conformada por la religiosidad o en los modelos educativos, sino mucho antes; en los momentos inaugurales de nuestra civilizacin. La idea de que es posible gobernar a los hombres es hebraica y cobra todo su desarrollo en el poder pastoral cristiano: de l procede la gubernamentalidad moderna sin que quepa reducirla a su origen. El pastor cristiano, como ya seal antes, pretende dirigir la conducta completa del individuo y acabar con su individualidad15; en Grecia, por el contrario, las relaciones de consejo y tutela servan para consolidar la propia autonoma. La metodologa argumentativa consiste en la acumulacin de pruebas a favor de los casos prototpicos: sin ninguna excepcin, con desarrollos que siempre confirman los tipos ideales perfilados. Ese tipo de gobierno de almas fue sacudido por una primera ola de, lo que podra llamarse, racionalizacin. Foucault no emplea la palabra, pero es lo que describe y el sentido en que evala la historia que narra16. La razn de Estado, al
Aunque es fcil de adivinar pues los malos de los relatos de Foucault acostumbran a menudo, desgraciadamente, a cabalgar juntos, el curso de 1980 Du gouvernement des vivants (an no publicado) sita a la pastoral cristiana como antecedente de la psicologa moderna y modelo de la misma (Landry, 2007, 44). Lo ms extrao de tales construcciones, que traducen comprensibles fijaciones de Foucault, es la facilidad con la que las siguen aceptando personas eruditas. 16 Cabe discutir esta afirmacin y sealar que Foucault solo describe racionalidades sin jerarquizarlas normativamente. Es una interpretacin justificada porque hay una ambigedad en el corazn de las intervenciones de Foucault que, no lo olvidemos, son publicaciones pstumas que l no dio a la imprenta. Sin embargo, mi interpretacin se basa en desarrollos de Foucault muy significativos de que, al menos implcitamente, operaba en l un esquema de racionalizacin, esto es, de progreso histrico. A) La seguridad permite la libertad en el sentido moderno del trmino (Foucault, 2004a, 50). Ya no es una simple libertad dominada por las disciplinas, como haba, reconoce l mismo, sealado hasta entonces. B) La razn gubernamental (estatal o securitaria) acaba con la idea metafsica de que el poder tiene un origen divino y un final basado en la reconciliacin, abriendo un proceso de historicidad indefinida el marxismo, como ya he sealado, reactiva en sus propios trminos la creencia en la reconciliacin final (Foucault, 2004a, 265-266, 272, 292). En otro lugar, Foucault (2004b, 312), coherente con ese aporte de la razon gubernamental, se aparta del problema del origen del poder, asumiendo que la subordinacin y el poder no se pueden eliminar. C) La crtica de los economistas a la razn disciplinaria de la poltica, dando un nuevo contenido a la razn de Estado (Foucault, 2004a, 356), permite la profundizacin y la ampliacin de las formas de gubernamentalidad. As, puede concluirse, sin ninguna violencia, lo
15

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

176

comienzo de la modernidad, desliga el gobierno del marco religioso de salvacin. El Estado moderno no conoce reconciliacin final porque no se nutre de una soteriologa. Racionalidad, pues, contra el cristianismo; tambin, como se insisti ya, contra el socialismo que es, dice Foucault una y otra vez, una doctrina de salvacin. Dicha razn de Estado busca gobernar la vida de los hombres por medio de los reglamentos. Los economistas van a desbaratar semejante sueo de ingeniera integral. Constituirn la segunda oleada de racionalizacin. La razn de Estado, en su debate con la tecnologa medieval de gobierno, haba criticado la idea de fundar la poltica en la naturaleza. La crtica de los economistas a la tecnologa disciplinaria reactiva la idea de que lo gobernable tiene una naturaleza propia aunque, claro est no fundada en la cosmoteologa. Entre las variadas formas de resistencia que se confrontan a la tecnologa de la seguridad, Foucault (2004a, 364, 365) distingue tres modulaciones de una escatologa revolucionaria: el sueo de una sociedad civil que reabsorbe el Estado, el derecho a la revolucin de la sociedad civil y la idea de un Estado que sera el representante de la nacin o del pueblo. En esta reunin de elementos heterclitos, destaca la vecindad entre el socialismo y el fascismo. sta haba ocupado ya algunos anlisis del curso Il faut defendre la socit que recoge as una aportacin peculiar de Foucault a los anlisis que sobre el totalitarismo o el historicismo vinculaban a uno y a otro. Ahora, bien, en aquel momento, la posicin de Foucault era notablemente compleja. El racismo serva para introducir diferencias en el continuum biolgico que el poder tomaba bajo su control. Por medio del racismo, se vuelven complementarias dos operaciones: la muerte del otro y el mantenimiento de la propia vida. El colonialismo y el nazismo, insista Foucault, han utilizado este discurso; pero tambin ha encontrado acomodo en el discurso socialista. No, matiza Foucault, cuando ste ha pensado al enemigo desde el punto de vista estructural, como un adversario al que despojar de sus privilegios, sino cuando lo ha convertido en un objetivo a eliminar; esto es, cuando ha reificado las clases en lucha como si de razas se tratase (Foucault, 1997, 233-234)17.
siguiente: el paradigma de la seguridad es ms complejo pues incorpora los dos anteriores. Y, lo ms importante, repito, es el modelo que permite la libertad. Coherentemente, Foucault critica a los socialistas por tener una gubernamentalidad de Estado. 17 Etienne Balibar (1991, 275-276), en un clarificador artculo, ha explicado que la lucha de clases solo adopta la forma del conflicto de campos (guerra civil) cuando est determinada por las variables religiosas o las tnicas. Puede adoptar otras muchas: formas democrticas, electorales, de costumbres Por lo dems, las clases se superponen, insiste, y no forman grupos aislados: No son castas. Las clases, en fin, no producen la lucha de clases. Es la lucha de clases la que reordena las clases, su separacin, su proximidad, sus pertenencias mltiples.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

177

Da la sensacin de que entre esta formulacin y la de los cursos de finales de los 70, se completa un ciclo. El primer volumen de la Histoire de la sexualit, si bien contena una crtica de la concepcin marxista del poder, reivindicaba con riesgo los tiles analticos de la lucha de clases. Incluso se permita hacer un guio a las interpretaciones ms estalinianas que conoci en su juventud: Hay pues que volver a formulaciones desacreditadas desde hace mucho; hay que decir que existe una sexualidad burguesa, que existen sexualidades de clase. O ms bien que la sexualidad es originaria e histricamente burguesa y que induce, en sus desplazamientos sucesivos y sus trasposiciones, efectos de clase de carcter especfico (Foucault, 1976, 168)18. Con esta teora lysenkista (con su pequea irona para entendidos) de la sexualidad, Foucault se opona a su peculiar visin del freudomarxismo y, ciertamente, al intento de Althusser (1993, 30), en su importante texto de 1964, por aislar los territorios del inconsciente del sociologismo extremo. Este tipo de formulaciones se encontraban cerca de una escuela que despegaba en los aos 70 del siglo pasado: la sociologa fenomenolgica de Bourdieu con los trabajos que inspir en su, por entonces, discpulo Luc Boltanski (1969 y 1971). Ciertamente puede comprenderse bien cmo un anlisis de las formas de acumulacin de la experiencia social interiorizada, algo accesible a la descripcin de las capas del habitus que propona el modelo de Bourdieu, podra justificar la referencia a una sexualidad de clase. Que ese camino le resultase difcil de transitar a Foucault se comprende por su rechazo a la fenomenologa en la que se concentr su proceso de formacin y a la que no deja de rendir homenajes en sus anlisis, muy prximos de la variacin imaginaria19. Pero, pese a los problemas tericos del modelo foucaultiano para sostener con coherencia la dimensin de la lucha de clases en su programa de investigacin, cuesta comprender un cambio terico tan vertiginoso. El abandono de la perspectiva del anlisis de clase es an ms significativo que el del marxismo. Abandono, tambin, de la hiptesis Nietzsche segn la cual habra que concebir el poder en trminos de dominacin y lucha (Foucault, 1997, 5053). Sin ella, poco sigue conectando a Foucault con aquel que escribi en los primeros aos 70. Slo una preocupacin por las relaciones de poder y por cmo contener los peores efectos que producen.
18

Foucault guard an inters por la lucha de clases en Marx, aun cuando su rechazo al profetismo implcito en su obra se iba haciendo ms complejo. (Foucault, 1994a, 604-605, 612-613) 19 Procedimiento fenomenolgico que consiste en imaginar todas las variaciones que puede tener un objeto y cul es la que hace que pierda su naturaleza. Ese invariante es la esencia o eidos del objeto. No es el lugar de demostrar la presencia implcita de ese modelo analtico en los razonamientos de Foucault.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

178

En ese marco, la crtica izquierdista con la que l comparti luchas y teoras tampoco le convence como herramienta analtica. La fobia al Estado olvida, primero, que el Estado no es una especie de cncer que crece sin control; segundo, que las diversas formas de Estado no son asimilables; tercero, que la presuncin de intenciones malficas, es decir, el funcionalismo de lo peor que siempre encuentra idnticos efectos en toda accin pblica, es una caricatura de anlisis (Foucault, 2004b, 193). Por lo dems, esta crtica izquierdista tiene un suelo de creencias comunes con el rechazo liberal al Estado que vera al nazismo como un efecto de una variante antiliberal que englobara tambin la economa keynesiana (Foucault 2004b, 117). Foucault rechaza ese tipo de anlisis: ni el nazismo ni el estalinismo son Estados hipertrofiados, sino la destruccin del Estado por la lgica del partido del mismo modo que, como aclara en una agudsima entrevista de 1976 con K. S. Karol, el terror estaliniano no procede de la disciplina, sino precisamente de su fracaso (Foucault, 1994c, 69). Estas crticas metodolgicas, de evidentes consecuencias polticas, parecen situar a Foucault entre los partidarios de la accin estatal democrtica, algo que sera coherente con su poltica de acercamiento al Partido Socialista Francs. Sin embargo, sus anlisis del neoliberalismo americano ayudan a matizar esta posicin. En ella, una crtica econmica de la normalizacin, perfectamente coherente con muchas de las inquietudes ntimas y tericas de Foucault, cobra una significativa relevancia que parece acercarlo a otras fracciones del mbito poltico. Un individuo sin normalizacin

Del neoliberalismo americano, Foucault se interesa, coherente con una orientacin general de su pensamiento, por su programa de constitucin de sujetos. Los neoliberales son conscientes de que deben producirse hbitos que permitan a los sujetos enfrentarse a los riesgos. Para ello, por un lado, los neoliberales concentran su atencin en las capacidades de los sujetos, es decir, por todo lo que, a decir de Marx, ignoraba el capitalismo: la riqueza de la fuerza de trabajo. Los neoliberales consideran, por el contrario, que cada trabajador dispone de una red de competencias variables. Unas, derivadas de su capital gentico y que permiten un programa de mejoras de los recursos fsicos. Otras, gestadas en los procesos cotidianos: el neoliberalismo nos ensea que la vida diaria puede ser concebida como una reserva enorme de procesos de valorizacin

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

179

de los individuos20. Convencido hasta el fondo por el discurso que analiza (el texto se mueve en una sutil administracin de la frontera entre el anlisis y las evaluaciones positivas), Foucault (2004b, 239) explica que el despegue econmico de Occidente no ha dependido de la cantidad de seres humanos que se pusieron a trabajar sino de la cualificacin de los mismos. Justo en ese momento, Foucault tena pensada una nota crtica sobre Bourdieu21 que no desarrolla y que los editores del curso incluyen en el texto. Su contenido es interesante, aunque algo oscuro, y la oportunidad de la misma era pertinente22. La cuestin recoga un viejo problema planteado por Marx (1986, 150-159) en El capital. Los elementos del capital, en lo que concierne al proceso de trabajo, pueden diferenciarse en capital constante y capital variable. El primero comprende los medios de produccin y, lo interesante, es que no cambia de valor en el proceso de produccin. El segundo define la compra de la fuerza de trabajo y, esta s, cambia de valor en el proceso productivo, aadindole el obrero al objeto que fabrica un valor superior al que recibe en concepto de salario (en dicho proceso, emerge la plusvala). Cabe preguntarse cmo se relaciona la fuerza de trabajo con la cualificacin especfica que se adquiere y que permite la mejora de la contribucin obrera a la produccin. La relacin entre parte objetiva y parte subjetiva del capital tuvo, en Bourdieu, una reformulacin diferente. Por un lado, derivada de una utilizacin materialista de la fenomenologa, convierte al cuerpo en lugar de interiorizacin de los recursos que se tienen. Desde tales recursos, el cuerpo genera una lgica simblica que codifica la realidad mediante elecciones espontneas. Por otro lado, Bourdieu delimita la existencia
Con acierto, Fredric Jameson (1996, 206) destac el inters de esta perspectiva analtica para el materialismo marxista. 21 Problematizar de otra manera todos los dominios de la educacin, de la cultura, de los que se ha apropiado la sociologa. No es que la sociologa haya olvidado el aspecto econmico de todo esto, pero, por atenerse a Bourdieu. reproduccin de las relaciones de produccin [curiosa y significativa asimilacin de Bourdieu con Althusser y de la sociologa con el marxismo. La reproduccin de las relaciones de produccin es uno de los epgrafes de Ideologa y aparatos ideolgicos del Estado: JLMP]. la cultura como solidificacin social de las diferencias econmicas. Mientras que en el anlisis neoliberal, todos estos elementos estn directamente integrados en la economa y en su crecimiento bajo la forma de una constitucin de capital productivo. Todos los problemas [de la herencia?] -transmisin-educacin-formacin-desigualdad de nivel tratados desde un punto de vista nico como elementos homogeneizables, ellos mismos por su [parte?] recentrados no alrededor de una antropologa o de una tica o de una poltica del trabajo, sino alrededor de una economa del capital. Y el individuo considerado como una empresa, como alguien que hace una inversin en algo y es un inversionista [Foucault escribe investissement/investisseur]. [] Sus condiciones de vida son el ingreso de un capital (Foucault, 2004b, 239). 22 El curso siguiente llevaba por ttulo La economa de mercado y las relaciones no mercantiles, tema muy prximo de la economa de las relaciones simblicas que ocupaba a Bourdieu (Foucault, 2004b, 245).
20

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

180

de varias especies de capital (capital econmico, capital cultural y capital social) y la posibilidad de reconversiones entre ellas. Un individuo tiene un determinado volumen y estructura de capital (por ejemplo, con mucho capital econmico y poco cultural): para adquirir el capital cultural tiene que arriesgar capital econmico, invertirlo en capital cultural objetivado (libros, bienes culturales), institucionalizado (ttulos reconocidos) o incorporado (capacidad de hablar competentemente de un tema). Ese proceso de reconversin de capital requiere un esfuerzo y puede salir mal. Ahora bien, es necesario realizarlo porque cuando alguien se hace bello (reconvirtiendo sus capitales econmicos y cultural en la adquisicin de una morfologa legtima) y culto merece un reconocimiento ms profundo, como si su prestigio derivase exclusivamente de sus grandes cualidades a ese reconocimiento llama Bourdieu capital simblico23. No creo que Foucault conociese la obra de Bourdieu24 ni ste la de Foucault pero s estaba lo suficientemente informado de la misma para comprender que sus desarrollos sobre el neoliberalismo se superponan con los del socilogo francs. Lo interesante es la comparacin realizada y el sentido que toman las preferencias de Foucault. All donde Bourdieu se gua por una teora antropolgica de las disposiciones (en la que cambiar una disposicin es difcil y en la que la coherencia consigo mismo juega un papel importante), el neoliberalismo considerara que todo puede ser considerado desde la exclusiva perspectiva econmica. El neoliberalismo concibe al individuo como un simple empresario de s mismo que maximiza sus recursos en funcin de sus proyectos. Pero el economicismo antropolgico tiene, para Foucault, virtudes o al menos lo expone sin interrogarse, ni un solo momento, por sus posibles efectos negativos. Por ejemplo, en el tratamiento de la pobreza, las innovaciones neoliberales no carecen de atractivos; muchos, se dira. Foucault explica que el neoliberalismo persigue no dejar a nadie fuera del juego econmico. Las situaciones de pobreza no deben combatirse con prestaciones globales sino con ayudas exclusivamente localizadas sobre aquellos que no alcanzan un umbral suficiente y salen, por falta de recursos, de la concurrencia econmica. La poltica social neoliberal les ayuda, sin eliminar las fuentes del compromiso competitivo y animndoles a interiorizar ste. De ese modo, la lgica de la normalizacin, que consiste en interrogarse por las pautas subjetivas que generan
Sobre estas cuestiones vase Moreno Pestaa (2004). En una entrevista, Daniel Defert explic que jams lee uno a sus propios contemporneos. S recordaba la lectura complacida que l y Foucault hicieron del texto de Bourdieu sobre la casa kabil. Entrevista enero 2005. Vase una descripcin de sus relaciones en Moreno Pestaa (2007).
24 23

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

181

pobreza, cede su lugar a una prctica de incentivo de la responsabilidad econmica. Se configura, as, un modelo de poblacin asistida, asistida sobre un modo, en efecto, muy liberal, mucho menos burocrtico, mucho menos disciplinarista que un sistema que estara centrado en el pleno empleo y que pondra en funcionamiento mecanismos como el de la seguridad social. Deja, finalmente, la posibilidad de que la gente trabaje si quiere y si no quieren, no trabaje (Foucault, 2004b, 213). El sistema penal, por su parte, muestra tambin las virtudes no disciplinarias del modelo neoliberal; que admite la incorreccin y el mal, no desea erradicarlos y slo se preocupa por controlar los desbordamientos que haran imposible la vida en sociedad. Curiosamente, se dice el lector (porque las dinmicas afectivas que recorren los textos no emergen y, por tanto, no se explicitan tericamente), idntico rasgo caracterizaba a la ltima fase de racionalizacin, la gubernamental, frente a la reglamentacin invasiva de la fase anterior de racionalizacin, determinada por la razn de Estado. El sistema penal se haba enrolado en una perpetua interrogacin psicolgica o antropolgica sobre la naturaleza del criminal, esto es, una teora de la naturaleza humana que producira luego efectos normalizadores. Cada patrn antropolgico designara sus desviados. El neoliberalismo, por el contrario, no est engolfado por la voluntad de saber. Ante un crimen, slo se pregunta cunto cuesta cometerlo; nada de curiosear las peculiaridades subjetivas de quien lo comete. Despus de evacuar completamente cualquier principio de razn suficiente, slo quedan los principios econmicos del sujeto, con los que el neoliberalismo no se precipita por tanto en un saber psicolgico, un contenido antropolgico, del mismo modo que cuando hablaba desde el punto de visa del trabajador, no se haca una antropologa del trabajo (Foucault, 2004b, 257). Las expresiones que se rechazan, pese a la dificultad de comprender qu significan, estn muy prximas de las que se empleaban para caracterizar el proyecto de Bourdieu: La consideracin del sujeto como homo economicus no implica una asimilacin antropolgica de todo comportamiento, sea cual sea, con un comportamiento econmico. En suma, el neoliberalismo no proyecta sus modelos de ser humano en el individuo; stos, por increble que parezca, no ejercen efecto performativo alguno y no proyectan una nueva forma de normalidad; simple y llanamente, son el marco de inteligibilidad para comprender la conducta del sujeto. Los neoliberales son intelectuales muy precavidos que no confunden objeto real y objeto de conocimientos y, adems, controlan que la poblacin a la que liberan de las disciplinas no lo haga. Si se define as el crimen como la accin que comete un individuo tomando

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

182

el riesgo de ser castigado, dejan de existir cualquier diferencia entre una infraccin del cdigo de circulacin y un asesinato premeditado. Lo que quiere decir igualmente que el criminal, en ningn modo, en esta perspectiva, se encuentra marcado o interrogado a partir de rasgos morales o antropolgicos (Foucault, 2004b, 258). Y, ms adelante, seala: La sociedad no tiene necesidad alguna de obedecer a un sistema disciplinario exhaustivo. Una sociedad se encuentra bien con una cierta tasa de ilegalismos y se encontrara muy mal si quisiera reducir indefinidamente esta tasa de ilegalismos (Foucault, 2004b, 261). La plyade de categoras estancadas (asesinatos natos, criminales de ocasin, perversos y no perversos, reincidentes), capaces de cuadricular los comportamientos de una poblacin en sistemas de inclusin y exclusin, de generar en los individuos la culpabilidad si no se ajustaban a sus moldes, son barridas por el economicismo de los neoliberales (Foucault, 2004b, 264). El crculo terico se cierra y el mensaje, difuso, llega al lector. Se opuso el paradigma de la seguridad al de la disciplina; el primero que acta por umbrales, el segundo que presume la posibilidad de embridar los comportamientos de conjunto. Ambos modelos rompieron con la fundamentacin soteriolgica del poder medieval, fundado en la salvacin colectiva. An as, la modernidad conocer reactivaciones de conductas de resistencia basadas en una verdad histrica. Tales conductas, entre ellas, y muy especialmente, las inspiradas por el marxismo, carecen de modelos de gobierno que, no lo olvidemos, son los que permiten la libertad. Entre tales modelos de gobierno, existen unos que pretenden exportar la lgica gubernamental (seleccionando la poltica social slo segn criterios de apoyo a la concurrencia, ignorando toda interrogacin sobre los grados de crimen y la naturaleza de los criminales) al mbito de la poltica social y de lugar de mayor intensidad disciplinaria la poltica penal. Mtodo de gobierno que se nutre de la crtica de los economistas a los polticos; fuente de transformacin de los modelos disciplinarios en la modernidad y, nadie lo ignora, actores, que en el tiempo en que Foucault dictaba sus cursos, ejemplificaban a los contendientes en el conflicto neoliberal con el Estado keynesiano25.

En una entrevista concedida en Japn en 1978 (Foucault, 1994c, 532-534), Foucault, aunque confuso en la utilizacin de su marco terico, identifica la crisis econmica por la que pasan los pases occidentales con la crisis de la disciplina. Foucault apuesta por salir de la sociedad de disciplina, dado que la sociedad ha cambiado y los individuos tambin y cada vez existiran ms gentes diversas, diferentes e independientes. La manera de hablar de Foucault se diferencia muy poco de la de un tribuno de la modernizacin liberal. Y, aunque su modelo terico no puede ser reducido a ello, esta actitud poltica es coherente con el mismo: la diversidad es antidisciplinaria, pero no antisecuritaria, antiestatal pero no antiliberal.

25

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

183

El modelo neoliberal llega tan lejos porque olvida toda perspectiva de interrogacin basada en cuestiones psicolgicas o antropolgicas, palabras que Foucault explica poco, pero que ocupan en su discurso los mximos peligros y que tienen un efecto de una estigmatizacin no argumentada. Hay que creer en l para comprender la magnitud de tales peligros. En cualquier caso, estos no se encuentran en el neoliberalismo: cuidado de s de un individuo emprendedor de s mismo26. De ste, del neoliberalismo, se destacan sobre todo sus excelencias. De tales excelencias, con razn o sin ella (esa cuestin exige salirse de este marco analtico y hablar de muchas otras cosas que, desde l, ni se ven ni se nombran27), Foucault, de entre los muchsimos ex-izquierdistas que lo hicieron, aunque no sin ambigedades, fue un inteligente cantor. Al menos en un periodo de su complejo periplo intelectual.

Un pensamiento en tres frentes: a modo de resumen Campo poltico Sistema terico de Foucault 1. Cambio del concepto de biopoltica por el de gubernamentalidad. 2. Fin de la hiptesis Nietzsche y de la perspectiva de clase. 3. Privilegio analtico y criptnormativo del paradigma de la seguridad sobre el de la disciplina. Campo intelectual

1. Prximo a la nueva izquierda de Michel Rocard. 2. Asimilacin del marxismo y del socialismo real. Anticomunismo. 3. Guios al neoliberalismo.

1. Conflicto con Deleuze y con el izquierdismo. 2. Alianza con los nuevos filsofos. 3. Conflicto de demarcacin con Bourdieu y la sociologa crtica.

Conclusin Se ha intentado situar una etapa del pensamiento de Foucault mostrando, en primer lugar, las posiciones en el campo poltico de Foucault y de su crculo. Es importante

La incapacidad crtica del modelo de Foucault frente al neoliberalismo fue sealada por Dreyfus y Rabinow (1984, 354). 27 Cabra una instructiva comparacin, que exigira otro artculo, entre la obra de Foucault, en esta cuestin, y las reflexiones de Robert Castel (1983, 119-127 y 1984, 209-222)al que Foucault se refiere en algunas ocasiones sobre el advenimiento de una tecnologa post-disciplinaria. No tienen nada que ver: ni en periodizacin, ni en ambicin filosfica (mucho menor en Castel), ni en precisin (mucho mayor en el socilogo), ni en las evaluaciones (la fascinacin est completamente ausente del trabajo de Castel, persona ideolgicamente estable).

26

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

184

trazar bien esa cartografa para situar mejor las posiciones de Foucault en el mundo intelectual. De lo contrario, se puede caer en preguntas completamente equivocadas. Por ejemplo, pensar que las interesantes crticas que Poulantzas realiz a Foucault (Jessop, 2004, 89-90) podran habitar algo del nervio interno de los trabajos del filsofo de Poitiers. Del mismo modo, la ubicacin poltica de Foucault ayuda al menos matizar la procedencia de ciertas comparaciones. Puede, evidentemente, compararse la perspectiva de la gubernamentalidad con la idea de hegemona en Gramsci desde una actitud rebelde con el neoliberalismo (Lemke, 2004, 24); con la nocin de interpelacin ideolgica en Althusser y reelaborarla con una interesantsima teora de la melancola de cuo freudiano como la elaborada por Judith Butler (Le Blanc, 2004). Se puede hacer, y se debe hacer, como ejercicio filosficamente interesante en s mismo. Ahora bien: siempre situando correctamente la perspectiva que tenan cada uno de los universos de discurso comparados. De lo contrario, se puede entrar en un juego de semejanzas y diferencias, casi al lmite de la asociacin libre, en el que todos los ecos mutuos son posibles y todos los agrupamientos viables. Foucault, en la poca que he analizado, pensaba, obviamente fuera del psicoanlisis y al margen del marxismo (al margen de Marx, un pensador al que Foucault lea y admiraba, no) y dentro de universos de discurso progresivamente liberales representados por la fraccin de la izquierda a la que se acerc. Lo que tuvo profundas consecuencias tericas. Entre otras, el abandono de hecho del concepto de biopoltica: ste cuesta comprender por qu Foucault lo mantiene pasa a significar lisa y llanamente gobierno liberal (Foucault, 2004b, 23). Como se ha mostrado, el gobierno liberal no conoce lucha de clases, favorece la libertad y tiende a desemparejarse de las disciplinas (aunque conviva con ellas en una formacin histrica). En suma, no es la biopoltica en sus primeras versiones: tejida desde el conflicto de clases, con unas libertadas mediadas por los controles prepolticos, articulada con las disciplinas. Puede haber continuidades entre ambas nociones. Pero son distintas aunque queden recubiertas bajo un mismo trmino. Los cambios son mucho ms importantes: desde un punto de vista terico (en el que resuenan transformaciones importantes de Foucault y de su grupo, insisto: pues los procesos de pensamiento siempre se tejen en redes colectivas) y desde el punto de vista poltico. Por supuesto, no pretendo con ello limitar las utilizaciones de Foucault. No lo deseo porque es imposible. Foucault (1994e) analiz la existencia de autores que permitan el juego eterno del retorno al origen, del redescubrimiento, de la

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

185

actualizacin. Esos autores no fundaban un discurso regulado segn normas cientficas; sino una especie de campos de discursos donde todas las contradicciones podran aplanarse o explotarse o soslayarse o reinterpretarse de forma creativa: lo importante es que tales discursos se prestaban al comentario indefinido. Eran, deca Foucault, los fundadores de discursividad. Como Marx y Freud. Esos juegos con los fundadores de discursividad abren un campo de enunciacin inagotable, entre otras cosas, porque referirse a ellos proporciona la seguridad psicolgica de ocuparse de autores y

problemas consagrados y la seguridad institucional de que el propio discurso pasar los filtros de nobleza en este caso, los filtros de nobleza filosficos que permiten hablar sintindose legtimo. Foucault ha entrado en dicha industria. Paradjicamente, puede parecer, pues buena parte de sus gestos y de sus esfuerzos intelectuales fueron realizados en ruptura con la misma. Fuera de ella, queda el Foucault que ilumina articulaciones importantes de la realidad: hay mucho en sus trabajos que permite semejante clarificacin, nos gusten o no las opciones polticas con las que se escribieron. Como cualquier filsofo o intelectual importante (Marx, Pareto, Heidegger, Ortega, Althusser) sus conceptos estn transidos de poltica (que puede inocularse inadvertidamente cuando usamos aqullos) pero no se reducen a sta. La decisin de emplearlos debera depender de normas de economa cientfica (o, si se prefiere, intelectual): de cunto ayudan a ver que otros paradigmas impiden ver; de cunto ocultan, en comparacin con otros marcos, por su forma de plantear los problemas (Castro Orellana, 2007: 6). Utilizar dicho patrimonio analtico exige que lo valoremos crticamente. Y que pensemos a quien lo produjo, Foucault, con los mismos trminos con los que l, con toda razn, peda que se pensase a Marx: Es una existencia histrica y, desde ese punto de vista, slo es un rostro portador de la misma historicidad que las otras existencias (Foucault, 1994b, 602).

Bibliografa

Alonso, Luis Enrique (1999): Trabajo y ciudadana. Ensayos sobre la crisis de la sociedad salarial, Madrid, Trotta-Fundacin 1 de Mayo. (2007): La crisis de la ciudadana laboral, Barcelona, Anthropos. Althusser, Louis (1967): La revolucin terica de Marx, Mxico, Siglo XXI.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

186

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

187

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~

~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~ ~ ~~~~~ ~~~ ~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~ ~~~~ ~~ ~~ ~~~~~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~ ~ ~~~ phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

188

~~~~~~~~~~~~~~~

~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~ ~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~ ~ ~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~ ~~~~~~ ~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~ ~
~~~~~~~~~~~

~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

189

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~ ~~~~~~ ~~ ~~~~~~~ ~~~ ~ ~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

190

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~ ~

~~~~~ ~~~ ~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

191

~~~~~~~~~~~~~

~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~

~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~ ~


~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

192

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

193

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

194

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~

~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~ ~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~ ~~ ~~~~~~~~~~ ~~ ~~~~~~~~~~~~~ ~~~~~~~ ~~~~~ ~~~~~ ~ ~~~~~ ~~~~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~ ~~~~~~~ ~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~ ~ ~~ ~~~~~ ~~~~~~~~~~~ ~~~~~ ~~~ ~~~~~~~~ ~ ~ ~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~ ~ ~~~~~~~~~~ ~~~~~ ~~~~~~~~ ~ ~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~ ~~~~~ ~~~~~~~~~~~ ~~~ ~~ ~~~~~ ~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

195

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~ ~~~~~~~~ ~ ~~~~~~~~~~~~~~~~

~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

196

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

197

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~ ~~~ ~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~ ~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~ ~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

198

~~~~~~~~~~~~~~~

~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~

~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

199

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~ ~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

200

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~ ~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~ ~ ~~~

~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

201

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~

~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~ ~~~~~~~~ ~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~

~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

202

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~ ~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~

~~ ~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

203

~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~ ~~~~~~~~~~ ~~ ~~~~~~~ ~~ ~~~~~ ~~~ ~~~~~~~~~


~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

204

~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~

~~~~~~~~~~ ~ ~~~~~~~~~~~~~~
~~~

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

205

VARIACIONES SOBRE SEXO Y GNERO: .BEAUVOIR, WITTIG Y FOUCAULT1 Judith Butler No se nace mujer, se llega a serlo la ya famosa formulacin de Beauvoir afirma la no coincidencia de la identidad natural y la de gnero: Y porque lo que llegamos a ser no es lo que somos ya, el gnero se halla desalojado del sexo; la interpretacin cultural de los atributos sexuales es distinguida de la facticidad o simple existencia de estos atributos: El verbo "llegar a ser" contiene, no obstante, una ambigedad consecuencial. No slo estamos construidos culturalmente, sino que en cierto sentido nos construimos a nosotros mismos. Para Beauvoir llegar a ser mujer es un conjunto de actos intencionales y apropiativos, la adquisicin adems de ciertas destrezas para asumir un estilo y una significacin corporales culturalmente establecidos. Si se considera que "llegar a ser" significa "asumir o encarar intencionalmente", la declaracin de De Beauvoir parece ser portadora de la carga de la eleccin sartreana. Si los gneros son elegidos en cierto sentido, qu le ocurre entonces a la definicin de gnero como una interpretacin cultural del sexo, es decir, qu le ocurre a los diversos modos por los que, como si dijramos, ya estamos cultural mente interpretados? Cmo puede ser el gnero a la vez una cuestin de eleccin y una construccin cultural? Beauvoir no pretende describir en El segundo sexo una teora de la identidad de gnero ni de la adquisicin de gnero, y con todo su formulacin del gnero como un proyecto parece invitar a una especulacin sobre semejante teora. Monique Wittig, feminista francesa que escribi un artculo de gran influencia, "No se nace mujer" (1978), ampla la teora de Beauvoir sobre la ambigua naturaleza de la identidad de gnero, ese yo cultural que llegamos a ser pero que parece que siempre lo hayamos sido. Aun siendo distintas en aspectos cruciales, las posturas de Beauvoir y Wittig sugieren en comn una teora del gnero que intenta darle sentido cultural a la doctrina existencial de la eleccin. Gnero se convierte en el locus corpreo de significados culturales tanto recibidos como innovados. Y en este contexto la "eleccin" pasa a significar un proceso corpreo de interpretacin dentro de una red de normas culturales profundamente establecida. Cuando se concibe el cuerpo como un locus cultural de significados de gnero, deja de estar claro qu aspectos de este cuerpo son naturales o cules carecen de impronta cultural. Desde luego, cmo vamos a encontrar el cuerpo que preexiste a su interpretacin cultural? Si el gnero es la corporeizacin de la eleccin, y la aculturacin de lo corpreo, qu le queda entonces a la naturaleza, y en qu se ha convertido el sexo? Si el gnero es determinado en la dialctica entre cultura y eleccin, a qu papel sirve entonces el "sexo"? Y, deberamos concluir que la distincin misma entre sexo y gnero es anacrnica? Ha refutado Beauvoir el significado original de su famosa formulacin, o bien aquella declaracin tena ms matices de lo que originalmente suponamos? Para responder, tenemos que reconstruir la distincin que hace Beauvoir entre sexo y gnero, y considerar la vida que tiene su teora en la obra de Monique Wittig quien, de hecho, considera que la distincin es anacrnica. Pasaremos despus al rechazo de la categora de "sexo natural" por parte de Michel Foucault, lo compararemos con la postura de Wittig e intentaremos reformular el gnero como proyecto cultural.
1

Este artculo fue originalmente publicado como "Variations on Sex and Gender: Beauvoir, Wittlg and Foucault, Feminism as Cri. Tiq/Ut, University of Minnesota Press; 1982. Reproducimos la traduccin de Ana Snchez, que apareci en castellano en Teora feminista y teora crtica, Ensayos sobre la poltica de gnero en las sociedades de capitalismo tardo, Ediciones Alfons el Maghilnim, Valenca, 1990. Simone de Beauvoir, The Second Sex, Nueva York, Vintage Press, 1973, 301
1

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

206

CUERPOS SARTREANOS y FANTASMAS CARTESIANOS


La idea de que de algn modo nosotros elegimos nuestro gnero plantea un rompecabezas ontolgico. En principio podra parecer imposible que podamos ocupar una-posicin fuera del gnero en el fin de quedamos atrs y elegir nuestro gnero. Si siempre estamos generizados de antemano, inmersos en el gnero, qu sentido tiene decir que elegimos lo que ya somos? La tesis no slo parece tautolgica, sino que, en la medida que postula un yo elegido anterior al gnero que elige, parece adoptar una visin cartesiana del yo, una estructura egolgica que vive y medra con anterioridad al lenguaje y a la vida cultural. Esta visin del yo va contra los descubrimientos contemporneos de la construccin lingstica de la accin personal y, siendo ste el problema que siempre tienen los egos cartesianos aqu y all, su distancia ontolgica del lenguaje y la vida cultural excluye la posibilidad de su eventual verificacin. Si la afirmacin de Beauvoir quiere tener fuerza, si es verdad que "llegamos a ser" el gnero que tenemos a travs de algn conjunto volitivo y apropiativo de actos, entonces ella debe querer decir algo distinto al no situado acto cartesiano. Que la accin personal sea un prerrequisito lgico para adoptar un gnero no presupone que esta accin en s misma sea desencarnada, es decir, que no tenga cuerpo; desde luego, lo que llegamos a ser es nuestro gnero y no nuestro cuerpo. Para entender que la teora de Beauvoir est liberada del fantasma cartesiano, primero debemos establecer su concepcin de la identidad encarnada, y considerar sus meditaciones sobre las posibilidades de las almas desencarnadas. La conciencia tiene un estatus ontolgico discreto aparte del cuerpo es una cuestin a la que Sartre responde inconsistentemente a lo largo de El ser y la nada Esta ambivalencia respecto del dualismo mente/cuerpo cartesiano vuelve a emerger, aunque menos seriamente, en El segundo sexo de Beauvoir. De hecho, en El segundo sexo podemos ver el esfuerzo por radical izar la implicacin de la teora de Sartre relativa al establecimiento de una nocin encarnada de libertad. El captulo sobre el cuerpo de El ser y la nada contiene los ecos del cartesianismo que vagan por su pensamiento, aunque tambin evidencia sus esfuerzos por expulsar al fantasma cartesiano. Aunque Sartre argumenta que el cuerpo es coextensivo a la identidad personal (es una "perspectiva" de que uno vive), tambin sugiere que la conciencia de algn modo est ms all del cuerpo ("Mi cuerpo es-un punto de partida que yo soy y que al mismo tiempo sobrepaso"). En lugar de refutar el cartesianismo, la teora de Sartre asimila el momento cartesiano como un rasgo inmanente y parcial de la conciencia; la teora de Sartre intenta conceptualizar el rasgo desencarnado o trascendente de la identidad personal como algo paradjico aunque esencialmente relacionado con la conciencia en tanto que encarnada. La dualidad de la conciencia como algo a la vez encarnado y trascendente es intrnseca a la identidad personal, y el esfuerzo por localizar la identidad personal exclusivamente en uno u otro es, segn Sartre, un proyecto con mala fe. Aunque pueda leerse que las referencias de Sartre acerca de "sobrepasar" el cuerpo presuponen un dualismo mente/cuerpo, tenemos que entender esta autotrascendencia como un movimiento corpreo en s mismo, y volver a pensar de este modo tanto nuestras ideas usuales sobre la "trascendencia" cuanto las del mismo dualismo mente/cuerpo. Para Sartre, uno puede sobrepasar el cuerpo, lo que no quiere decir que uno quede definitivamente ms alldel cuerpo; la paradoja subversiva consiste en el hecho de que el mismo cuerpo, es sobrepasamiento. El cuerpo no es un fenmeno esttico ni autoidntico, sino un modo de intencionalidad, una fuerza direccional y un modo de deseo. En cuanto que condicin del acceso al mundo, el cuerpo es un ser llevado ms all de s mismo, que se refiere al mundo y
2

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

207

que con ello revela su estatus ontolgico en tanto que realidad referencia\. Para Sartre el cuerpo es vivido y experimentado como el contexto y el medio de todos los esfuerzos humanos. Porque para Sartre todos los seres humanos se esfuerzan por las posibilidades an no realizadas, los seres humanos estn en esa medida "ms alia" de s mismos. Esta condicin ek-esttica es en s misma una experiencia corprea; de este modo el cuerpo es experimentado como un modo del llegar a ser. Para Sastre desde luego, el cuerpo natural slo existe en el modo de ser sobrepasado: Nunca podemos aprehender esta contingencia como tal en la medida en que nuestro cuerpo es para nosotros; pues somos una eleccin y para nosotros ser es elegimos... Este cuerpo inaprehensible es precisamente la necesidad de que exista una eleccin, de que yo no existo todo en el mismo momento. Beauvoir no refuta a Sartre sino que toma de l su mejor aspecto anticartesiano. Sartre escribe en El ser y la nada que "sera mejor decir, usando 'existe' como un verbo transitivo, que la conciencia existe a su cuerpo". La forma transitiva de "existe" no queda muy lejos del uso conciliador que hace Beauvoir de "llegar a ser", y el concepto de Beauvoir de llegar a ser gnero parece a la vez una radicalizacin y una concretizacin de la formulacin sartreana. Al trasponer la identificacin de la existencia corprea y el "llegar a ser" al escenario del sexo y el gnero, Beauvoir se apropia de la necesidad ontolgica de la paradoja, pero la tensin de su teora no reside entre estar "en" y "ms all" del cuerpo, sino en la traslacin del cuerpo natural al cuerpo aculturado. Que no se nazca mujer, sino que se llegue a serio no implica que este "llegar a ser" atraviese un sendero de libertad desencarnada hasta la encarnacin cultural. Uno es, desde luego, su cuerpo desde el principio, y slo posteriormente llega a ser su gnero. El movimiento que lleva del sexo al gnero es interno a la vida corporeizada, como esculpir el cuerpo original dndole forma cultural. De mezclar la fraseologa sartrena con la de Beauvoir, podramos decir que "existir" el propio cuerpo en trminos culturalmente concretos significa, al menos parcialmente, llegar a ser el propio gnero. Aunque en opinin de Beauvoir "llegamos a ser" nuestro gnero, el movimiento temporal de este llegar a ser no sigue una progresin lineal. El origen del gnero no es temporalmente discreto precisamente porque el gnero no se origina sbitamente en algn punto del tiempo despus del cual su forma quedara fijada. En un sentido importante, no se puede rastrear el origen del gnero de forma definible porque l mismo es una actividad originante que est teniendo lugar incesantemente. Al dejar de ser entendido como el producto de relaciones culturales y psquicas pasadas hace mucho, el gnero es una forma contempornea de organizar las normas culturales pasadas y futuras, una forma de situarse en y a travs de esas normas, un estilo activo de vivir el propio cuerpo en el mundo.

EL GNERO COMO ELECCIN


Uno elige su propio gnero, pero no lo elige desde la distancia, lo que seala una unin ontolgica entre el agente elector y el gnero elegido. El espacio cartesiano del "elector" deliberado es ficticio, pero si las deliberaciones distanciadas del espectador no son las elecciones de las que habla Beauvoir, cmo vamos a entender entonces la eleccin en el origen del gnero? La concepcin que tiene Beauvoir del gnero como proyecto incesante, acto diario de reconstruccin e interpretacin, se inspira en la doctrina sartreana de la eleccin prerreflexiva y le da a esa estructura epistemolgica abstracta un significado cultural concreto. La eleccin prerreflexiva es un acto tcito y espontneo que Sartre denomina "cuasi-conocimiento". No siendo totalmente consciente, aunque no obstante s es
3

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

208

accesible a la conciencia, es el tipo de eleccin que hacemos y que nicamente nos damos cuenta de haberla hecho ms adelante Beauvoir parece apoyarse en esta nocin de eleccin cuando se refiere al tipo de acto volitivo por el que se asume el gnero. No es posible asumir un gnero en un instante, sino que se trata de un proyecto sutil y estratgico, laborioso y en su mayor parte encubierto. Llegar a ser gnero es un proceso, impulsivo, aunque cuidadoso, de interpretar una realidad cultural cargada de sanciones, tabes y Prescripciones. La eleccin de asumir determinado tipo de cuerpo, vivir o vestir el propio cuerpo de determinada manera, implica un mundo de estilos corpreos ya establecidos. Elegir un gnero es interpretar las normas de gnero recibidas de un modo tal que las reproduce y organiza de nuevo. Siendo menos que un acto de creacin radial, el gnero es un proyecto tcito para renovar una historia cultural en los trminos corpreos de. Uno. No es una tarea prescriptiva que tengamos que empeamos en realizar, sino una tarea en la que estamos empeados todo el tiempo. Al analizar los mecanismos de la accin y la apropiacin Beauvoir intenta, en mi opinin, infundir potencial emancipatorio al anlisis de la opresin de las mujeres, La opresin no es un sistema que se contenga a s mismo y o bien se enfrenta a los individuos como objetos tericos o bien los genera como sus peones culturales. Es una fuerza dialctica que requiere participacin individual a gran escala para mantener su maligna vida Beauvoir no se dirige directamente a la carga de libertad que el gnero presenta, pero podemos extrapolar de su postura hasta qu punto pueden funcionar las normas de gnero de manera constrictiva para sojuzgar el ejercicio de la libertad de gnero. Los constreimientos sociales acerca del acatamiento y la desviacin de gnero son tan enormes que mucha gente se siente profundamente herida si se les dice que ejercen su masculinidad o femineidad inapropiadamente. En la medida en que la existencia social requiere una afinidad de gnero que no sea ambigua, no es posible existir en un sentido socialmente significativo fuera de las normas de gnero establecidas. La cada de los lmites de gnero establecidos inicia una especie de dislocacin radical que puede asumir significacin metafsica. Si la existencia humana siempre es existencia generizada, entonces extraviarse del gnero establecido en cierto sentido es poner en cuestin la propia existencia. En los momentos de dislocacin de gnero en que nos damos cuenta de lo poco necesario que es que seamos los gneros que hemos llegado a ser, nos enfrentamos con la carga de la eleccin intrnseca a vivir como un hombre o como una mujer o como alguna otra identidad de gnero, libertad que se ha convertido en carga por el constreimiento social. La angustia o el terror de abandonar un gnero prescrito o de meterse sin derecho en otro territorio de gnero da testimonio de los constreimientos sociales sobre la interpretacin de gnero as como de la necesidad de que haya una interpretacin, i.e. De la libertad esencial que hay en el origen del gnero. De manera similar, la difundida dificultad de aceptar la maternidad, por ejemplo, como una realidad institucional ms que instintiva expresa esta misma interaccin de constreimiento y libertad. El esfuerzo por interpretar los sentimientos maternales como necesidades orgnicas desvela un deseo de disfrazar la maternidad como prctica opcional. Si la maternidad llega a ser una eleccin, qu ser posible entonces? Este tipo de cuestionamiento a menudo engendra vrtigo y tenor con respecto a la posibilidad de perder las sanciones sociales, de abandonar un puesto y un lugar social slidos. Que este tenor sea tan bien conocido le da el mayor de los crditos a la nocin de que la identidad de gnero descansa en el inestable lecho de roca de la invencin humana.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

209

ENCARNACIN Y AUTONOMA
El anlisis que Beauvoir hace del cuerpo se apoya en la situacin cultural en .la que los hombres tradicionalmente han sido asociados al rasgo caracterstico de la existencia humana no corprea o trascendente y las mujeres al rasgo caracterstico de la existencia humana corpreo e inmanente. Su concepcin de una identidad encarnada que "incorpore" la trascendencia no suscribe ninguna de las dos posturas. Aunque en ocasiones parece adherirse a una concepcin de la autoridad modelada sobre la trascendencia desencarnada de la conciencia, su crtica de esta perspectiva desencarnada sugiere que en su teora funciona implcitamente otra versin de la autonoma. Segn Beauvoir las mujeres son el "Otro" en la medida en que son definidas por una perspectiva masculina que intenta salvaguardar su propio estatus no corpreo, desencarnado, identificado a las mujeres generalmente con la esfera corprea. La desencarnacin masculina slo es posible a condicin de que las mujeres ocupen sus cuerpos en tanto que sus identidades esenciales y esclavizadoras. Si las mujeres son sus cuerpos (a distinguido de "existir" sus cuerpos, que implica vivir sus cuerpos como proyectos o portadores de significados creados), si las mujeres slo son sus cuerpos, si su conciencia y su libertad slo son otras tantas permutaciones disfrazadas de necesidad corprea, entonces la mujeres, en efecto, han monopolizado en exclusiva la esfera corprea de la vida. Al definir a las mujeres como el "Otro" los hombres pueden, valindose del atajo de la definicin, disponer de sus cuerpos, hacerse distintos de sus cuerpos -un smbolo de decadencia potencial, por lo general de limitacin- y hacer a sus cuerpos distintos de ellos. Desde esta creencia de que el cuerpo es Otro, no hay un gran salto a la conclusin de que los dems son sus cuerpos, mientras que el "Yo" masculino es un alma no corprea. El cuerpo situado como Otro -el cuerpo reprimido o negado y, entonces, proyectado- vuelve a emerger de este "Yo" en opinin de otros como esencialmente cuerpo. De ah que las mujeres lleguen a ser el Otro; vienen a incorporar la corporalidad misma. Esta redundancia se convierte en su esencia, y la existencia como mujer llega a ser lo que Hegel denominaba "una tautologa sin movimiento". La dialctica de Beauvoir del Yo y el Otro discute los lmites de una versin cartesiana de la libertad descorporeizada, y critica implcitamente el modelo de autonoma que defienden estas normas de gnero masculinas. La bsqueda de encarnacin necesariamente es engaosa porque el cuerpo nunca puede ser negado verdaderamente; su negacin se convierte en la condicin de su emergencia de una forma alienada. La descorporeizacin se convierte en una forma de existir el propio cuerpo en el modo de la negacin. Y la negacin del cuerpo -como en la dialctica de Hegel del amo y el esclavo- se revela como algo que no es sino la encarnacin de la negacin.

EL CUERPO COMO SITUACIN


Beauvoir sugiere una alternativa a la polaridad de gnero de la descorporeizacin masculina y la esclavizacin femenina del cuerpo en su nocin del cuerpo como "situacin". El cuerpo como situacin tiene al menos un significado doble. Como locus de interpretaciones culturales, el cuerpo es una realidad material que ha sido localizada y definida dentro de un contexto social. El cuerpo es tambin la situacin de tener que asumir e interpretar ese conjunto de interpretaciones recibidas. En tanto que campo de posibilidades interpretativas, -el cuerpo es un locus del proceso dialctico de interpretar de nuevo un conjunto de interpretaciones histricas que ya han informado al estilo corpreo. El cuerpo se convierte en un nexo peculiar de cultura y eleccin, y "existir" el propio cuerpo se convierte en una forma
5

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

210

personal de asumir y reinterpretar las normas de gnero recibidas. En la medida en que las normas de gnero funcionan bajo la gida de los constreimientos sociales, la reinterpretacin de esas normas mediante la proliferacin y variacin de estilos corporales se convierte en una forma muy concreta y accesible de politizar la vida personal. Si aceptamos el cuerpo como una situacin cultural, entonces la nocin de un cuerpo natural y, desde luego, de un "sexo" natural se hace cada vez ms sospechosa. Los lmites del gnero, la gama de posibilidades de una interpretacin vivida de una anatoma sexual mente diferenciada, parece menos restringida por la anatoma que por el peso de las instituciones culturales que convencionalmente han interpretado esa anatoma. Esto queda bien claro si llevamos la formulacin de Beauvoir a sus consecuencias no formuladas, acerca de si el gnero necesita estar vinculado al sexo de algn modo o bien este vnculo es en s mismo una convencin cultural. Si el gnero es una forma de existir el propio cuerpo, y el propio cuerpo es una situacin, un campo de posibilidades culturales a la vez recibidas y reinterpretadas, entonces tanto el gnero como el sexo parecen ser cuestiones completamente culturales. El gnero parece menos una funcin de anatoma que uno de sus posibles usos: el cuerpo de la mujer es uno de los elementos esenciales de su situacin en el mundo. Pero ese cuerpo no basta para definida como mujer; no hay verdadera realidad viva a excepcin de la que manifiesta el individuo consciente en sus actividades y en la intimidad de la sociedad.

LA POLTICA DEL CUERPO


Si el cuerpo natural-y el "sexo" natural- es una ficcin, la teora de Beauvoir parece preguntar implcitamente si es que el sexo no era gnero todo el tiempo. Monique Wittig formula explcitamente esta puesta en cuestin del "sexo" natural. Aunque Wittig y Beauvoir ocupan puestos muy diferentes del espectro poltico feminista en la Francia contempornea, estn no obstante unidas tericamente en su rechazo de las doctrinas esencialistas de la feminidad. El artculo de Wittig, "No se nace mujer", toma su ttulo de la formulacin hecha por Beauvoir, y fue presentado por primera vez en la conferencia Simone de Beauvoir en Nueva York en 1979. Aunque este trabajo no menciona a Beauvoir, despus de unos cuantos prrafos del principio, podemos leerlo no obstante como un esfuerzo por explicitar la teora tcita de Beauvoir de la adquisicin de gnero. Para Wittig la discriminacin misma de "sexo" tiene lugar dentro de un entramado poltico y lingstico que presupone, y por tanto requiere, que el sexo siga siendo didico. La demarcacin de la diferencia sexual no precede a la interpretacin de esa diferencia, sino que esta demarcacin es en s misma un acto interpretativo cargado de supuestos normativos sobre un sistema de gnero binario. La discriminacin siempre es "discriminacin" y la oposicin binaria siempre sirve a los propsitos de la jerarqua. Wittig se da cuenta de que su postura es contraintuitiva, pero lo que desea exponer es precisamente la educacin poltica de la intuicin. Para Wittig, cuando nombramos la diferencia sexual, la creamos; restringimos nuestro entendimiento de las partes sexuales relevantes a aquellas que ayudan en el proceso de reproduccin, haciendo con ello de la heterosexualidad una necesidad ontolgica. Lo que distingue a los sexos son esos rasgos anatmicos, que o bien se refieren a la reproduccin directamente, o son construidos para ayudar a su xito eventual. Por lo que Wittig arguye que la erogeneidad, la capacidad de respuesta sexual del cuerpo, es restringida por la institucionalizacin de la diferencia sexual binaria; se pregunta: por qu no nombramos como rasgos sexuales a nuestras bocas, manos y culos? Y responde: nicamente nombramos sexual -lase, sentimos sexual- los rasgos funcionales para la actividad reproductiva.
6

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

211

Su afirmacin es contraintuitiva porque vemos la diferencia sexual constantemente, y nos parece un dato inmediato de la experiencia. Argumenta: El sexo... Es tomado como un "rasgo fsico", un "dato inmediato", un dato sensible, perteneciente al orden natural. Pero lo que creemos que es una percepcin fsica y directa slo es una construccin sofisticada y mtica, una "formacin imaginaria", que reinterpreta los rasgos fsicos (en s mismos tan neutros como los dems pero marcados por un sistema social) mediante la red de relaciones en la que son percibidos. Al igual que Beauvoir, Wittig entiende el gnero como una proscripcin y una tarea; en efecto, el gnero es una norma que nos esforzamos por encarnar. Con palabras de Wittig: "Hemos sido obligados, en nuestros cuerpos y nuestras mentes, a corresponder, rasgo por rasgo, a la idea de naturaleza que se nos ha establecido" . El que nos experimentemos a nosotros mismos o a otros como "hombres" y "mujeres" son categoras polticas y no hechos naturales." La teora de Wittig es alarmante por una serie de razones, siendo la primera de ellas la insinuacin de que el discurso sobre el sexo crea el inapropiado nombre de anatoma. De ser ste el punto de vista de Wittig podra parecer que la diferenea sexual no tiene un fundamento material necesario, y que ver en los cuerpos diferencias, que resultan ser binarias, es un profundo engao que se han permitido las culturas de un modo casi universal. Afortunadamente, yo no creo que sea esto lo que Wittig afirma. Sin duda alguna existen diferencias que son binarias, materiales y distintas, y no nos hallamos atrapados por la ideologa poltica cuando asentimos a este hecho. Wittig debate la prctica social de valorizar determinados rasgos anatmicos como si fueran definitorios no slo del sexo anatmico sino de la identidad sexual. Seala que existen otros tipos de diferencias entre la gente, diferencias de forma y tamao, de formacin del lbulo de la oreja y el tamao de la nariz, y no preguntamos cuando un nio viene al mundo qu clase de lbulo de las orejas tiene. Preguntamos inmediatamente por determinados rasgos anatmicos sexualmente diferenciados porque suponemos que esos rasgos de algn modo determinarn el destino social de ese beb, y ese destino, cualquiera que sea, es estructurado por un sistema de gnero predicado sobre la supuesta naturalidad de las oposiciones binarias y, en consecuencia, de la heterosexualidad. Por tanto, al diferenciar a las criaturas del modo que lo hacemos recapitulamos la heterosexualidad como una precondicin de la identidad humana, y proponemos esta norma constrictiva disfrazndola de hecho natural. Wittig no discute, de este modo, la existencia o facticidad de las distinciones sexuales, sino que cuestiona el aislamiento y valorizacin de determinados tipos de distincin por encima de otros. El cuerpo lesbiana de Wittig es el retrato literario de una lucha ertica por reescribir las distinciones relevantes constitutivas de la identidad sexual. Los rasgos diferentes del cuerpo femenino son separados de sus lugares habituales y reagrupados de forma muy literaria. Reclamar diversas partes del cuerpo como fuentes de placer ertico es, para Wittig, la anulacin o reescritura de la restriccin binaria impuesta al nacer. La erogeneidad le es restaurada al cuerpo entero a travs de un proceso de lucha que en ocasiones es violento. El cuerpo de la mujer deja de ser regonocible como tal; deja de aparecer como un "dato inmediato de la experiencia"; es desfigurado, reconstruido y reconcebido. Emanciparse de ello consiste en la disolucin de la estructura binaria, en la emergencia del caos esencial, lo polimorfo, la inocencia precultural del "sexo". Podra parecer que Wittig ha entrado en un terreno utpico que nos deja al resto de las almas ubicadas esperando impacientemente a este lado de su espacio liberador imaginario. Despus de todo El cuerpo lesbiana es una fantasa, y no queda claro si se supone que nosotros,
7

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

212

lectores, vamos a reconocer un curso de accin potencial en ese texto, o simplemente vamos a quedar dislocados de nuestros supuestos habituales sobre los cuerpos y el placer. Ha decidido Wittig que las normas heterosexuales son normas culturales, mientras que las normas lesbianas son naturales por alguna razn? El cuerpo lesbiano que propone como algo que de algn modo es anterior y excede a las restricciones binarias verdaderamente s un cuerpo? Se ha apropiado la lesbiana del puesto del polimorfo psicoanaltico en la particular cosmogona sexual de Wittig? Ms que defender la superioridad de una cultura no heterosexual, Wittig concibe una sociedad sin sexo, argumentando que el sexo, al igual que la clase, es un constructo que debe ser depuesto inevitablemente. El programa de Wittig parece, desde luego, profundamente humanista en su exigencia de una erradicacin del sexo. Argumenta que: Ms all de las categoras de sexo (hombre y mujer) se puede encontrar una nueva definicin personal y subjetiva para toda la humanidad y que el advenimiento de los sujetos individuales exige destruir primero la categora de sexo, acabar con el uso de sta, y rechazar todas las ciencias que usen esas categoras como fundamentos (prcticamente todas las ciencias sociales). Por una parte Wittig exige una total trascendencia de sexo, pero su teora igualmente podra llevar a una conclusin inversa, a la disolucin de las restricciones binarias a travs de la proliferacin de gneros. Como la categora de "sexo" nicamente tiene sentido en trminos de un discurso binario sobre el sexo en el que "hombres" y "mujeres" agotan las posibilidades de sexo, y se relacionan entre s como opuestos complementarios, la categora de "sexo" siempre es subsumida bajo el discurso de la heterosexualidad. Por lo que Wittig argumenta que una lesbiana no es una mujer, porque ser mujer significa estar fijada en una relacin binaria con un hombre. Wittig no argumenta que la lesbiana sea otro sexo o gnero, pero afirma que el de lesbiana "es el nico concepto que yo sepa que est ms all de la categora de sexo". Pero incluso cuando Wittig describe a la lesbiana en relacin con esta oposicin binaria de "hombre" y "mujer", el hecho de que estar ms all de la oposicin sigue siendo un modo de estar relacionada con esa oposicin, desde luego una relacin binaria con ello. Con el fin de que la lesbiana evite ser atrapada en otra oposicin binaria, i.e.la oposicin con la heterosexualidad misma, "ser lesbiana" debe convertirse en un fenmeno cultural mltiple, un gnero sin esencia unvoca. Si las oposiciones binarias implican jerarquas, entonces postular una identidad sexual "ms all" de la cultura promete seguir estableciendo otro par de oposiciones que, a su vez, sugieren otra disposicin jerrquica; la cultura heterosexual hegemnica se establecer como el "Otro" para ese sujeto poscultural, y bien puede ocurrir que una nueva jerarqua sustituya a la antigua -al menos en la teora. Adems, definir la cultura como algo que se preocupa necesariamente de la reproduccin de las oposiciones binarias es apoyar un supuesto estructuralista que no parece ni vlido ni polticamente beneficioso. Despus de todo, si hay que superar las restricciones binarias en la experiencia, stas debern encontrar su disolucin en la creacin de nuevas formas culturales. Como dice Beauvoir, y Wittig debiera saber, fuera de los trminos de la cultura no hay ninguna referencia a la "realidad humana" que tenga significado. El programa poltico para superar las restricciones binarias debera preocuparse, por tanto, por la innovacin cultural ms que por mitos de la trascendencia. La teora de Wittig encuentra apoyo en el primer volumen de la Historia de la sexualidad de Foucault que tiene consecuencias improbables aunque significativas para la teora feminista. En su intento de subvertir la configuracin binaria de] poder, el modelo jurdico de opresor y
8

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

213

oprimido, Foucault ofrece algunas estrategias para la subversin de la jerarqua de gnero. Para Foucault, la organizacin binaria del poder, incluida la que est basada en estrictas polaridades de gnero, se efecta mediante la multiplicacin de formas de poder productivas y estratgicas. Por ello, a Foucault ya no le interesa el sueo marcuseano de una sexualidad sin poder, sino que ]e preocupa subvertir y disipar los trminos existentes del poder jurdico. En ese sentido, Wittig est paradjicamente ms cerca de la teora de la emancipacin sexual de Marcuse cuando imagina una identidad sexual y una sexualidad libres de relaciones de dominacin. En efecto, Foucault escribe en el momento de ]a desilusionada consecuencia de Eros y civilizacin de Marcuse, rechazando un modelo progresivo de historia basado en la liberacin gradual de un eros intrnsecamente liberador. Para Foucault el eros que se libera siempre est culturalmente estructurado, saturado de la dinmica del poder, y con ello suscitando implcitamente los mismos dilemas polticos que la cultura represiva a la que iba a liberar. No obstante, a] igual que Wittig, Foucault rechaza el "sexo natural" en tanto que dato primario, e intenta entender cmo "fue el despliegue de la sexualidad... Lo que estableci esta nocin de 'sexo"'. La categora de sexo pertenece a un modelo jurdico de poder que supone una oposicin binaria entre los "sexos". La subversin de los opuestos binarios para Foucault no es resultado de su trascendencia, sino de su proliferacin hasta un punto en e] que las oposiciones binarias dejen de tener sentido en un-contexto en el que las diferencias mltiples, no restringidas a las diferencias binarias, abunden. Como estrategias para hacer difuso el antiguo juego de poder de opresor y oprimido Foucault parece sugerir la "proliferacin" y la "asimilacin". Su tctica, si se le puede llamar as, no es trascender las relaciones de poder, sino multiplicar sus diversas configuraciones de tal modo que el modelo jurdico de poder como opresin y regulacin deje de ser hegemnico. Cuando los opresores mismos son oprimidos, y el oprimido desarrolla formas de poder alternativas, nos hallamos en presencia de una relacin pos moderna de poder. Para Foucault esta interaccin tiene como resultado valencias de poder nuevas y ms complicadas, y el poder de la oposicin binaria se hace difuso con la fuerza de ]a ambigedad interna. Para Foucault, ]a nocin de sexo natural no es ni primaria ni unvoca. E] propio "sexo", i.e. El propio yo sexual anatmicamente diferenciado, est ntimamente vinculado con e] "sexo" como una actividad y un impulso. La palabra compromete una variedad de significados que han sido apiados en un solo nombre para apoyar determinados fines estratgicos de la cultura hegemnica: La nocin de "sexo" permiti agrupar en una unidad artificial elementos anatmicos, funciones biolgicas, conductas, sensaciones, placeres, y permiti el funcionamiento como principio causal de esa misma unidad ficticia; como principio causal, pero tambin como sentido omnipresente, secreto a descubrir en todas partes: el sexo, pues, pudo funcionar como significante nico y como significado universal y Foucault no quiere seguir discutiendo la realidad material de los cuerpos anatmicamente discretos que Wittig disputa, sino que en su lugar se pregunta cmo llega a significar la materialidad del cuerpo ideas culturales especficas. De ah que, al final del vol. I de la Historia de la sexualidad imagine "una historia de cuerpos (que muestre) de qu forma se ha invertido lo que es ms vital y ms material de ellos" . Foucault lleva a cabo una fenomenologa de semejante "inversin" al publicar los diarios de Herculine Barbin, un hermafrodita del siglo XIX cuya ambigedad anatmica culmina en una "confesin" y un suicidio finales Y En su introduccin Foucault insiste en la irrelevancia de las categoras de gnero establecidas para la vida sexual de Alexina (Herculine):
9

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

214

Da la impresin -si se presta credibilidad al relato de Alexina- de que todo aconteca en un mundo de arrebatos, de tristezas, de placeres, de afectos tibios, de suavidades y amarguras, donde la identidad de los participantes y sobre todo del enigmtico personaje alrededor del cual todo se urda, no tuvieron ninguna importancia. Parece que Herculine escap al sexo unvoco y por tanto al sistema binario que gobierna al sexo, y para Foucault representa la literalizacin de una ambigedad en el sexo y en la identidad sexual que es el potencial suprimido de todo sexo o gnero adecuado y unvoco. Herculine Barbin, nuestro hermafrodita, no estn ni aqu ni all, aunque tampoco se encuentra en algn tercer lugar discreto. Es una amalgama de opuestos binarios, una configuracin y una pugna particulares de macho y hembra. Por motivo de su misteriosa intrusin en el dominio del varn es castigada y desterrada por las autoridades de la Iglesia, designada unvocamente como varn. Herculine no trasciende el sexo en la medida que lo confunde, y mientras que podemos considerar que su_cl stino hasta cierto punto es anatmico, est claro que los documentos legales y mdicos que dirigen su transgresin anatmica revelan una necesidad social urgente de reprimir el sexo justo a los dos usuales. Por lo que no es su anatoma, sino el modo en que es "invertida" esa anatoma, lo que causa problemas. Su situacin apurada revela en trminos grficos la urgencia y la estrategia societales por descubrir y definir la anatoma dentro de trminos binarios. Explotar el supuesto binario es uno de los modos de privar a la hegemona masculina y a la heterosexualidad compulsiva de sus premisas primarias ms atesoradas. Cuando, por otro lado, se hace de la diferencia sexual binaria una funcin de la ontologa, entonces las opciones de la identidad sexual son restringidas a los trminos heterosexuales tradicionales; y la heterosexualidad desde luego es reducida a una versin mtica de s misma, disfrazando su multiplicidad potencial tras una presentacin unvoca de s misma.

CONCLUSIN: ENCARNACIN DE LA DISONANCIA


Como conclusin, parece importante destacar que el desafo a un sistema de gnero didico que permite la teora de Beauvoir y que Wittig y Foucault ayudan a formular, tambin es implcitamente un desafo a las posiciones feministas que mantienen que la diferencia sexual es irreductible. Y que intentan dar expresin al aspecto distintivamente femenino de esa oposicin binaria. Si el sexo natural es una ficcin, entonces lo distintivamente femenino es un momento puramente histrico del desarrollo de la categora de sexo, lo que Foucault llama "el elemento ms especulativo, ms ideal y ms interno de un despliegue de la sexualidad organizado por el poder cuando aferra los cuerpos y su materialidad. El esbozo esquemtico de una teora de la invencin del gnero que aqu ha apuntado no supera los escollos existenciales del sartreanismo por el mero hecho de su aplicacin cultural. Al disponer de la proliferacin foucaultiana nos parece desde luego haber pasado a una idea de invencin radical, aunque sta emplee y despliegue convenciones culturalmente existentes y culturalmente imaginables. El problema de esta teora parece doble, y en muchos sentidos las objeciones que sin duda se suscitarn contra estas visiones son las mismas que, de forma alterada, se han suscitado contra la tesis existencial tanto desde la perspectiva marxista como desde la psicoanaltica. El problema marxista se puede entender como el de la constitucin social de la identidad personal y, por implicacin, de la identidad de gnero. No slo elijo mi gnero, y no slo lo elijo dentro de los trminos de que se dispone culturalmente, sino que por la calle y en el mundo siempre estoy siendo constantemente constituido por los otros, de tal modo que el gnero constituido por mi yo bien puede
10

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

215

encontrarse en oposicin cmica o incluso trgica con el gnero que otros me ven. Por ello, incluso la prescripcin foucaultiana de la invencin radical presupone una accin que, a la Descartes, definicionalmente elude la mirada fija del Otro. Puede que la objecin psicoanaltica sea la ms incisiva, ya que las teoras psicoanalticas de la identidad de gnero y de la adquisicin de gnero tienden a insistir en que lo que llegamos a ser en cierto sentido es lo que siempre hemos sido, aunque el proceso de llegar a ser es, por necesidad edpica, un proceso de restringir nuestra ambigedad sexual de acuerdo con los tabes del incesto que fundan la identidad. La ambigedad, sea sta descrita en el discurso de la bisexualidad o en el de lo polimorfo, siempre debe presuponerse, y la identidad de gnero establecida a la vez contiene y oculta esta ambigedad reprimida. Una proliferacin de gnero que supere las oposiciones binarias siempre constituira por tanto una vuelta a la ambigedad preedpica que, supongo yo, nos sacara de la cultura tal y como la conocemos. Segn la perspectiva psicoanaltica, el ideal normativo de multiplicidad de gneros siempre sera una mezcla peculiar de memoria y fantasa que se entendera en el contexto de un sujeto edpicamente condicionado en una lucha afectiva con el tab del incesto. Quiz constituya esto material para la gran literatura, pero no es necesariamente practicable en la lucha cultural por renovar las relaciones de gnero tal y como las conocemos. En efecto, si hablamos desde este punto de vista, yo he aportado aqu una fantasa preedpica que slo tiene sentido en trminos de un sujeto que nunca puede realizar esta fantasa. En este sentido, tanto el marxista hipottico como la objecin psicoanaltica formularan la acusacin de que la teora que he presentado carece de principio de realidad. Pero, desde luego, esa acusacin es engaosa, porque no est claro que el principio que gobierna esta realidad sea necesario, ni si otros principios de realidad se podran "inventar", como si dijramos, ni si estos principios contraintuitivos forman parte de las fantasas culturales que finalmente vienen a constituir nuevas organizaciones de la realidad. No tengo claro que la realidad sea algo establecido de una vez por todas, y haramos bien en instar a la especulacin sobre la relacin dinmica entre fantasa y la realizacin de nuevas realidades sociales. Buena parte de los estudios feministas franceses se han preocupado por especificar la naturaleza de lo femenino para establecer la cuestin de qu quieren la mujeres, cmo se deja conocer ese placer especfico, o cmo se representa a s mismo indirectamente en la ruptura del lenguaje logocntrico. Este principio de feminidad se busca en el cuerpo de la mujer, entendido unas veces como la madre preedpica y otras veces de manera naturalista como un principio pantesta que requiere su propio tipo de lenguaje para expresarse. En estos casos, el gnero no est constituido, sino que es considerado como un aspecto esencial de la vida del cuerpo, y llegamos muy cerca de la ecuacin biologa y destino, esa pugna entre hecho y valor, en cuyo intento de refutacin pas Beauvoir su vida. En un artculo titulado, "Las mujeres no pueden ser definidas", Julia Kristeva seala que "la creencia de que 'una es mujer' es casi tan absurda y oscurantista como la creencia de.que 'uno es hombre'" . Kristeva dice "casi tan absurdo" porque existen razones prcticas, estratgicas para mantener la nocin de mujer como una clase sin que importe su vaco descriptivo como trmino. Aceptando el argumento de Wittig de que la "mujer" es una categora poltica, Kristeva pasa a considerar si no podra haber una categora poltica til al respecto. Lo que nos lleva otra vez a la objecin marxista proferida ms arriba, y Kristeva est dispuesta a desprenderse del trmino por completo cuando se agote su eficacia poltica. Por ello concluye, "debemos usar 'somos mujeres' como un anuncio o eslogan para nuestras demandas. En un nivel ms profundo, no obstante, una mujer no puede 'ser'; es algo que ni siquiera pertenece al orden del ser" . Las mujeres es, de este modo, un significante sustantivo y unvoco falso que disfraza e
11

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

216

imposibilita una experiencia de gnero internamente variada y contradictoria. Y si, por volver a Beauvoir, las mujeres son un modo tal de llegar a ser que es detenido prematuramente, como si dijramos, mediante la imposicin reductiva de una nomenclatura sustancializadora, entonces la liberacin de la experiencia internamente compleja de las mujeres, experiencia que podra hacer del mismo nombre "experiencia de las mujeres" una significacin vaca, bien podra llegar a liberarse y/o precipitarse. Y la tarea aqu no es simplemente cambiar el lenguaje, sino examinar el lenguaje o en sus supuestos ontolgicos, y criticar esos supuestos en sus consecuencias polticas. En efecto, entender que la mujer existe en el orden metafsico del ser es entenderla como lo que ya est realizado, siendo autoidntica, esttica, pero concebirla en el orden metafsico del llegar a ser es inventar la posibilidad para su experiencia, incluida la posibilidad de no llegar a ser nunca una "mujer" sustantiva, autoidntica. Tales sustantivos seguirn siendo, desde luego, descripciones vacas, y pueden llegar a ser deseables otras formas de descripciones activas. No es sorprendente que Beauvoir derive su marco filosfico de la filosofa existencial, ni que Wittig parezca deberle ms a Beauva ir que a las feministas francesas que escriben a favor o en contra de Lacan. Ni tampoco sorprende que la teora de la sexualidad de Foucault y su historia de los cuerpos est escrita sobre la base de La voluntad de poder y la Genealoga de la moral de Nietzsche, cuyo mtodo de crtica existencial revelaba regularmente cmo se pueden reducir los valores que parecen naturales a sus orgenes culturales contingentes. El cuestionamiento psicoanaltico hace bien en recordamos lo profundamente enraizadas que estn las identidades sexual y de gnero y la cualificacin marxista refuerza la nocin de que el modo en que estamos constituidos no siempre es asunto nuestro. Bien podra ocurrir que Wittig y Foucault ofrecieran nuevas identidades que, a pesar de toda su cualificacin, siguieran siendo utpicas. Pero es til recordar la lectura que hace Gayle Rubin del psicoanlisis como la reconstruccin de estructuras de parentesco bajo la forma de las modernas identidades de gnero. Si ella tiene razn al atender la identidad de gnero como el "rastro" del parentesco, y al sealar que el gnero se ha liberado cada vez de los vestigios del parentesco, nos parece entonces justificado concluir que la historia del gnero bien pudiera revelar la liberacin gradual del gnero de sus restricciones binarias. Ms an, cualquier esfuerzo terico por descubrir, mantener o articular una feminidad esencial debe enfrentarse con el siguiente problema moral y emprico: qu ocurre cuando las mujeres individuales no se reconocen en las teoras que les explican su esencia insuperable? Cuando lo esencial femenino se articule por fin, y lo que hemos estado llamando "mujeres" no puedan verse a s mismas en esos trminos, qu concluiremos entonces? Que esas mujeres estn engaadas, o que de ningn modo son mujeres? Podemos argumentar que las mujeres tienen una esencia ms inclusiva, o podemos volver a esa prometedora sugerencia de Simone de Beauvoir, a saber, que las mujeres no tienen ningn tipo de esencia, y por tanto no tienen necesidad natural, y que, desde luego, lo que llamamos una esencia o un hecho material simplemente es una opcin cultural reforzada que se ha disfrazado de verdad natural.

12

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

217

RETRICASDELGNERO/POLTICASDEIDENTIDAD:performance,performatividadyprtesis Direccin:BeatrizPreciado Direccingruposdelecturaydiscusin:MJosBelbel,AzucenaVieites,FefaVila Sede:AuladelRectoradodelaUniversidadInternacionaldeAndaluca(UNIA)ySalaEndanza Fecha:1723demarzode2003 Invitadas: Mara JosBelbel, Azucena VieitesyFefaVila(direccin grupos delectura y discusin);Judith Halberstam,MarieHlneBourcier,MyriamMarzouk.
Resumendelassiguientessesionesdetrabajo: Sesin1>>Feminismoyperformancedegnero Sesin2>>Imitacin,mascarada,parodiaodecomolanocinde"performance"llegahastalascienciassociales Sesin3>>Performancesdegneroypolticasdelperformativo:laaportacindelateora"queer"

Entreel17yel23demarzosehacelebradoenelAuladelRectoradodelaUniversidadInternacionalde Andaluca (UNIA) el seminario Retricas del gnero / Polticas de identidad donde se ha analizado la re definicin de gnero en trminos de performance postulada por las prcticas y teoras queer que comenzarona desarrollarseaprincipiosdeladcadadelos90.DirigidoporBeatrizPreciado,autoradel libroManifiestocontrasexual,elseminario profundizen elorigenmultidisciplinar ytransversalyen las mltiples implicaciones polticas y sociales de esta redifinicin de la identidad de gnero que se opone tantoalaimposicinnormativadeciertasformasdemasculinidadyfeminidadcomoalaconcepcindel feminismoclsicoquecreeenlaexistenciadeunaverdadprediscursivadeladiferenciasexual. Dequhablamoscuandohablamosdegnero? Para explicar y contextualizar el profundo "giro performativo" que ha supuesto este cambio en la nocin de gnero, Beatriz Preciado analiz durante la primera jornada de este seminario la transformacinhistricaquehaexperimentadoelconceptodesexualidad."Elsentidodelttulodeeste curso, seal Beatriz Preciado, hace referencia a la multiplicidad de caminos y discursos tericos (retricas) que han contribuido a pensar y reflexionar sobre el gnero". El feminismo clsico y esencialista (una de esas retricas) se estructura a partir de una especie de ontologa biolgica de la diferencia sexual que defiende la existencia de una lnea de continuidad entre tres nociones diferenciadas: sexo, gnero y orientacin sexual. Desde esta perspectiva terica, el sexo sera algo natural, un imperativo biolgico que se identifica con los genitales, mientras la diferencia de gnero derivara de una construccin social y simblica vinculada a un proceso dialctico de dominacin y opresin (en el que los opresores seran los hombres y las oprimidas las mujeres). Beatriz Preciado consideraqueesavisinnosepuedeentenderalmargendelperiodohistricoydelatradicintericay cientficaenlaquesegesta. En su intento de aproximacin analtica al concepto de gnero, Preciado recurre a la tipologa de Foucault que establece una diferencia histrica entre sociedades soberanas, disciplinarias y de control. Segn Foulcault en las sociedades soberanas (hasta el SXVIII) hay una equivalencia jurdicosimblica entre el crimen y el castigo, y el poder (un poder negativo puesto que slo puede decidir de la muerte) se articula en torno a la figura de un soberano nico que decide sobre la muerte de sus sbditos. Por el contrario, en las sociedades disciplinarias y de control, el poder depende de la capacidad de producir la vida (demografa, polticas de control de la reproduccin,...), no en darla o quitarla, el soberano se transforma en una instancia colectiva y desaparece la equivalencia directa entre la falta y el castigo. En estas sociedades que tienen su origen en la revolucin francesa, hay una dinmica institucional de correccin y regulacin sistemtica de los espacios (por ejemplo, la prisin, el hospital, la escuela, la caserna militar, etc.), cuyo objetivo es la regulacin del cuerpo y la transformacin de los hbitos de conducta. SegnBeatrizPreciadosepuederealizarunacorrespondenciaentreestasformasdedivisindelpodery un anlisis histrico de los regmenes de produccin de la sexualidad en la civilizacin occidental. En este sentido Preciado considera que se podra hablar de una sexualidad premoderna, moderna y posmoderna. Las fronteras entre los distintos periodos de esta historia de la sexualidad son difusas, aunque para la autora de Manifiesto contrasexual s existen algunos puntos de inflexin (marcados por una serie de "fechasfetiches") en los que se producen cambios muy significativos que determinan la transformacindelasidentidadesdegnero.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

218

En este sentido, Thomas Laqueur seala en su libro Making sex que hasta el siglo XVII exista un slo sexo, el masculino, con una variable dbil y decadente que se asociara a la feminidad. Esta certeza era fruto de los estudios mdicos de la poca que crean en la existencia de una especie de rgano sexual universalque serepresentabaenforma U (derivando en masculinosiestabaparaafuera yenfemenino si se encontraba hacia adentro). Posteriormente apareci un nuevo rgimen visual de la sexualidad, un nuevo paradigma epistemolgico, para el que los rganos genitales constituan el elemento clave de la diferencia sexual. "Hasta entonces, recuerda Beatriz Preciado, el criterio que determinaba la feminidad ola masculinidad de una persona era la capacidad reproductiva y no se consideraba importante la morfologa de los genitales". La diferencia sexual y la diferencia entre homosexualidad y heterosexualidadsonregmenesderepresentacindelasexualidadrelativamenterecientes. No es hasta el siglo XVII cuando la representacin mdica de la anatoma sexual produce la diferencia sexual entre lo masculino y lo femenino. Del mismo modo que no es hasta finales del siglo XIX, cuando diversos estudios asociados a la ciencia mdica fijaron por primera vez la distincin lingstica y conceptual entre homosexualidad y heterosexualidad, entre perversin sexual y normalidad. Los "sujetos sexuales" aparecen as como una invencin moderna que comenzar a cuestionarse hacia mediadosde1950. A mediados del siglo XX, comenz a gestarse una nocin de la sexualidad que pona en duda la relacin causal entre sexo y gnero, esto es, que cuestionaba la idea de que el sexo es una instancia biolgica predeterminada y fija que sirve como base estable sobre la que se asienta la construccin cultural de la diferencia de gnero. Segn Beatriz Preciado, si extendemos los anlisis del poder y la sexualidad de FoucaultalsigloXX, podemossealarunpuntodeinflexinfundamental(otrafechafetiche)entornoa 1953, coincidiendo con la aparicin pblica de Christine Jorgensen, la primera transexual meditica estadounidense. Ese ao, John Money, un pediatra norteamericano especializado en el tratamiento de nioscon problemas de indeterminacin de la morfologa sexual, utiliz por primera vez la nocin de gnero (palabracastellanaquederivadeltrminoanglosajngender)parareferirsealaposibilidadquirrgicay hormonaldetransformarlosrganosgenitalesdurantelosprimeros18mesesdevida."Estosuponaun cuestionamientoabsoluto,subrayBeatrizPreciado,delrgimensexualbipolardela modernidad,dela epistemologa visual sobre la que se haba construido el conocimiento de la sexualidad". Adems para Preciado es muy significativo el hecho de que el concepto de gnero no apareci en el mbito de los estudios sociolgicosyhumanistas, sino asociadoa lamedicinaya lastecnologasde intervencin de la sexualidad. JohnMoneyjustificabaestasintervencionesquirrgicasenlosbebsconproblemasdeindeterminacin sexualcomoelnicomedio paraposibilitarsuadaptacinalavidafamiliaryalalgicaproductivadela sociedad. Lo llamativo es que esta prctica (que supuso la aplicacin artificial y cruel de un proceso de seleccin sexual de corte darwinista) slo comienza a ponerse en cuestin hacia finales de los aos 90 cuando se constituyeron las primeras asociaciones de intersexuales en los EE.UU que exigan poder accedera sus historiales mdicos y reclamaban el derecho de todocuerpo a elegir las transformaciones quesellevenacabosobresumorfologagenital. ParaPreciadoestehechoilustracomolosdispositivosinstitucionalesdepoderdelamodernidad(desde la medicina al sistema educativo, pasando por las instituciones jurdicas o la industria cultural) han trabajado unnimemente en la construccin de un rgimen especfico de construccin de la diferencia sexual y de gnero. Un rgimen en el que la normalidad (lo natural) estara representado por lo masculino y lo femenino, mientras otras identidades sexuales (transgneros, transexuales, discapacitados,...)noseranmsquelaexcepcin,elerroroelfallo,monstruosoqueconfirmalaregla. Lasteorasyprcticasqueers "Las teoras queers, subray Beatriz Preciado, ponen en cuestin la distincin clsica entre sexo y gnero, haciendo hincapi en el hecho de que la nocin de gnero apareci en el contexto del discurso mdico como un trmino que haca referencia a las tecnologas de intervencin y modificacin de los rganos genitales y cuyo nico objetivo era llevar a cabo un proceso de normalizacin sexual". Para

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

219

Preciado es necesario y urgente desde un punto de vista poltico repensar el autntico sentido de la dicotoma sexognero (presentada convencionalmente como una relacin natural), y entender dicha dicotomacomoelresultadodeaplicarunconjuntodedispositivospolticoseideolgicos.Lasexualidad no sera algo biolgico, sino una construccin social, una tecnologa, y slo trascendiendo la dicotoma entre sexo y gnero se puede articular un discurso y una accin poltica que rompa con la labor normalizadoraymutiladoradeladiferenciasexual. Queer en sentido literal significa maricn, bollera, aunque por extensin designa todo lo que sexualmentenoesnormativo(desdel@strabajador@ssexualesalossadomasoquistas).Elmovimiento queer apareci a principios de los 90 en el seno de la comunidad gay y lesbiana de los EE.UU. En ese contexto, una minora (no en su connotacin cuantitativa, sino en el sentido que este trmino adquiere enelpensamientodeGillesDeleuzecomopotencialrevolucionariofrentealanormainstitucionalizada) decidi autodenominarse con este trmino despectivo para diferenciarse (establecer una distancia poltica) de las iniciativas que buscaban la construccin de una identidad estable (una normalizacin) para los gays y lesbianas. "Unas iniciativas, record Beatriz Preciado, que con frecuencia se olvidan del restodelasvariantesposiblesdelasexualidadyterminanlimitandosuluchaalaobtencindederechos yprivilegios". La cultura queer (que engloba a grupos como Queer Nation, Radical Furies o the Lesbian Avangers) planteaunaposicincrticaconrespectoalosefectosnormativosdetodaformacinidentitaria,noslo lasexualsinotambinlasreferidasalarazaoalaclase.As,frentealosanlisisfeministasclsicosyde los grupos de gays y lesbianas ms liberales que aplican un enfoque dialctico para valorar la opresin, las teoras queers consideran como su objetivo prioritario llevar a cabo un acercamiento transversal a losdispositivossocialesdesumisinydominio. Se trata de un movimiento postidentitario, pero que ante una situacin de opresin concreta decide poner en marcha estrategias hiperidentitarias que hagan visible la posicin de ciertas minoras. "Pero siempre, seal Beatriz Preciado, desde la conciencia de que la configuracin de esa hiperidentidad no es fruto de un proceso natural sino algo construido que adems puede generar exclusin". Es decir, las teoras queers deben enfrentarse y resolver ciertas paradojas ya que al mismo tiempo que reivindican una identidad propia, critican la supuesta naturalidad de las identidades. Por ello no tratan de crear espacios de dualidad y dicotoma (en los que el enemigo y el objetivo a alcanzar est claro) sino de aplicar un anlisis transversal y cruzado que complica mucho las estrategias polticas a desarrollar pero dotanasuaccindiscursivadeunagrancomplejidadtericaydeunenormepotencialsubversivo. Segn Beatriz Preciado el movimiento queer converge con el postfeminismo al implicar una revisin crtica de las luchas feministas. Frente al feminismo liberal, heterosexual y de clase media que busca la igualdad del sujeto poltico mujer con el sujeto poltico hombre (la normalizacin), el postfeminismo incorporaotroselementosidentitarioscomolasreivindicacionesdeclaseyraza.Frentealfeminismode la diferencia que ya integra la nocin de cuerpo pero define a la mujer en clave esencialista (y habla de unaidentidadfemeninanaturalconunaseriederasgosintrnsecos:instintomaternal,sensibilidad,...),el postfeminismo concibe el cuerpo (y no slo el cuerpo de la mujer) como el efecto de un conjunto de tecnologassexuales. Perolasteorasyprcticasqueersnorepresentanunmovimientode emancipacinquepidelaadquisicindederechosenvasdeunreconocimientosocialydeunprogreso econmico(principalycasinicareivindicacindemuchosmovimientosfeministasydehomosexuales), sino que plantean una contestacin integral de la categora de sujeto de la modernidad. "Por ello, subrayBeatrizPreciado,paralateoraqueeresnecesarionoasumirlosdiscursos/dispositivosdepoder de la hegemona". Por el contrario, debe intentar reapropiarse de nociones abyectas (como el propio nombrequedesignaalmovimiento)quenopuedenserasimiladasconrapidezporelsistemacapitalista. Perfomancesdegneroenelfeminismoradicaldelosaos70 A partir de los trabajos de Teresa de Lauretis, Judith Butler o Eve K. Sedgwick, las teoras queers cuestionanlaideadeunsujetopolticomujer(ydeunsujetopolticohomosexual)paraponerelacento enlaideadesubjetividadperformativa.EnElgneroendisputa,Butlerutilizalanocindeperformance para desnaturalizar el gnero y mostrar que el sexo es un efecto performativo (realizativo en una

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

220

traduccin ms literal) de los discursos de la modernidad (desde la medicina a la institucin educativa). Es decir, la nocin de performance adoptada por la teora queer cuestiona el origen biolgico de la diferenciasexual. Segn Beatriz Preciado los antecedentes de la apropiacin del concepto de performance para explicar, repensar y parodiar la identidad de gnero hay que buscarlo tanto en las primeras apariciones de las Drag Queens como en las intervenciones en los espacios pblicos a travs del cuerpo de una serie de grupos feministas radicales norteamericanos de la dcada de los 70. Algunas de estas intervenciones estn recogidas en el filme Not for sale de Laura Cottingham (proyectado durante la primera y quinta jornada del seminario), un documental que se acerca al arte feminista y lesbiano de los EE.UU con imgenes de propuestas de colectivos como Woman House Project y artistas como Adrian Piper, Nancy Buchanam,AnaMendietaoMarthaRosler. Haydostcnicasfundamentaleseneldiscursoestticopolticodeestegrupodeartistasfeministas: Las performances del cuerpo que se conciben como un medio para llevar a la prctica el eslogan "lo privado es poltico". Para estas creadoras, el cuerpo y la experiencia personal es el espacio poltico por excelencia, por ello sus performances no tienen como objetivo producir una representacin para que el espectadorlaveadeformapasiva,sinogeneraruna"experiencia"que posibilitelaransformacinsocial y personal, una experiencia que el feminismo de los aos 70 concibe como un proceso de aprendizaje, unmododeproduccindeconocimientoquehaceposiblelaaccinpoltica. La "toma de conciencia" como mtodo de accin poltica que consiste en sacar al espacio pblico la palabra que hasta ese momento haba quedado relegada al espacio privado (algo parecido a lo que quiso hacer el psicoanlisisa principios del siglo XX). En este sentido resultan muy significativas las propuestasdeSarachildquedotanaestasprcticasdeunvalorteraputicoypoltico.Sonproyectosde carcter colectivoen el quegrupos demujeressereunan haciendo circularla palabra unasveces sobre asuntosaparentementebanalesotrasrelacionadasconlaintimidad,oelcuerpo,mientrasalgunasdelas participantes realizaban una teatralizacin de lo que se estaba contando."Gracias a esta escenificacin, indic Beatriz Preciado, se produca una especie de liberacin colectiva, una autntica catarsis poltica cuyo objetivo era modificar las estructuras de conocimiento y de afecto. En definitiva, se trataba de producirunnuevosujetopoltico". Woman House Project surge de un grupo de trabajo que se form en el Fresno College (California) en torno a Judith Chicago y Mryam Shapiro para luchar contra las implicaciones sexistas de los sistemas de produccin, distribucin y representacin del arte. El contexto social y poltico de la poca hizo posible que Judith Chicago y su grupo de trabajo pudiese disponer durante un breve periodo de tiempo (6 meses) de una casa con 16 habitaciones donde podan producir y exhibir arte sin ningn tipo de mediacin ni control. A travs de instalaciones (transformaron integralmente todas las habitaciones de la casa), sesiones de tomas de conciencia (las propuestas de Sarachild), performance que muestran el trabajo domstico como un proceso de repeticin regulado (por ejemplo, una escenificacin de un planchadoatiemporeal)orepresentacionesritualizadasquereleenlavidadelamujerentrminosde esperapasiva(WaitingdeFaithWilding),estasartistasfeministasarticularonunaprofundacrticadelas estrategias de territorializacin del gnero que asocian lo femenino con el espacio domstico, privado, interior,cerradoylomasculinoconelespaciopoltico,pblico,profesional,exterior. Una de las performances del Woman House Project que mejor conecta con el anlisis de gnero de la teoraqueeresTheCuntandCockPlayenlaquelosrganosgenitalesrepresentanpormetonimiatodo elcuerpomasculinoyfemeninoatravsdelaescenificacindeundesconcertanteeirreverentedilogo entre una polla y un coo. "En esta performance, asegur Beatriz Preciado, se lleva a cabo una deconstruccin no slo del gnero sino tambin de la sexualidad al presentarla como un proceso de repeticin regulado, lo que conecta directamente con los planteamientos de la teora queer". En esta misma lnea de politizacin del espacio domstico se sitan las propuestas de otras artistas estadounidenses de la poca como Martha Rosler (su performance Semiotic of kitchen descoloca a los espectadoresinvirtiendoelusoaparentementenaturaldeunaseriedetilesdecocina)oIleneSegalove (su obra Advice from home pone de manifiesto la existencia de unos mtodos y de un saber domstico queatesoranlasmujeresperoquesocialmentenosevaloracomounafuentedeconocimientos).

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

221

LafeminidadcomomascaradaenlainterpretacinpsicoanalticadeJoanRivire. A partir de las reflexiones de Ernest Jones sobre la sexualidad femenina, Joan Rivire, una de las primerasmujeresqueconsiguihacerseunhuecoenloscrculosacadmicospsicoanalticos,publicen 1929 un artculo (Womanliness as a Mascarade) en el que defina la feminidad como mascarada. E. Joneshabaestablecidounesquemadedesarrollodelasexualidadfemeninasubdivididoendosgrandes grupos homosexual y heterosexual a los que Jones aada perplejamente varias formas intermedias. De esas formas intermedias haba una que interesaba especialmente a Joan Rivire: la de aquellas mujeresque,peseasuorientacinheterosexual, presentabanrasgosmarcadosdemasculinidad(yalas que denominaba "mujeres intermedias"). "Un tipo de mujer heteromasculina, puntualiz Beatriz Preciado, que rompa con la causalidad aparentemente natural que enlaza sexo, gnero y orientacin sexual." Para el psicoanlisis de aquella poca, la diferencia entre desarrollar una orientacin homosexual y heterosexualestabadeterminadaporelgradovariabledelaangustia.Tomandocomoreferencialaidea de S. Ferenczi de que ciertos hombres homosexuales luchan contra su orientacin exagerado su heterosexualidad, Rivire cree que estas mujeres intermedias utilizan la mscara de la feminidad para "alejarlaangustiayevitarlavenganzadeloshombres".Enestesentidoserefiereauntipoespecficode mujer heterosexual que intenta abrirse camino en mbitos acadmicos y profesionales (espacio pblico y poltico reservado a los hombres) y a la vez participa de los roles clsicos de la feminidad (buena ama de casa, esposa atenta, marcado instinto maternal,...). Y toma como ejemplo el caso de una paciente (donde podemos encontrar una evocacin narrativa de su propia biografa) que debe utilizar el habla y la escritura (algo impropio de las mujeres de su poca) en el desarrollo de su labor profesional. La angustia de esta paciente se manifestaba tras sus intervenciones en el espacio pblico y le llevaba a sentir un deseo de coquetear histricamente con todos los hombres que poda (especialmente con aquellosquelerecordabanasupadre). Segn Riviere esta paciente pertenecera al grupo de mujeres homosexuales, aunque no estuviera interesadaporotrasmujeres.Esdecir,unamujercuyaorientacinsexualseralahomosexualidad,pero noassusprcticassexuales."Siempreteniendoencuenta,aclarBeatrizPreciado,quehastamediados del siglo XX la homosexualidad se entenda como inversin de gnero y no como relacin entre individuos del mismo sexo". Esta inversin le generaba a su paciente una terrible angustia (pues provocaba la censura del resto de los hombres) que slo lograba sortear si utilizaba la feminidad como una mscara, como un disfraz que camuflara sus rasgos marcados de masculinidad y evitara las represaliasdeloshombresporhaberentradoensuterritorio(elmbitopblico,elespaciopolticoyde lapalabra). Estanocindelafeminidadcomomscaraformuladahacemsde70aosnosremiteya,comopusode manifiesto Butler, al concepto de performance, a la idea de que el gnero es una construccin cultural, una elaboracin poltica y no algo natural. Pero Rivire y todo el aparato discursivo psicoanaltico posterior mantiene la dicotoma entre masculinidad y feminidad, otorgando a lo masculino un valor originario (natural) y subrayando de lo femenino su carcter de mscara. "La cultura queer, asegur Beatriz Preciado, vamuchoms all,alplantearqueno existetal dicotoma,ni siquieradiferencia entre una feminidad/masculinidad verdadera y otra impostada, sino que toda identidad de gnero es una perfomance,unamascarada". Performancesdegneroypolticasdelperformativo:laaportacindelateoraqueer Una definicin genrica de performance como proceso de repeticin regulada (que abarca desde el ritualalamascarada,pasandoporeltravestismoolasrepresentacionespardicas)permiteasociareste concepto con la idea de performatividad como acto lingstico y a su vez evitar la excesiva estetizacin que ha adquirido el trmino en el mundo del arte (donde se ha neutralizado su carga poltica). Las teorasqueers,quenacendeuncrucemetodolgicoydisciplinario,hanexplicadoelgneroentrminos de performance, una tesis que en los textos fundacionales de Judith Butler se desarrolla a partir del anlisisdelaculturaDragQueen. "Pero Judith Butler, indic Beatriz Preciado, se basa exclusivamente en el anlisis de las performances de la feminidad, y se apoya todava en el discurso psicoanaltico que conceba la feminidad como

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

222

mascarada y la masculinidad como algo natural". Para la autora de Manifiesto contrasexual las teoras queers deben articular una visin sobre el amor, el placer y la sexualidad completamente alternativa al psicoanlisis,unadisciplinaquesurgedeunacosmovisin burguesayfundamentalmentecolonialyque sesustentasobrela nocin delsujeto(masculino)de lamodernidad.SegnBeatrizPreciado,apartir de los aos 60 se ha abierto un espacio poltico y social en el que los presupuestos psicoanliticos no encajan. Unodelosproblemasdelateoraqueer,almenosensuformulacinbutleriana,esqueintentaconciliar dosplanteamientosfilosficosdistintossobreelsujetoyelpoder.Porunlado,lostextospsicoanalticos quedescriben elpodercomocensura,comoinstanciade represin,yvenlarelacinentreelsujetoyel discurso en trminos dialcticos (planteando que existe un deseo que antecede al sujeto, una pulsin anterior al lenguaje y al discurso). Por otro lado, los anlisis de Foucault sobre la sexualidad (que Preciado completara y matizara con las reflexiones de Monique Wittig y los trabajos de Deleuze y Guattari)enlosqueseconcibeelsujetocomoproductodeldiscursoyelpodercomoproduccin. En su libro The straight mind (1980) Monique Wittig, activista y ensayista lesbiana fallecida recientemente, defina el sexo y el gnero como una construccin y consideraba las actividades asociadas a lo femenino (la reproduccin, el matrimonio, el cuidado de los hijos,...) como elementos de una cadena de produccin social y demogrfica destinada a la reproduccin de la vida. Wittig calificaba la heterosexualidad no ya como una prctica sexual sino como un rgimen poltico (un sistema de produccincapitalista),unanlisisqueconectaconlanocinfoulcatianadebiopoltica.ParaWittig,que sustituye la dualidad dialctica de la opresin hombre/mujer por la de hetersosexualidad/homosexualidad, "la mujer" no es una identidad natural, sino una categora poltica que surge en el marco de un discurso heterocentrado. En este sentido la autora de The straight mind consideraba que las lesbianas no son mujeres, ya que no participan en el rgimen poltico (productivo y reproductivo)delaheterosexualidad. Desmarcndose de la dialctica binaria de la opresin marxista y en continuidad con el pensamiento de Foucault y de su coetnea Monique Wittig, las teoras queers hablan de un poder productivo, transversal, complejo. "Frente a una estructura de dominacin vertical y sin fisuras, puntualiz Beatriz Preciado, donde a un lado estn los hombres y al otro las mujeres (o a un lado los poderosos y al otro los oprimidos), las teoras queers piensan que existe un sistema complejo que pone en marcha mltiples relaciones depoder y enel que,por tanto,es siempre posible intervenir,crearespaciosde resistenciay desarrollarunaluchapoltica". En los textos tericos queers es muy importante la reflexin sobre el sujeto de la enunciacin. En la pelculaParisisburning(proyectada parcialmentedurantelatercerajornadadelseminario)elsujetode la enunciacin es Jeannie Livingstone, una persona blanca, juda, neoyorquina y de clase mediaalta (lo que determina su mirada e interpretacin de la realidad) que dirige un filme sobre transexuales, travestes y trabajadoras sexuales de clase baja (en su mayora chicanos, negros o white trash) participando(comoautoresocomoespectadores)enactuacionesdeDragQueens.Elfilmepresentalas performances degnerodeestas DragQueensnocomouna merarepresentacinescnica(para laque bastara colocarse una peluca y un traje) sino como el resultado de un proceso de aprendizaje performativomuydeterminadoporunaseriedecondicionespersonales,materialesysociales. "Pero lo interesante de Paris is burning, subray Beatriz Preciado, es que no slo articula un sugerente anlisis del gnero, sino que adems lleva a cabo una exploracin de las polticas de identidad en el mundo capitalista al mostrarnos los accesorios de las Drag Queens como productos de consumo que simbolizan todo un conjunto de roles econmicos y polticos". Gracias a la creacin de un espacio performativo donde se sienten respaldadas, estas drags marginales pueden acceder a la cultura y a los sistemas de representacin consumistas a travs de performances que les permiten realizar no slo la performancedelafeminidad,sinotambinlaperformancedelhombre denegociosodelalumno deun colegio privado (identidades que no pueden o no han podido desempear por un conjunto de imposicionespolticasdegnero,claseyraza).Enestesentido,lasparodiasdeloshabitantesdelmundo paralelo del Ball Room de Paris is Burning, ponen de manifiesto la produccin performativa no slo del gnero,sinotambindelaclaseydelaraza.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

223

BIOPOLTICADELGNERO

BeatrizPreciado

FilosofaUniversidaddePrinceton Pars8SaintDenis

ALaliaKowskaRgnier,princesahechiceradeestrgenoseimgenes

Lainvencindelgnero,oeltecnocorderoquedevoraaloslobos Enoctubrede1958unajovensepresentaenelDepartamentodePsiquiatradelaUni versidad de California en Los ngeles. La reciben los doctores Stoller, Garfinkel y Rosen, un equipo integrado por un psiquiatra, un socilogo y un psiclogo que investigan la intersexua lidad y la disforia de gnero (Garfinkel, 1967: 116185). De la joven, que acaba de cumplir diecinueve aos, se dice en el informe mdico que es blanca y que trabaja como secretaria en una compaa de seguros. El informe agrega: Tiene un aspecto femenino convincente. Es alto, fina y de formas femeninas [...] Tiene genitales masculinos y un pene de desarrollo nor mal, as como caracteres secundarios del sexo femenino: busto mediano; no desarroll vello enelrostronienelcuerpo.Sinembargo,silajovenparececolmarlasexpectativastaxonmi cas de los tres hombres, es ante todo porque no presenta signos de desviacin sexual, de travestismo o de homosexualidad: No tiene nada que pueda diferenciarla de una joven de su edad. Tiene un tono de voz agudo, no usa la vestimenta exhibicionista y de mal gusto que ca racterizaatravestisyhombresconproblemasdeidentificacinsexual.Lacondicindeposibi lidad del futuro diagnstico de gnero es ante todo esa constatacin de normalidad en trmi nos de raza (blanca), de clase (trabaja) y de sexualidad (no es travesti ni homosexual). Tododiagnsticodependedeunadivisinpreviaentrepenalidadyterapia,entreperversiny enfermedad (Foucault, 1975: 29). Una vez que se saca al cuerpo del campo de la patologa so cialomoralesposibleinstrumentarlastcnicasmdicas(performativas,hormonales,quirrgi cas...)paraayudaralanaturaleza. La eleccin del nombre interviene siempre en las historias mdicas como tentativa l tima de identificacin, de produccin de un tipo en una taxonoma. Lo que queda comprome tido,dicenDeleuzeyGuattari(2004:3435)alhablardelosnombresquediopapFreudasus pacientes, tanto para las palabras como para las cosas es la relacin del nombre propio co mo intensidad con la multiplicidad que l aprehende instantneamente.[...] Cuando todo se fragmenta y pierde su identidad, an queda la palabra para restablecer una unidad que ya no existaenlascosas.GarfinkellallamaAgns,lamujernormal,natural(Garfinkel,1967:cap. 5). Al decir Agns, nombra sin saberlo una revuelta en ciernes. La guerra de los corderos* an no se produjo. El informe contina: Una exploracin pelvianay renal [...] revela la ausen cia de tero y de ovarios. Una biopsia bilateral testicular muestra una leve atrofia de los test

JuegodepalabrasentreelnombredeAgnsyagneux,corderos.[N.delT.]

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

224

culos.Unabiopsiadelasclulasdelapiel1revelauntipodecromatinanegativa(osea,mascu lina) [...] Paradjicamente, sin embargo, una biopsia de las clulas de la uretra muestra una elevadaactividaddeestrgenos.(Stoller,GarfinkelyRosen,1960:379381). Luego de treintaycinco horas de consultas e infinidad deanlisis morfolgicos y endo crinolgicos, el equipo de la UCLA concluye: Agns es un caso de hermafroditismo verdade ro. Para el equipo, Agns sufre de sndrome de feminizacin testicular, un raro tipo de in tersexualidad en el cual los testculos producen una cantidad elevada de estrgenos (Stoller, 1968: 365). De acuerdo con el protocolo Money de tratamiento de nios intersexuales, que prev la reasignacin del sexo por medio de tratamientos hormonales y quirrgicos, el equipo recomienda una vaginoplastia teraputica, vale decir la construccin quirrgica de una vagina apartirdeltejidogenitalalosefectosderestablecerlacoherenciaentreidentidadhormonal e identidad fsica. En 1959 se le practicaa Agns una operacin de castracin: se le ampu tan el cuerpo cavernoso del pene y los testculos, y se crean los labios de la vagina con la piel del escroto (Garfinkel, 1967: 184). Un tiempo despus Agns obtiene el cambio de nombre en sudocumentodeidentidad. Esta historia clnica puede leerse de dos formas diferentes. Segn el discurso mdico tradicional, por un lado, la historia de Agns parece dar cuenta del tratamiento de un proble ma de intersexualidad al que la medicina supo responder con xito. Segn una lectura genea lgicadeldiscursomdicolegal,pareceraquelosprocesosdenormalizacin,decontroldelos cuerposydelasexualidadqueoperanlasinstitucionesdisciplinariasyqueFoucaulthabades crito en Los anormales, alcanzan aqu un mximo punto de eficacia. Si se compara la historia clnicadeAgnsconla historiatrgicadeHerculineBarbin(autobiografadeunahermafrodita que public el grupo de investigacin de Foucault a fines de la dcada de 1970), podra con cluirse que el aparato represivo, transformado en empresa de salud pblica, tiene ahora una nueva sofisticacin endocrinolgica y quirrgica para realizar de manera ms eficaz lo que la medicina de la poca de Herculine Barbin haba soado: restablecer la relacin original entre sexo, gnero y sexualidad; hacer del cuerpo una inscripcin legible y referencial de la verdad delsexo. Exhumadaytransformadaenbestseller,laautobiografadeHerculineBarbinleservir aFoucaultdeficcinoriginalparaconstruirsupropiateoradelasexualidad.Foucaultveenla historia de Herculine el sntoma de la emergencia de un nuevo rgimen discursivo sobre el sexo. Mientras que los hermafroditas del siglo XIX vivan, segn Foucault, en un mundo sin identidades sexuales en el cual la ambigedad de los rganos haca posible una pluralidad de identificaciones sociales (como Marie Madelaine Lefort, nacida en 1800, a la que poda consi derarsetantounamujerconbarbaypenecomounhombreconpechos:AliceDreger,1998),la nueva episteme de la sexualidad de la que Foucault da cuenta obliga a Herculine Barbin a ele gir una sola identidad sexual y, en consecuencia, a restablecer la coherencia entre los rganos sexuales,elsexo(femeninoomasculino:tngaseencuentaqueelconceptobiotecnolgicode gnero todava no se haba creado) y la identidad sexual (heterosexual o perversa). Por lti mo, Herculine introduce una serie de discontinuidades irreparables en esa cadena causal de
1

Garfinkel se refiere aqu al controvertido test de Barr, utilizado para establecer la femineidad de las atletas que participan en las Olimpadas a partir de 1966. Lo impugnarn atletas transexuales como Rene Richards, que rechazan ese diagnstico deportivo del sexo a travs del anlisis cromosmico. Ms adelante se revelar que el anlisisnoesconfiable.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

225

produccin de sexo, que la llevarn a convertirse no slo en un espectculo mdico, sino tam binenunamonstruosidadmoral. Si nos atenemos al modelo de anlisis de Foucault, parece lgico inclinarse por una exaltacin de la resistencia de Herculine y una crtica de la facilidad con la que Agns se deja absorber por los aparatos biopolticos. Sin embargo, esa lectura foucaultiana, que hace apare cer el discurso mdico como una instancia de subjetivacin normalizadora, se hace problem tica cuando, en 1966, seis aos despus de la vaginoplastia, Agns hace otro relato de su pro pio proceso de transformacin corporal. La segunda narracin desafa y ridiculiza las tcnicas cientficas de los diagnsticos psiquitrico y hormonal a los que deben someterselas personas transexualesenlasinstitucionesmdicolegalesapartirdeladcadade1950.Elsaberdeltec nocorderoengaaalamanadadelobos. Agns dice que fue un nio de sexo anatmico masculino y que al inicio de su adoles cencia(alosdoceaos)empezatomaraescondidaslosestrgenosquelehabanrecetadoa sumadreluegodeunapanhisterectoma,unaablacincompletadelteroylosovarios.Segn ese segundo relato, todo habra empezado como un juego: en un primer momento roba algu na que otra cpsula ocasionalmente; despus falsifica las recetas mdicas para acceder a una provisinregulardeStilbestrol.Agnssiempredeseserunamujery,graciasalosestrgenos de su madre, empieza a ver que se le desarrollan pechos y que evita signos no deseados de la pubertad, tales como la vellosidad facial (Stoller, 1968: 135). El segundo relato nos permite arriesgarunadoblehiptesis:AgnscuestionalateoradelpoderydelasubjetivacindeFou cault, pero tambin desestabiliza o completa ciertos ejes argumentativos de la teora de la identidadperformativadeJudithButler. LoqueelcorderolehizoaFoucault Gneroversussexo Foucaultdesignaelpasajedeunasociedadsoberanaaunasociedaddisciplinariacomoeldes plazamiento de una forma de poder que decide y ritualiza la muerte, a una nueva forma de poderquecalculalavidaentrminostcnicosdepoblacin,saludeintersnacional.Foucault llamar biopoder a esa forma de poder productivo, difuso y tentacular. Sin embargo, hay dos cuestionesquedestacanladificultaddeutilizaresemodeloenelcontextosexopolticoposte rioralaSegundaGuerraMundial. En segundo lugar, Foucault interrumpe su genealoga de la sexualidad en el siglo XIX y, si bien se trata de elaborar un anlisis poltico sobre las prcticas y las identidades sexuales contemporneas, a pesar de que no poda ignorar la existencia de los movimientos feministas francsyestadounidenseydequeconocalasubculturaSMcalifornianayladelFHARenFran cia,prefiriconstruirunaficcinretrospectivaapartirdelasexualidadgriega,queutilizacomo hiptesisprogramticaparaladefinicindelasnuevasestticasdevida.AlexhumaraHerculi ne, entierra a Agns. Al operar como ventrlocuo de una voz muerta, acalla el grito de los mo vimientossexualesvivos.Hoyresultasorprendentequeladefinicindelasestticasdevidaen trminos de tecnologas del yo se haga sin tener en cuenta las tecnologas del cuerpo (bio tecnologas, sobre todo ciruga y endocrinologa) y de la representacin (fotografa, cine, tele visin, ciberntica), que se encuentran en plena expansin durante la segunda mitad del siglo

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

226

XX. Foucault soslaya un conjunto de tranformaciones que se suceden a partir de la Segunda GuerraMundialyque,enmiopinin,exigenunaterceraepisteme,nisoberananidisciplinaria, ni premoderna ni moderna, que tenga en cuenta el impacto de las nuevas tecnologas del cuerpo,unaepistemequellamoposmoneystahaciendoreferenciaalafiguradelDr.JohnMo ney,cuyopoderdiscursivosobrelasexualidadreemplazaraldeKrafftEbingyaldeFreud. La invencin de la categora de gnero constituye el indicio de la emergencia de ese tercerrgimendelasexualidad.Lejosdeserunacreacindelaagendafeministadeladcada de1960,la categoradegneropertenecealdiscursomdicodefinesdelosaos 40.Durante elperododelaguerrafra,losEstadosUnidosinvirtieronenlainvestigacinsobreelsexoyla sexualidad una cantidad de dlares sin precedentes en el mundo. Digamos de inmediato que ese tercer modelo se caracteriza no slo por la transformacin del sexo en objeto de gestin poltica de la vida, sino sobre todo por el hecho de que esa gestin se opera a travs de las nuevasdinmicasdeltecnocapitalismoavanzado.RecordemosquelosperodosdelaSegunda Guerra Mundial y de la posguerra constituyen un momento sin precedentes de visibilidad de lasmujeresenelespaciopblico,perotambindeemergenciadelasformasvisiblesdehomo sexualidad masculina en las fuerzas armadas estadounidenses (Berub, 1990). El maccarthyis mosumaalapersecucinpatriticadelcomunismolaluchacontralahomosexualidadentan to forma de antinacionalismo, as como la exaltacin de los valores familiares de la masculini dad laboriosa y la maternidad domstica (DEmilio, 1983). En todo el pas se abrendecenas de centros de investigacin en el marco de un objetivo nacional de salud pblica. Al mismo tiem po,losdoctoresGeorgeHenryyRobertL.Dickinsoninicianungranestudiocuantitativosobre la desviacin sexual que se conoce como Sex Variant y que se prolongar casi veinte aos (Terry, 1999: 178218). Es tambin el momento en que Harry Benjamn instaura el uso clnico delasmolculashormonales,elmomentodelaprimeracomercializacindeestrgenosypro gesteronaobtenidosapartirdeyeguas(Premarin)yluegodeformasinttica(Norethindrone), y es, sin duda, el momento en que John Money, que tiene a su cargo el rea de psiquiatra in fantojuvenildelhospitalJohnHopkinsdeNuevaYork,inventaelconceptodegnero. A la rigidez del sexo en el discurso mdico del siglo XIX, Money opondr la plasticidad tecnolgicadel gnero.Utiliza ese concepto por primera vez en sutesisde doctorado de 1947 y la desarrolla ms tarde en el rea clnica con Anke Ehrhardt, Joan y John Hampson, para hablar de la posibilidad de modificar hormonal y quirrgicamente el sexo de los nios inter sexuales nacidos con rganos genitales que la medicina considera indeterminados (Money, HampsonyHampson,1957:333336).ParaMoney,eltrminognerodesignaalavezelsexo fisiolgico(segnlatradicindeUlrich)ylaposibilidaddeusarlatecnologaparamodificarel cuerpo segn un ideal regulador preexistente de lo que un cuerpo humano (femenino o mas culino) debe ser (Meyerowitz, 2002: 998129). El concepto de gnero de Money es el ins trumentodeunaracionalizacindelavidaenlaqueelcuerponoesmsqueunparmetro.El gneroesantetodoun conceptonecesarioparalaaparicinyeldesarrollodeunconjuntode tcnicas de normalizacin/transformacin de la vida: la fotografa de los desviados sexuales, la identificacin celular, el anlisis y el tratamiento hormonales, la lectura cromosmica, la cirugatransexualeintersexual... Al hacer referencia a la genealoga del discurso anatmico que efecta Thomas La queur, se puede afirmar que ese proceso de produccin de la diferencia sexual mediante tc nicasderepresentacindelcuerpoyaseinsinuabaenelsigloXVII(Lacqueur,1990).Afinesdel

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

227

siglo XIX, mucho antes de la aparicin y el perfeccionamiento de las tcnicas endocrinolgicas y quirrgicas, la verdad del sexo se produce mediante una nueva tecnologa de la representa cin,lafotografa,cuyosprimerosusossernlarepresentacinanatomopatolgicaylaporno grafa. Apenas diez aos despus de la invencin de la fotografa, alrededor de 1886, el ciruja no estadounidense Gordon Buck utiliza por primera vez los cdigos fotogrficos del Antes y Despus para ilustrar el xito de la nueva ciruga plstica en los cuerpos de los soldados heri dos en la guerra de secesin (Sander Gilman, 2000: 37). Teniendo en cuenta la precariedad de las tcnicas quirrgicas de la poca, la representacin fotogrfica asegura el efecto de recons truccin. Esa incipiente fotografa mdica crea tambin un nuevo cdigo de representacin realista que rompe con la tradicin pictrica del retrato al desplazar del rostro a los rganos sexualeslarepresentacindelaverdaddelsujeto. Tomemos, por ejemplo, una de las imgenes recurrentes de la representacin de los hermafroditas y los invertidos de esa poca: cuerpo extendido, rostro cubierto, piernas abier tas y rganos sexuales a la vista, todo lo cual una mano ajena muestra a la cmara. La imagen dacuentadesupropioprocesodeproduccindiscursiva.Comparteloscdigosderepresenta cinpornogrficaquesurgenenesapoca:lamanodelmdicoqueocultaymuestraalmismo tiempo los rganos sexuales establece una relacin de poder entre el objeto y el sujeto de la representacin. El rostro, y ms especficamente los ojos del paciente estn cubiertos. Si bien la medicina ve en ese gesto la proteccin de la privacidad del enfermo, el borramiento revela la imposibilidad de ste de acceder a la representacin como agente. La antroploga Susanne Kessler demostr que los protocolos de Money se basan en criterios estticos idnticos (el tamaoylaformadelpeneoelcltoris)alosqueimperanenlafotografamdicadeprincipios delsigloXX.Unalevediferencia:elprocesodenormalizacinquehastaelpresenteslopoda llevarseacabomediantelarepresentacinseinscribeahoraenlapropiaestructuradelavida. Lejos de la rigidez y la exterioridad de las tcnicas de normalizacin del cuerpo que operan en los sistemas disciplinarios, las nuevas tcnicas de gnero del perodo posmoneyista son flexi bles,internasyasimilables. Si el concepto de gnero introduce una ruptura, es precisamente porque constituye el primermomentoreflexivodeesaeconomadeconstruccindelsexo.Apartirdeentonces,no hay retroceso. La medicina permite que emerjan sus fundamentos arbitrarios, su carcter constructivista,yporlomismoabrelapuertaanuevasformasderesistenciaydeaccinpolti cas. El rgimen postmoneyista de la sexualidad no puede funcionar sin la circulacin de un enorme flujo de hormonas, silicona, textos y representaciones, de tcnicas quirrgicas... en definitiva, sin un trfico constante de biocdigos de los gneros. En esa economa poltica del sexo, la normalizacin y la diferencia dependen del control, de la reapropiacin y el uso de esos flujos de gnero. Cuando hablo de la ruptura que introduce ese concepto de gnero, no me refiero al pasaje de un modelo al otro en trminos de que provoque una forma de discon tinuidad drstica. Se trata sobre todo de una superposicin de estratos en los cuales las dife rentes tcnicas de escritura de la vida se encabalgan y se rescriben. El cuerpo no es aqu una materia pasiva sino una interface tecnoorgnica, un sistema tecnovivo segmentado y territo rializadosegndiferentesmodelos(textuales,informticos,bioqumicos,etc.)(Haraway,2000: 162). Voy a dar slo un ejemplo de esa yuxtaposicin de ficciones somticas de las que somos objeto. Dean Spade invita a reflexionar sobre la diferencia entre la definicin de la rinoplastia como ciruga esttica y la aceptacin actual de la vaginoplastia y la faloplastia como operacio

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

228

nes de cambio de sexo (Dean Spade, 2000). Mientras la primera pertenece a un rgimen de corporalidad posmoneyista en la que la nariz se considera propiedad individual y objeto de mercado, las segundas permanecen inmersas en un rgimen premoderno y casi soberano de corporalidad en el que el pene y la vagina siguen siendo propiedad del Estado. Agns va a ser sensible a las brechas y los vasos comunicantes entre diferentes estratos, entre muchos siste masdeproduccindelovivo:vaautilizarsucuerpocomozonadetranscodificacin. Agns nos permite entonces releer la Herculine de Foucault. Mediante el uso de la pri merapersona,elrelatodeHerculinerevelaelcarcterabierto,poroso ypermeabledelastc nicasdelsexo.Nohayunasaturacindiscursivadelasubjetividadsexual:lasubjetividadsurge como un gusano que atraviesa la malla de una red y al mismo tiempo que cava abre un cami no,trazaunainscripcin,dejaunrastro,tejeunatramaquerecodificaeldiscursopreexistente. Herculine es condenada a muerte (o ms precisamente al suicidio), no porque se site en un puntoderupturaentredosepistemesdelasexualidad,sinoporqueescomosisucuerpoque dara absorbido en la brecha que separa dos ficciones discordantes del yo.2 Herculine no es un hombre atrapado en el cuerpo de una mujer ni una mujer atrapada en el cuerpo de un hom bre.Esantetodouncuerpoatrapadoentrelossaberesdominantessobreelsexoylossaberes menoresdelosanormales. Su texto en primera persona deforma el tejido discursivo y abre un nuevo espacio a la enunciacin poltica y potica de la subjetividad sexual. Es ante todo la productora de un nue vosabersobreelsexo.EltextodeHerculinehabrapodidoiniciarlainsurreccindelossaberes sometidosdelosquehablaFoucaulten1976conunasolacondicin:lapropiaHerculine,yno Foucault, tendra que haberlo hecho pblico. Si Herculine muere, no es porque su cuerpo est saturado por los lenguajes disciplinarios, sino sobre todo porque ella no llega a colectivizar la enunciacin de su propio discurso sobre la sexualidad. Herculine habla una lengua menor que enesemomentonopuedeentenderse.LalenguaprivadadeHerculinenoestencondiciones de recodificar los efectos del saberpoder del discurso mdicolegal. Agns es una suerte de Herculine self designed cuya palabra deviene potencia poltica, un cuerpo que deviene una ficcinsomticacolectiva. LoqueelcorderolehizoaButler Gneroversusperformance Ahorabien,elrelatodeAgnsnotienepornicoefectoeldesplazamientodeciertostrminos de la teora de la subjetivacin de Foucault, sino que tambin alcanza la definicin del gnero como performance que populariz la teora queer. Se recordar que la nueva reflexin que iniciaron los autores queer en relacin con las teoras feministas de la segunda ola adopt la formadeunainflexinperformativaenelanlisisdelaidentidadsexual.AutorascomoButler, SedwickyHalberstamutilizaronlos conceptosdeperformanceyperformatividadcomoprinci piosexterioresalfeminismoparadesnaturalizarladiferenciasexual. Cmo lleg a las ciencias sociales, y ms especficamente al lenguaje del feminismo, ese concepto de performance, que en un primer momento se relacionaba con el anlisis tea traloconlacrisisdelasprcticasestticasenelsigloXX?Nopuedohaceraquunagenealoga
2

AgradezcoaElsaDorlinporsulecturadeHerculine,quemellevamoderaralgunasdemispalabrasiniciales.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

229

del concepto de performance en el feminismo y la teora queer, por lo que me limitar a re cordarqueelconceptotienesusantecedentesdiscursivosen1929,enuntextodelapsicoana lista Joan Riviere. En La femineidad como mscara, Joan Riviere defini por primera vez la fe mineidadcomoartificio,teatralizacin,parodia,ficcin,efectodesuperficieomscara.Ciertas mujeres intermediarias (llama as a las mujeres que se ubican entre la heterosexualidad y la homosexualidad) utilizan la mscara, dice, para ocultar su posible masculinidad. Pero qu es esa masculinidad que se oculta tras la mscara de la femineidad? En la dcada de 1920, esa masculinidad, segn el anlisis de Riviere, no es otra cosa que la capacidad de las mujeres de utilizar la palabra en el espacio pblico y de desarrollar actividades profesionales y polticas. Cuando Riviere habla de la femineidad como mscara detrs de la cual las mujeres ocultan su masculinidad,piensaenunartificiodedisimuloquelamujerusaparaevitar,dice,lasrepresa lias que tema por parte de esas figuras paternas como consecuencia de sus proezas intelec tuales (Riviere, 1979: 14). La hiptesis de Riviere, que se aleja de toda etiologa psicolgica o familiar al presentar un argumento poltico para explicar la femineidad, fue rechazada de in mediato por el psicoanlisis institucional y no se la recuper hasta la dcada de 1980, cuando laretomelfeminismoconstructivista.EnsuclsicoElgneroendisputa,JudithButlervuelve sobre el concepto de mscara para analizar la produccin de la femineidad, no en la mujer intermediariadeRivieresinoenlaperformancedragqueen,valedecir,ladeunhombrebiol gicoqueperformalafemineidad,amenudodeformahiperblica(Butler,2001). Dehecho,laargumentacindelateoradeButlersebasaengranmedidaenlaeficacia conlacuallaperformancedeladragqueenlepermitedevelarelcarcterimitativodelgnero. Podra decirse que la concepcin butleriana de la identidad sexual performativa es resultado deunalecturacruzadadelaperformancedeladragqueen,queabrevaalmismotiempoenel anlisisdeFoucaultsobrelaformacindelassubjetividadesporpartedelosregmenesdiscur sivos disciplinarios, as como en el anlisis de Derrida sobre la fuerza performativa del lengua je.Butlervaamostrarlaproduccinperformativadelapresuntarelacinnaturalentresexo biolgico e identidad de gnero a partir del anlisis de las prcticas de female impersonation (imitacin de la femineidad) que presenta la antroploga Esther Newton en Mother Camp (1972) y, ms adelante, de los casos de performance drag queen de la pelcula Pars en lla mas (1991), de Jeannie Livingston. A Butler le interesa la disociacin entre sexo y gnero en lasprcticasdragqueen,valedecir,enelespacioabiertoentreelsexodefinidocomomasculi no y la performance de la femineidad. Dado que la drag queen ocupa ese espacio paradjico que se sita entre el sexo anatmico y el gnero interpretado, hace aparecer la imitacin, la recitacin de los cdigos de significacin del gnero, como los mecanismos de produccin de la verdad del sexo: al imitarel gnero, la vestida implcitamenterevela la estructura imitativa del gnero en s, as como su contingencia (Butler, 2001: 169). Para Butler, la performance drag queen es subversiva porque desnaturaliza la relacin normativa entre sexo y gnero y permite que aparezcan los mecanismos culturales que producen la coherencia de la identidad heterosexual.CuandoeneseprimermomentodesuanlisisButlerdefineelgnerocomoper formativo, implica que ste no tiene un estatuto ontolgico ms all de las diferentes repeti cionesteatralesqueconstituyensurealidad.As,laperformancedeladragqueenlepermitir a Butler concluir que la identidad original sobre la que se modela el gnero es una imitacin sinunorigen(Butler,2001:169),enlaquelasposicionesdegnero(masculinasyfemeninas)

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

230

que se considera naturales son el resultado de performances sometidas a regulaciones, itera cionesysancionesconstantes. En un segundo proceso argumentativo que se afianza cada vez msa partir de la publi cacin de Cuerpos que importan, Butler trata de redefinir la performance teatral en trminos de performatividad lingstica (Austin reledo por Derrida). Concluye que los enunciados de gnero, los que se pronuncian en el momento del nacimiento como es una nia, es un nio, pero tambin los insultos homofbicos como afeminado o marimacho, no son enunciados descriptivos sino ante todo performativos, vale decir, invocaciones o citaciones ritualizadasdelaleyheterosexual.(Butler,2002:323334). Qu pasa si se confronta ese concepto de performance de gnero o hasta la idea ms sofisticada de identidad performativa con el relato de Agns? En efecto, en cierta medida es posible leer el proceso de subjetivacin de Angs como una instancia de resignificacin y de reapropiacin performativa. En el momento en que se encuentra con los doctores Stoller y Garfinkel, es posible que Agns ya conozca algunas narraciones autobiogrficas de transexua les. Empieza a tomar Stilbestrol en 1952. Ese mismo ao se difunde en los diarios estadouni denses la historia del cambio de sexo de Jorgensen con el ttulo El soldado estadounidense que se transform en una rubia (Jorgensen, 1967: 83), as como la de Roberta Cowell, gracias a la cual elmdico estadounidense Gillie desarrolla y homologa su tcnica de vaginoplastia. La biografa novelada de Lili Elbe, Man into Woman, que se public en 1932 y en esa poca se consider un caso de hermafroditismo, se reeditar en los Estados Unidos en 1953, luego del xitomediticodelahistoriadeJorgensen(Hoyer,1953).Esemismoao,muchasnovelascer canasalgneroautobiogrficoexploranelprocesodecambiodesexo,queaparececomoel nicoargumentoposibleparasituaryresolverlaintrigaenelinteriordelpropiocuerpodelos protagonistas. Aparece as un nuevo gnero de biografa transexual novelada en la tradicin gtica de la mutacin monstruosa (historias de vampiros, etc.), donde el personaje principal, desdoblado, dividido entre anatoma e imagen de s, termina por ofrecerse a la investigacin cientfica.Todosesosrelatoscompartenunamismaretrica:elcambiodesexoapareceenlos mismos como la respuesta a una incongruencia fisiolgica o morfolgica. La transexualidad es aqusimplementelasolucinmdicaaunacondicinintersexual,ynuncaunadecisin(psico lgicaopoltica)autnomadetransformacindesydelcuerpo. Lo que Agns parece haber aprendido de la proliferacin meditica de los discursos sobre la sexualidad es que la identidad de gnero opera como un script, una narracin, una ficcin performativa en la que el cuerpo es al mismo tiempo el argumento y el personaje prin cipal. Agns omite de forma estratgica ciertas historias en el primer relato que hace a Stoller y a Garfinkel. Por ejemplo, evita mencionar las prcticas masturbatorias con el pene, as como lasprcticasdepenetracinanalconsuamigoBill.Sunarracin,queadhierealaconstruccin mediticadelatransexualidadenesapoca,insiste,porelcontrario,enlasfigurasqueponen de relieve los puntos del diagnstico intersexual: su sensibilidad y su amor por la naturaleza, un buen gusto innato en materia de vestimenta femenina que la distingue de travestis y tran sexuales,lainsensibilidadsexualdelpene... Agns realiza un proceso de apropiacin de las tcnicas performativas de produccin de identidad sexual precisamente en el momento en que el discurso mdico y los medios po nen en circulacin los conceptos de gnero, intersexualidad y transexualidad. Inicia un trfico

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

231

deficcionesenelcualsetomanciertosenunciadosdegnerodelaautoridaddeldiscursom dico para su utilizacin por parte de un nuevo sujeto de conocimiento que ahora reivindica su condicin de experto. Lo que me interesa aqu no es tanto la posible mimesis desviada o flawedsimesislarelacinentre repeticinydesobedienciaquedestacaHommiBhabhaenel anlisis de la relacin del colonizado con el discurso colonial) de Agns respecto del discurso mdico(Bhabha,1994:8688).3Loquemeinteresaeslaproduccinorgnicadeunasubjetivi dad poltica trans self designed. Agns se comporta como el modest witness (testigo modesto) de Haraway: utiliza su cuerpo como zona de transcodificacin de las tcnicas y los saberes so bre el sexo (Haraway, 1998). Luego surge la voz de la produccin de saberes y el activismo trans:treintaaosdespus,KateBornstein,RikiAnneWilchinsoDelLagraceVolcanorechazan las tcnicas de reeducacin de la voz, afirman abiertamente su posicin de translesbianas o transfeministasyhastadeclaranquenoquierenperteneceraningunodelosdossexos. Sibienelanlisisperformativobutlerianofueysiguesiendomuyfructfero,tantoenlo que concierne a la produccin de estratgicas polticas de autonominacin (coming out, estra tegias postidentitarias, etc.) como en lo relativo a las operaciones de resignificacin y de re apropiacin del insulto, de todos modos parece insuficiente para dar cuenta del proceso de Agns.Ascomodaresultadoseficacesparalacomprensindelaidentidadensuproliferacin discursiva (sobre todo textual y lingstica), tropieza cuando se trata de explicar la modifica cindelaestructuradelavidaqueoperaennuestrassociedadesposmoneyistas. Elanlisisperformativodelaidentidadcierraunciclodereduccindelaidentidadaun efecto del discurso que ignora las tecnologas de incorporacin especficas que funcionan en las diferentes inscripciones performativas de la identidad. El concepto de performance de g nero, y ms aun el de identidad preformativa, no permite tomar en cuenta los procesos bio tecnolgicos que hacen que determinadas performances pasen por naturales y otras, en cambio, no. El gnero no es slo un efecto preformativo; es sobre todo un proceso de incor poracinprosttico. El relato de Agns slo tiene sentido a travs del anlisis de los procesos biotecnolgi cos de inscripcin corporal que permitirn que su imitacin de la intersexualidad pase por na tural. No se trata simplemente de sealar el carcter construido del gnero, sino ante todo de reclamarlaposibilidaddeintervenirenesaconstruccinalpuntodecrearlasformasderepre sentacin somticas que pasarn por naturales. No obstante, el desplazamiento que empren do con Agns no debe interpretarse como una ruptura con el marco de anlis butleriano, sino comounaportealoquelapropiaButlerllama,sindardemasiadosdetalles,unaconsideracin escenogrfica y topogrfica de la construccin del sexo (Butler, 2002). De ahora en ms, y si guiendo a Teresa de Lauretis, hablar sobre todo de las tecnologas del gnero como de un circuitocomplejodecuerpos,tcnicasysignosquecomprendennoslolastcnicaspreforma tivas, sino tambin tcnicas biotecnolgicas, cinematogrficas, cibernticas, etc. (De Lauretis, 1987). Agnsdesafalalgicadelaimitacinsegnlacualunatransexualesunhombrebiol gico que imita a una mujer. Pone en tensin la relacin que establece Riviere entre mscara y
No intento establecer aqu una genealoga poltica ni una metodologa en la que Agns desempee el papel de estrella.LarelacindeAgnsconeldiscursomdicoyafueobjetodelacrticadenumerososactivistastransgne ro como Dean Spade, para quien la repeticin leal de la argumentacin mdica por parte de Agns significa para ellalacondicindeposibilidaddeobtenerunavaginoplastia.VaseSpade(2000).
3

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

232

10

femineidad y que Butler instala entre drag queen y femineidad, entre copia y original, artificio y naturaleza, irreverencia y seriedad, forma y fondo, extravagancia y discrecin, ornamento y estructura.Setratadeundevenirtransquenosecontentaconpasarporlasemejanza,alcual lasemejanzaleresultaramsquenadaunobstculo.Agnsnoimitaaunamujernipretende hacersepasarportalmedianteunaperformancemsomenosestilizada.Porelcontrario,esa travs de la gestin y el uso disidente de los estrgenos y por la produccin de una narracin especfica que Agns se hace pasar en trminos fisiolgicos por hermafrodita y puede acceder asalostratamientosdereasignacindesexosinpasarporlosprotocolospsiquitricosylega lesdelatransexualidad. Lo que critica Agns mediante su consumo oculto de estrgenos no es ni la masculini dad ni la femineidaden s mismas,sino ante todo (en un segundo grado de comprensin de la complejidad de las tecnologas de gnero) el propio aparato de produccin de la verdad del sexo. Si Susan Sontag defini el camp, que emerge de la cultura drag y del travestismo, como la crtica del original mediante los procesos de produccin del doble, de la copia o de la imita cin (Sontag, 1964), entonces puede decirse que Agns lleva el concepto del camp al lmite para volverlo obsoleto. Si en el camp la esttica suplanta a la moral y el teatro reemplaza a la vida, en el caso de Agns la tcnica somtica suplanta a la esttica y la vida reemplaza al tea tro. Agnsesunabiodragparaquienelpropiocuerpoeselprocesodeimitacin,conloque eliminalasoposicionesdelametafsicatradicionalquetantosproblemasplantearonalateora performativa de Butler: oposiciones entre fachada e interior, entre performance y anatoma, entre cuerpo y espritu, gentica e identidad. Agns es un artefacto cultural con consistencia orgnica,unaficcincuyossignificantessonsomticos. Entre Agns y su madre no hay una filiacin gentica sino una alianza farmacutica. Agnsheredalosestrgenosdesumadre.Porunacuriosaascendencia,lostestculosdeAgns empiezanaproducirlosestrgenosdesumadre.Ambasingresanenunprocesodereversibili dad y mutacin, como si hubieran firmado un contrato hormonal secreto: la misma dosis, la misma regularidad. No se trata aqu de una cuestin de imitacin, sino de reproduccin asisti da con hormonas. Si se acepta que Agns es una cyborg, una biodrag, entonces hay que decir que tambin lo es su madre, que depende de la ingestin de una tcnica de sustitucin hor monal que a menudo parece ser catica, y la mujer biolgica estadounidense tpica, que con sume anticonceptivos orales a partir de la adolescencia. Al avalar esos comprimidos inofensi vos, las dos encarnan las ficciones biotecnolgicas de la identidad. La diferencia reside en lo siguiente: mientras que Agns parece reapropiarse de las tcnicas de subjetivacin y de gene rizacin de su cuerpo, la mujer biolgica estadounidense se traga de forma inconsciente esas tcnicascomosisetrataradecomplementosnaturalesdesufemineidad. Apartirdeladcadade1950,laconstruccindelafemineidadesentodosloscasosun proceso de travestismo somtico o de biodrag similar al que realiza Agns. Los pechos, cuyo volumen y consistencia adquieren una nueva importancia, se convierten en un centro somti co de produccin del gnero. Pasan a ser el lugar de nuevas patologas como la hipomastia (pechos pequeos) o el cncer de mama, cuya frecuencia aumenta de forma exponencial y surge al mismo tiempo que las tcnicas de mastectoma y de reconstruccin con implantes sintticos (Haiken, 1997). Desde el aumento hasta la reconstruccin, los pechos del siglo XX funcionanantetodocomoprtesis.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

233

11

Desde principios del siglo XX, los nuevos materiales sintticos, las estructuras cuasi ar quitectnicas, y las tcnicas de montaje ingresan al terreno de la transformacin corporal. La parafina es una de las primeras sustancias que se utilizan para la construccin de lo que cono ce con el nombre de island flaps o colgajo en isla para los implantes de pechos, pero tambin paraelcasodetestculosoparaeltratamientodelanarizsifiltica.Enlosaos20selasusti tuye por goma arbiga y luego por caucho, celulosa, marfil y diferentes metales. En 1949 se inventelIvalon,underivadodelalcoholpolivinlico,parasuusoenelprimerimplantemama rio mediante inyeccin subcutnea. Las primeras destinatarias de esos implantes rudimenta rios sern las trabajadoras sexuales japonesas de la posguerra y la guerra fra, cuyo cuerpo se estandarizar segn los criterios de consumo heterosexuales de las fuerzas armadas estadou nidenses(Yalom,1997:236238).Loscuerposquenodeformaronlasracionesdeplutonio,son ahora objeto de la deformacin de los polmeros de polisiloxano . La mutacin de los cuerpos se lleva a cabo en un plano global. A partir de 1953 la silicona pura se convierte en lder de la produccin de implantes prostticos. Poco despus, la Dow Corning Corporation introduce el primer tubo estandarizado de gel de silicona. A pesar de que se comprueba su toxicidad, se lo seguirusandohastaprincipiosdeladcadade1990. Sinembargo,ladimensinbiodragoelcampsomticonoderivanslodelautilizacin de materiales sintticos para la reconstruccin de una presunta normalidad corporal natural. De hecho, una de las primeras tcnicas de reconstruccin mamaria surge a fines del siglo XIX, cuando el doctor Vinzent Czerny deciderecuperar lamasa de un lipoma en forma de protube rancia que una de sus pacientes tena en la espalda a los efectos de compensar una mastecto ma mediante un autransplante (Gilman, 1999: 249). Unos aos despus se desarrollan los au totrasplantesdegrasacorporalparaliftingsyreconstrucciones. En consecuencia, no se trata aqu de evaluar el pasaje de lo orgnico a lo inorgnico, sinosobretododedestacarlaaparicindeunnuevomodelodecorporeidad:lasnuevastcni casyanosonfielesaunataxonomaorgnicaclsicasegnlacualacadarganoyacadateji dolecorrespondeunasolaubicacin,unasolafuncin.Lejosderespetarunatotalidadformal o material del cuerpo, la ingeniera de los tejidos y las tcnicas prostticas combina los modos de representacin del cine y la arquitectura, tales como el montaje o la modelacin en tres dimensiones. La nueva ciruga como tecnologa de la sexualidad posmoneyista es un proceso de construccin tectnica por el cual rganos, tejidos, fluidos y molculas se transforman en materiasprimasconlasquesefabricaunanuevaaparienciadenaturaleza. Antesdeconcluirmegustaradetenermeunmomentoenlastcnicasendocrinolgicas presentes en el espacio domstico de Agns, sobre todo porque los mtodos de tratamiento que utiliza la madre luego de la panhisterectoma son los mismos que aquellos a los que recu rre Gladys Bentley en la dcada de 1950 para anular los efectos de la performance de la mas culinidad.DetenernosenGladysBentleynospermitirreconsiderarlasdimensionesperforma tivasdelaincorporacinprostticadegnero. SeconoceaGladysBentleycomounodelosprimerosdragkings,valedecir,unaprofe sionaldelaperformancedelamasculinidadenelHarlemRenaissancedelosaos20y30(Ser lin, 2004: 111158). En 1952, Bentley, una lesbiana afroestadounidense abiertamente mascu lina, aprovech el xito de las nuevas terapias hormonales y comenz un tratamiento de es trgenos (con Stilbestrol) a los efectos de intentar un proceso de refeminizacin al inicio de la menopausia. Al recurrir a la medicina endocrinolgica, busca, como bien seal David Serlin,

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

234

12

iniciar un proceso de rehabilitacin social, no slo de gnero sino tambin racial (Serlin, 2004: 144145). Unos meses despus de empezar el tratamiento,concede una entrevistaa larevista Ebony y declara: Volv a convertirme en una mujer. Lo que resulta interesante del caso de Bentley, esque el tratamiento hormonal contribuye precisamente a bloquear los efectos de la repeticin de la performance de la masculinidad, como si un exceso de masculinidad perfor mativa slo pudiera compensarse mediante una biotecnologa. Es gracias a esa ficcin somti ca que Gladys parece poder retornar a la performance de la femineidad: abandonar el espacio pblicoyteatralparavolveralespaciodomstico. En segundo lugar, la mujer biolgica heterosexual estadounidense es tan cyborg como Agns,dadoquetomametdicamentelapldora,sindudalatcnicabiodragmspoderosade lasegundamitaddelsigloXX.Lapldoraescontemporneadelaaparicindelanocindeg nero. Gregory Pincus cre el primer anticonceptivo a partir de la noretindrona, una forma sin ttica y asimilable por va oral de la molcula de progesterona activa. Se prob primero en ocasin de una campaa de investigacin sobre las tcnicas de asistencia para la procreacin en casos de esterilidad en familias blancas catlicas. Luego se prob en la isla de Puerto Rico comomtododecontroldelanatalidadenlapoblacinlocaldecolor,perotambinenvarios gruposdepacientesmujeresdelWorcesterStateHospitalydehombresdelacrcelestatalde Oregn entre 1956 y 1957, en investigaciones sobre elcontrol de la libido y hasta para el tra tamientodelahomosexualidad(Tone,2001:220).Lapldoranoesslounmtododecontrol de la reproduccin, sino tambin un mtodo de produccin y purificacin tnica, una tcnica eugensicadecontroldelaespecie(Roberts,1997). Ms biodrag aun, la pldora es tambin una tcnica de produccin de gnero. A pesar de que su eficacia era del 99,9%, el Instituto de Salud Norteamericano rechaz la primera pl doraporquestasuprimaporcompletolamenstruacinyponaencuestinlafemineidadde las futuras mujeres de Amrica del Norte. Por ese motivo se cre una segunda pldora, tan eficaz como la primera pero cuya nica diferencia resida en que reproduca el ritmo de los ciclos naturales. As como Agns se construy de forma consciente como hermafrodita gracias a los estrgenos de un tratamiento antimenopusico, sus compatriotas biolgicas contribuye ronalaconstruccindelaficcinsomticadelasjvenesblancasfemeninasyfrtilesdeAm ricadelNorte. ElprocesodefeminizacindeAgns,yporextensineldesumadreysuscompatriotas biolgicas, demuestran que las hormonas son ficciones biopolticas, ficciones que pueden to marse, digerirse, incorporarse, artefactos biopolticos que crean formaciones corporales y se integran a los organismos polticos mayores, tales como las instituciones polticolegales y el estadonacin. Esos artefactos biopolticos segregan narraciones que pueden citarse, recitarse y, sin duda, tambin citarse mal. Si puede decirse que cada hormona, en tanto ficcin poltica, est sujeta a posibles fracasos performativos y, en consecuencia, a incesantes procesos de ci taciones descontextualizadas, el cuerpo de Agns nos recuerda que esas invocaciones del g nero, esas interpelaciones normativas, no son simples procesos discursivos. Esas citaciones movilizan flujos, desencadenan procesos de modificacin celular de ycrecimiento capilar, pro vocan cambios de voz y hasta funcionan como verdaderos generadores de efectos. El cuerpo de Agns no es la materia pasiva sobre la cual opera un conjunto de tcnicas biopolticas de normalizacin del sexo, ni el efecto performativo de una serie de discursos sobre la identidad. EltecnocuerpodeAgns,verdaderomonstruosexualfascinante,selfdesigned,esproductode

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

235

13

lareapropiacinydelagenciamientocolectivodelastecnologasdegneroparaproducirnue vasformasdesubjetivacin. Para concluir, lo nico que me queda por hacer es invitarlos a practicar algunos ejerci ciosdeactivismobiopoltico.InsprenseenAgns.4
TraduccindeJoaqunIbarburu

Referenciasbibliogrficas: - Barbin, Herculine/Abel. 1978. Herculine Barbin, dite Alexina B.: Mes souvenirs. Presen tadoporMichelFoucault.Pars:Gallimard.[trad.esp.:HerculineBarbin,llamadaAlexi naB.Madrid:EditorialRevolucin,1985.] - Bhabha,Homi.1994.TheLocationofCulture.Londres:Routledge.[trad.esp.:Ellugarde lacultura.BuenosAires:Manantial,2002.] - Berube, Alan. 1990. Coming Out Under Fire: The History of Gay Men and Women in WorldWarTwo.NuevaYork:TheFreePress. - Billings, Dwight B. y Urban, Thomas. 1982. SocioMedical Construction of Transsexual ism.AnInterpretationandCritique,en:SocialProblems,29,3,pp.266282. - Bornstein, Kate. 1994. Gender Outlaw. On Men, Women and the Rest of Us. Nueva York:Routledge. - Butler, Judith. 2001. El gnero en disputa: el feminismo y la subversin de la identidad. Mxico:Paids. - Butler,Judith.2002.Cuerposqueimportan:sobreloslmitesmaterialesydiscursivosdel "sexo".BuenosAires:Paids. - Butler, Judith. 1994. Excitable Speech: The Politics of the Performative. Nueva York: Routledge.[trad.esp.:Lenguaje,podereidentidad.Madrid:Sntesis,2004.] - Butler, Judith. 2004. Undoing Gender. Nueva York: Routledge. [Deshacer el gnero. Barcelona:Piados2006.] - DEmilio,John.1983.SexualPolitics,SexualCommunities:TheMakingofaHomosexual MinorityintheUnitedStates.19401970.Chicago:ChicagoUniversityPress. - De Lauretis, Teresa. 1987. Technologies of Gender. Essays on Theory, Film and Fiction. Bloomington: Indiana University Press. [trad. esp.: La tecnologa del gnero, en: Mo ra,2,nov.1996,InstitutoInterdisciplinariodeEstudiosdeGnero,UniversidaddeBue nosAires.] - Deleuze, Gilles y Guattari, Felix. 1997. Mil mesetas: capitalismo y esquizofrenia. Valen cia:PreTextos. - Dreger, Alice D. 1998. Hermaphrodites and the Medican Invention of Sex. Cambridge, MA:HarvardUniversityPress.

Agradezco a Matilde Fournier por la lectura y correccin del texto en francs.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

236

14

Foucault, Michel. 1999. Les Anormaux. Cours au Collge de France. 19741975. Pars: Gallimard/LeSeuil.[trad.esp.:Losanormales:cursoenelCollgedeFrance(19741975 Mx ico:FCE. Garfinkel, Harold. 1967. Passing and the Management Achievement of Sex Status in a IntersexualPerson,en:StudiesinEthnomethodology.NewYork:PretinceHall. Gilman, Sander L. 2000. Making the Body Beautiful. A Cultural History of Aesthetic Sur gery.Princeton:PrincetonUniversityPress. Haiken, Elisabeth. 1997. Venus Envy. A History of Cosmetic Surgery. Baltimore y Lon dres:TheJohnsHopkinsUniversityPress. Haraway, Donna. 1998. Situated Knowledges: The Science Question in Feminism as a Site of Discourse of the Privilege of Partial Perspective, en: Feminist Studies, 14, 3. [trad. esp.: Conocimiento situado: La cuestin cientfica enel feminismoy el privilegio de la perspectiva parcial, en: Ciencia, cyborgs y mujeres: la reinvencin de la naturale za.Madrid:Ctedra,1995.] Haraway, Donna. 2000. How Like A Leaf. An Interview with Thryza Nichols Goodeve. NuevaYork:Routldege. Hoyer,Neils.1953.ManintoaWoman.NuevaYork:PopularLibraryEdition. Jorgensen,Christine.1967.ChristineJorgensen:APersonalAutobiography.NuevaYork: PaulEriksson. Kessler,Susan.1990.TheMedicalConstructionofGender:CaseManagementofInter sexInfants,en:Signs,16,I. Kessler, Susan y McKenna, Wendy. 1978 (1990). Gender: An Ethnomethodological Ap proach.NuevaYork:JohnWiley. Laqueur, Thomas. 1990. Making Sex. Body and Gender from the Greeks to Freud. Cam bridge: Harvard U. P. [trad. esp.: La construccin del sexo: Cuerpo y gnero desde los griegoshastaFreud.Madrid:Ctedra,1994.] Lazaratto, Maurizio. 2002. Puissance de lInvention. Pars: Les Empcheus de penser en rond. Meyerovitz, Joanne. 2002. How Sex Changed. A History of Transsexuality in the United States.Cambridge,MA:HarvardUniversityPress. Money, John, Hampson, John y Hampson, Joan. 1957. Imprinting and the Establish mentoftheGenderRole,en:ArchivesofNeurologyandPsychiatry,77. Money, John. 1975. Sexual signatures: On Being Man or Woman. Boston: Little Brown. [trad.esp.:Asignaturassexuales.Barcelona:A.T.E.,1978.] Money, John. 1980. Love and Love Sickness: The Science of Sex, Gender Difference and Pairbonding.Baltimore:J.HopkinsUniversityPress. Newton,Esther.1972. MotherCamp:FemaleImpersonatorsinAmerica.ChicagoyLon dres:TheUniversityofChicagoPress. Park,Jordan.1953.Half.NuevaYork:LionBooks. Riviere,Joan.1979.LaFemineidadcomomscara.Barcelona:Tusquets. Roberts, Dorothy. 1997 Killing the Black Body: Race, Reproduction and the Meaning of Liberty.NuevaYork:Vintage. Sedgwick, Eve K. 2003. Touching Feeling. Affect, Pedagogy, Performativity. Durham: DukeUniversityPress.

phylosajvg - @filodac

MATERIALES DE USO EXCLUSIVAMENTE DIDACTICO

237

15

Spade,Dean.2000.MutilatingGender,ArchivodeInternet. Sontag,Susan.1966(1964).Notes onCamp,en:AgainstInterpretationandOtherEs says. Nueva York: Farras, Straus & Giroux. [trad. esp.: Notas sobre el camp, en: Co ntralainterpretacin .Barcelona:EditorialSeixBarral,1969.] Stoller,Robert,Garfinkel, Harold y Rosen, Alexander. 1960. Passing and the Main tenance of Sexual Identification in an Intersexed Patient, en: Archives of General Psy chiatry,2. Stoller, Robert. 1964. A Contribution to the Study of Gender Identity, en: Journal of theAmericanMedicalAssociation,45. Stoller,Robert.1968.SexandGender:OntheDevelopmentofMasculinityandFeminin ity.NuevaYork:ScienceHouse. Stoller, 1968. A Further Contribution to the Study of Gender Identity, en: Interna tionalJournalofPsychoAnalysis,49. Tone,Andrea.2001.DevicesandDesires:AHistoryofContraceptivesinAmerica.Nueva York:HillandWang. Terry, Jennifer. 1999. An American Obsession. Science, Medicine and Homosexuality in ModernSociety.Chicago:ChicagoUniversityPress. Yalom, Marilyn. 1997. A History of the Breast. New York: Ballantine Publishing Group. [trad.esp.:Historiadelpecho.Barcelona:TusQuets,1997.]

phylosajvg - @filodac