You are on page 1of 130

EMC Data Domain DD OS 5.

1
System Installation
Student Guide
Version: A.1
January, 2012

Backup Recovery Systems Division


EMC Data Domain
2421 Mission College Boulevard
Santa Clara, CA 95054
866-WE-DEDUPE
408-980-4800
www.datadomain.com

EMC believes the information in this publication is accurate as of its publication date. The information is
subject to change without notice. THE INFORMATION IN THIS PUBLICATION IS PROVIDED AS IS. EMC
CORPORATION MAKES NO REPRESENTATIONS OR WARRANTIES OF ANY KIND WITH RESPECT TO THE
INFORMATION IN THIS PUBLICATION, AND SPECIFICALLY DISCLAIMS IMPLIED WARRANTIES OF
MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Using, copying, and distributing EMC software
described in this publication requires an applicable software license. EMC2, EMC, Data Domain, Global
Compression, SISL, the EMC logo, and where information lives are registered trademarks or trademarks of
EMC Corporation in the United States and other countries. All other trademarks used herein are the property
of their respective owners. Copyright 2009-2012 EMC Corporation. All rights reserved. Published in the
USA.

Welcome to the EMC Data Domain System Installation Course.


WelcometotheEMCDataDomainSystemInstallationCourse
ClicktheNotestabatanytimetoviewtextthatcorrespondstotheaudiorecording.
ClicktheSupportingMaterials tabtodownloadaPDFversionofthiseLearning.
Copyright1996,2000,2001,2002,2003,2004,2005,2006,2007,2008,2009,2010, 2011 EMCCorporation.AllRightsReserved.EMC
believestheinformationinthispublicationisaccurateasofitspublicationdate.Theinformationissubjecttochangewithoutnotice.
THEINFORMATIONINTHISPUBLICATIONISPROVIDEDASIS.EMCCORPORATIONMAKESNOREPRESENTATIONSORWARRANTIESOF
ANYKINDWITHRESPECTTOTHEINFORMATIONINTHISPUBLICATION,ANDSPECIFICALLYDISCLAIMSIMPLIEDWARRANTIESOF
MERCHANTABILITYORFITNESSFORAPARTICULARPURPOSE.
Use,copying,anddistributionofanyEMCsoftwaredescribedinthispublicationrequiresanapplicablesoftwarelicense.
EMC2,EMC,DataDomain,RSA,EMCCentera,EMCControlCenter,EMCLifeLine,EMCOnCourse,EMCProven,EMCSnap,EMCSourceOne,
EMCStorageAdministrator,Acartus,AccessLogix,AdvantEdge,AlphaStor,ApplicationXtender,ArchiveXtender,Atmos,Authentica,
AuthenticProblems,AutomatedResourceManager,AutoStart,AutoSwap,AVALONidm,Avamar,Captiva,CatalogSolution,CClip,Celerra,
CelerraReplicator,Centera,CenterStage,CentraStar,ClaimPack,ClaimsEditor,CLARiiON,ClientPak,CodebookCorrelationTechnology,
CommonInformationModel,ConfigurationIntelligence,Configuresoft,Connectrix,CopyCross,CopyPoint,Dantz,DatabaseXtender,Direct
MatrixArchitecture,DiskXtender,DiskXtender 2000,DocumentSciences,Documentum,elnput,ELab,EmailXaminer,EmailXtender,
Enginuity,eRoom,EventExplorer,FarPoint,FirstPass,FLARE,FormWare,Geosynchrony,GlobalFileVirtualization,GraphicVisualization,
Greenplum,HighRoad,HomeBase,InfoMover,Infoscape,Infra,InputAccel,InputAccel Express,Invista,Ionix,ISIS,MaxRetriever,
MediaStor MirrorView Navisphere NetWorker nLayers OnAlert OpenScale PixTools Powerlink PowerPath PowerSnap QuickScan
MediaStor,MirrorView,Navisphere,NetWorker,nLayers,OnAlert,OpenScale,PixTools,Powerlink,PowerPath,PowerSnap,QuickScan,
Rainfinity,RepliCare,RepliStor,ResourcePak,Retrospect,RSA,theRSAlogo,SafeLine,SANAdvisor,SANCopy,SANManager,Smarts,
SnapImage,SnapSure,SnapView,SRDF,StorageScope,SupportMate,SymmAPI,SymmEnabler,Symmetrix,SymmetrixDMX,Symmetrix
VMAX,TimeFinder,UltraFlex,UltraPoint,UltraScale,Unisphere,VMAX,Vblock,Viewlets,VirtualMatrix,VirtualMatrixArchitecture,Virtual
Provisioning,VisualSAN,VisualSRM,Voyence,VPLEX,VSAMAssist,WebXtender,xPression,xPresso,YottaYotta,theEMClogo,andwhere
informationlives,areregisteredtrademarksortrademarksofEMCCorporationintheUnitedStatesandothercountries.
Allothertrademarksusedhereinarethepropertyoftheirrespectiveowners.
Copyright2012EMCCorporation.Allrightsreserved.PublishedintheUSA.
Revision Date: January 2012
Revision Number: MR-7WN-DDSINSTL..DDOS5.1.0

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

Upon completionofthiscourse,youwillbeableto:
completion of this course you will be able to:

Prepareforinstallation,withrequiredtoolsandsafetyprecautions
Installrails,andracksystemhardware
Connectandcableexpansionshelves
PerforminitialconfigurationofDataDomainsystems
Configureoptionalsoftwarefeatures
Configurenetworkconnectivityforadministrativeaccess
Verifyinteroperabilitywithconnecteddevices
if i
bili
ih
dd i

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

During thecourse,youwillimplementthistopology.
the course you will implement this topology
Youwilllearnhowtorackcontrollersandexpansionshelvesasshownontheleft.TheData
Domainsystem(controllerandanyadditionalexpansionshelves)isconnectedtostorage
applicationsbymeansofVTLviaFibre Channel,orCIFSorNFSviaEthernet.
Intheexplodedviewdiagram,theDataDomaincontrollersitsatthecenterofthetopology
implementedthroughadditionalconnectivityandsystemconfiguration,including:
Expansion shelvesforadditionalstorage,dependingonthemodelandsiterequirements
MediaserverVirtualTapeLibrarystorageviaFibre Channel
LANenvironmentsforconnectivityforEthernetbaseddatastorage,forbasicdata
interactions,andforEthernetbasedsystemmanagement

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

TheSystemInstallationcourseprovidestheknowledgeandskillsneededforinstalling
The
System Installation course provides the knowledge and skills needed for installing Data
Data
Domainsystems.Thecourseprovideslearningexperiencescoveringhardwareinstallation,
cablingandconnections,andinitialconfigurationofsystemsoftwarefornetwork
connectivity,administrativeaccess,andverificationofinteroperabilitywithconnected
devices.
Thiscourseisintendedforfieldservicepersonnel,supportpersonnel,andothers responsible
for installing upgrading and expanding Data Domain systems
forinstalling,upgrading,andexpandingDataDomainsystems.
Tocompletethiscoursesuccessfully, thefollowingprerequisitesarerequiredorhighly
recommended:
TheEMCDataDomainTechnologyandSystemsIntroductionisavailableasawebbased
offering,andprovidesanimportantfoundationintechnologyandproductknowledge.
TheEMCDataDomainSystemAdministrationcoursecanbetakenasa3dayclassroom
y
y
course,oronlineinWebbasedformat.
Thesetwocourses arerequiredprerequisitesfortheSystemInstallationcourse.
Fieldengineeringexperienceisalsohighlyrecommended,includingfamiliaritywithbasic
networkingconceptsandtopologies,dataaccessprotocols,andexperiencewithrackingand
cablingequipment.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

Thismodulepresents
This
module presents essentialinformationandstepsyou
essential information and steps youllllneedtotakepriortoinstalling
need to take prior to installing
hardware.
Inthis moduleyouwilllearnhowto:

Accessusefulresources includinginstallationdocumentationandmedia.Youcanaccess
theseresourcesatanytimeduringthiscourse,priortoorduringinstallations.

Collecttherequiredtools
Observesiterequirementsandsafetyrequirements

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

Data DomainDocumentationisyourmostimportantresource.
Domain Documentation is your most important resource Priortoinstallingaparticular
Prior to installing a particular
DataDomainmodelinthefield,becomefamiliarwithInstallationandSetupguideand
relateddocuments.
Withanynewinstallation,aDocumentationCDisprovidedwiththeequipment. This
includesaDocumentationRoadmapandSafetyandRegulatoryinformation.
Alldocumentation aswellastrainingvideoscanbefoundattheDataDomainsupportportal
athttp://my.datadomain.com/underproductdocumentation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

UsealaptopcomputerasaterminaltologintothesystemandrunDDOScommands.The
Use
a laptop computer as a terminal to log into the system and run DD OS commands The
recommendedterminalemulationprogramisSecureCRT,configuredwitha5,000lineor
largerbuffer.AnyversionofSecureCRT issuitable.IfSecureCRT isnotavailable,usePuTTY
version0.58orlater.WindowsHyperterminal isnotrecommended.A2GBorgreaterUSB
flashmemorydriveisalsorecommended.
Thelistshowsadditionalitemsthatshouldbeastandardpartofyourinstallationtoolkit.
Take a moment to review before proceeding
Takeamomenttoreviewbeforeproceeding.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

The Data Domainapplianceshouldfitmostcommondatacenterracks.


TheData
Domain appliance should fit most common datacenter racks
Thewidthdimensionsofthe rackshouldbeastandard19inches.
ThedepthdimensionsdependontheDataDomainmodelandcanrangefrom23.543.5
inches.
TheheightdimensionsdependonthenumberofDataDomainsystems.Forexamplea2U
DataDomaincontrollerwiththreeexpansionShelveswoulduseatotalof11Uspace,where
1Uis1.75inches.Withthisexample,a15Udepthrackwouldmeettherequireddepth.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

Most Data Domain systems support the hot addition of expansion shelves. Some models
support six or more expansion shelves, with as many as 24 shelves in the case of Global
Deduplication Array and Data Domain Archiver systems. These large capacity systems
require additional planning and resources for installation.
Here are some general requirements for a large capacity installation:
The physical rack height requirement is often 40U or greater. 2U or 4U is needed for the
Data Domain controller, depending on model, while 3U is needed for each expansion
shelf.
If necessary, installation may be split across more than one rack, but will require advance
site-specific planning to determine appropriate SAS or interconnect cable lengths.
Whenever possible, grouping shelves in logical sets within contiguous rack spaces will
simplify the shelf-to-shelf SAS cabling.
The logical spacing of the shelves are divided into 3 or more Shelf Sets, labeled 1, 2, and
3, and so forth. The shelf order should alternate between shelf sets as seen in the
diagram.
The three recommended cable lengths for connection among expansion shelves and the
controller are 0.5, 1.0. and 2.0 meter cables. Use 1 meter and 2 meter head-to-shelf and
meter shelf-to-shelf.
Tip:
To allow for simple, predictable upgrades, if the site expects further expansion of storage
capacity in the future, plan ahead by leaving space in the rack for additional shelves
based on the maximum amount of expected storage.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation

Generalsafety
General
safety shouldbeobeyedforanyinstallation.Thisincludes:
should be obeyed for any installation This includes:
ElectricalSafetyProceduresthatreducetheriskofelectricalshock
Liftingand HandlingSafetyProceduresthatreduceriskofinjury.
Formostinstallations,aminimumoftwopeopleisrequiredtomounttheunits.
DataDomainElectrostaticSafetyproceduresthathelpavoiddamagetocomponentsdueto
electrostaticdischarge.
PleasereviewtheDataDomainSystemSafetyandRegulatoryInformationdocumentpriorto
y
y
g
y
p
installation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 10

This module covered the topics shown


Thismodulecoveredthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 11

In this module you learn how to install the hardware for various Data Domain solutions
InthismoduleyoulearnhowtoinstallthehardwareforvariousDataDomainsolutions.
Inthismodule,youwilllearnhowto:

Unpackthesystemandverifyshipment
Installrackmounts
InstalltheEMCDataDomaincontrollerunit
Installexpansionshelves
Connectexpansionshelvesorexternalstorageunitstothecontroller
Enabledatatransferconnectivityy
Connectanadministrativeconsole
Connectpowerandturnonthesystem

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 12

Thislessondescribes
This
lesson describes howtounpackandverifyshippedcontents,andcoversthetopics
how to unpack and verify shipped contents and covers the topics
shown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 13

Let scheckthecomponentsof
Lets
check the components of atypicalshipment.
a typical shipment
Whenyoufirstopentheboxyoushould see:
Ascrewdriver,documentation,powercordsandanullmodemcable.
Youshould alsoseethepackagedrails
Thereshouldalso betherailinstructionsandtheDatadomainsystem.
Onceonsite,makesure youverifytheDataDomainequipmentreceivedagainsttheorder
placedbythecustomer.
Compareequipmenttopurchaseorderandpackingslip,EMCorderentrysystem,orcontact
theaccountteam.
Open andcomparethecomponents intheboxwiththeorderinformation.
Checkthatthefollowingarecorrect:
Systemmodel
Cards(HBA,NICs)
SystemCables
PowerCables
Note thatinashipmentwithmultipleappliances,differentappliancesmayhavedifferent
that in a shipment with multiple appliances different appliances may have different
licenses.Makesureyouinstallthecorrectlylicensedapplianceforitsfunctioninthe
topologyforthesite.
Ifforanyreason, theequipmentisnotcorrect,immediatelycontactDataDomainsupport.
Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 14

Onceonsite,makesure
Once
onsite make sure youverifytheDataDomainequipmentreceivedagainsttheorder
you verify the Data Domain equipment received against the order
placedbythecustomer.
YoumayhavetogetthePurchaseOrderfromcustomerifitisnotintheshipping box.
Open andcomparethecomponents intheboxwiththeP.O.
Checkthatthefollowingarecorrect:

System model
Systemmodel
Cards(HBA,NICs)
SystemCables
PowerCables

Note thatinashipmentwithmultipleappliances,differentappliancemayhavedifferent
licenses.Makesureyouinstallthecorrectlylicensedapplianceforitsfunction.
Ifforanyreason, theequipmentisnotcorrect,immediatelycontactDataDomainsupport.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 15

This lesson describes howtorackmounthardware,andcoversthetopicsshown.


Thislessondescribes
how to rack mount hardware and covers the topics shown

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 16

Therearethreetypesofpossibleracks;around,asquareoratappedholerack.Thescrews
There
are three types of possible racks; a round a square or a tapped hole rack The screws
thatyouusetofastentheouterrailstotherackwilldependonwhichtypeofrackisused.
Eachofthescrewtypesareclearlylabeledwiththeequipmentkit.Usethelabeledscrews
providedwiththeappropriaterack.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 17

Cagenutsareonlyrequiredwhenfasteningarailtoasquareholedrack.Cagenutsarenot
Cage
nuts are only required when fastening a rail to a square holed rack Cage nuts are not
requiredwhenusingaroundortappedholerack.Useacagenuttooltoattachthecagenut
totherackpost.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 18

RackmountingofData
Rack
mounting of Data DomainControllers
Domain Controllers involvesseveralbasicstepscommontoallunits,
involves several basic steps common to all units
withsomevariations.
Thestepsare,to
First,preparetherackholes,workingwiththecorrectscrewsandapplyingadaptersforthe
correcttypeofhole,ifnecessary.
Second,installthesliderailstotherackitself.
Thenyouattachrailstoeachsideofthecontroller.
Onceallrailsareinplaceyoucanmountthechassis,secureittotherack,andfinallyattach
thefrontbezel.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 19

Reviewtherackatthesite,andthekit componentsforthecorrectmountingscrewsoradaptersforthetypeofholesintheracks.If
necessary installadaptersfromthekit.
i
ll d
f
h ki
Toinstallthesliderailsorouterrailstotherackposts:
Notethatsomerailsrequirethatyouremove theinnerchassisrailsfromtheouterrailsfirstbeforeproceding.
Ateachrackpost,determinetheverticalpositionintherackwheretherailsare tobeinstalled.Thetopmostmountingholefora
particularrackunit(RU)mounting positionistypicallyidentifiedbyamarkorhole.Racksmayalsobescreenprintedto showthepositions
oftherackunits. Makesurethattherails areinstalledinholesthatareverticallyalignedfromfronttoback. Iftherailismountedinholes
thatarenotverticallyaligned,therailmaybedamagedandmountingwillnotbesecure.If necessary, loosen the two screws on the
inside of each bracket so that you can adjust the length to fit your rack. Then, extend the rails to fit between the front and rear racking
posts. Attach the rails tightly to the front and rear of the rack. Attach the clamping screws tightly. Attach the rail to the right-side of
the rack using the same procedure.
ToattachthechassisrailstotheDataDomainsystem:
Some newer Data Domain models come with rack slides pre-installed on the chassis, fastened with pop-rivets. This greatly simplifies
the procedure for completing the installation. In that case, you can skip this step. For units that do not ship with preinstalled rack
slides on the controller, you attachtherailsasfollows:Alignthekeyholesontherailwiththemounting pegsonthesideofthechassis.
Holdtherailflushagainstthesideofthechassis.Withtherailagainstthechassishousing,pushtherailtowardtheback of the chassisso
thatthenarrowendsofthekeyholeengage themountingpegs.Pushtherailbackuntilthefrontlatchingtabengages.Iftherailsdonot
havepegsbutrequirescrews,addthescrewsandtightensecurely.Attach therailtotheothersideofthechassisusingthesame
procedure.
ToinstalltheDataDomainsystemintherack:
y
Usecautionwhenmountingdatadomain controllersintherack:Toavoidinjury,thisprocedurerequirestwopeople.
For rails that slide out from the rack, pull the ball-bearing slide to the front of the rail.Withoneinstalleroneachsideofthesystem,lift
thechassis.Ateachside,alignthechassiscomponentwiththerackcomponentandslidethe chassisintotherack.Carefullyslidethe
chassisallthewayintotherack.
Notethatsomerailassemblieshaveasecuritycatchthatpreventsaninstalledunitfrom accidentallyslidingallthewayoutoftherails.The
securitycatchmayinterruptthe movementofthechassisintotherackasyouslideitin.Ifthesecuritycatchpreventsthechassisfrom
slidinginsmoothly,pullbackonthe releasebuttonateachsideofthechassis,andpushthechassistherestofthe wayin.
Tosecurethesystemtotherack, ateachsideofthechassis,alignandtightenthethumbscrewtosecurethesystemto therack.
Toinstallthebezel:
MostbezelsforthefrontoftheDataDomainsystemhavemagnetstoholdtheminplaceagainst thesystemchassis.Setthebezelagainst
thefrontofthesystemandverifythatthe magnetsholdthebezelinplace.Adjustthepositionasnecessarytofitthebezelproperly.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 20

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 21

This table highlights the major differences between the ES20 and ES30 shelves.
shelves These
include the number of hard drives, the hard drive sizes and spares, and the type of cable
and SAS connector position. The commands and auto supports along with the racking
and railing will be discussed later in this course.
Explore additional information on this table by clicking on the icons.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 22

This shows the ES20 and ES30 hard drive specifications.


specifications

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 23

The ES30 cable is a min-SAS to mini-SAS cable.


cable

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 24

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 25

The ES20 uses two types of cables.


cables

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 26

This picture compares the ES20 and the ES30 controller location
location, expander ports and
host ports.
Make sure you can identify these components in both types of shelves.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 27

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 28

This shows the front panel of the Data Domain system with the bezel removed.
removed

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 29

The hard drives are labeled from left to right as shown in the picture.
picture

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 30

This shows the disk enclosure LED- specifically the disk enclosure power LED
LED.
The table shows the conditions for the disk enclosure LEDs.
This shows the disk enclosure LED- specifically the disk enclosure fault LED.
The table provides the conditions associated with the LEDs.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 31

This shows the disk active LED.


LED
This table provides the conditions for the Disk LEDs.
This shows the disk fault LED.
This table provides the conditions for the Disk LEDs.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 32

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 33

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 34

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 35

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 36

This shows the back panel of ES30 system.


system
A new chassis is introduced with the ES30. It is important that you know the differences
between the ES30 and ES20 components.
Please take a few moments to explore the components.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 37

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 38

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 39

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 40

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 42

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 43

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 44

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 45

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 46

Thislessonsdescribeshowtoconnectexpansionshelvestothecontroller,andcoversthe
This
lessons describes how to connect expansion shelves to the controller and covers the
topicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 47

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 49

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 50

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 51

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 52

This lessons describes how to manage shelf capacity licensing Itcoversthetopicsshown.


Thislessonsdescribeshowtomanageshelfcapacitylicensing.
It covers the topics shown

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 53

Shelf Capacity License is new as of DD OS 5 1


ShelfCapacityLicenseisnewasofDDOS5.1.
TheShelfCapacitylicenseisnotsupportedwithDDOS5.0andbelow.
AllexpansionshelveswhetherES20orES30arenowissuedaStorageCapacityLicensekey
withtheirpurchase.
IftheenvironmentisrunningDDOS5.1,thelicensekeyshouldbeapplied.
AnexceptionisforoldES20shelvespurchasepriortoDDOS5.1.Thesearegrandfathered
anddonotrequireakey.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 54

Here'ssasummaryoftheShelfCapacityLicense.
Here
a summary of the Shelf Capacity License
Shelfcapacitylicenseisissuedforallnewshelves(ES20orES30)(wheneverwerollout5.1
release).
Oldshelvesaregrandfatheredandwillnotrequirealicense.
ShelfcapacitylicensesareNOTtiedtotheheadchassisserialnumberortheshelfserial
number,customercanmovethelicensefromoneheadtoanotherheadorusetheshelf
capacitylicenseforothershelves.
ShelfcapacitylicensesarenotrequiredwithDDOS5.0andolderreleases.
ShelfcapacitylicensecanbeinstalledonlyonDDOS5.1systems.Ifcustomertriestoinstall
onDDOS5.0andolderDDOS,thefollowingmessagewillbeseen.
****Error"<shelfcapacitylicense>":Inapplicablelicensecode.Thiswillbedocumentedto
customer.
SFDC(SalesForce)willbepopulatedwiththeshelfcapacitylicensefromdatafromSAPand
autosupport sothatsupportcanretrievethelicensesincasecustomerlostthelicensesfrom
onecentralplace.
Ifcustomersendsautosupport forsystems,wewillhaveatrackwhichsystemshavewhich
licensesinSFDC,ifnot,wewilltrackthelicensesbasedonthesalesorder(againinSFDC).

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 55

As of DD OS 5 1 there are now two license categories tied to capacity


AsofDDOS5.1therearenowtwolicensecategoriestiedtocapacity
ExpandedStorage
andtheNewshelfcapacitylicense.
Theexpandedstoragelicenseprovidestheabilitytoexpandstoragebeyondthebase
capacity

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 56

In this scenario you want to upgrade your existing environmenttoDDOS5.1.


Inthisscenarioyouwanttoupgradeyourexisting
environment to DD OS 5 1
TheexistingenvironmentincludesoneDataDomainsystemw/threeES20Shelves.
YouwanttoupgradefromDDOS5.0toDDOS5.1
SincetheES20shelveswerepurchasedandinstalledpriortoDDOS5.1,noShelfCapacity
Licensekeywasissuedandthusnolicensekeyrequired.
TheoldES20shelvesaregrandfathered.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 58

In this scenario you want to implement a new environment


Inthisscenarioyouwanttoimplementanewenvironment.
ThenewenvironmentincludesoneDataDomainsystemw/threeES30shelves.
TheDataDomainsystemrunsDDOS5.1
AShelfCapacityLicensekeyisissuedandmustbeapplied.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 59

In this scenario you have an existing environment and want to add new ES20 shelves
InthisscenarioyouhaveanexistingenvironmentandwanttoaddnewES20shelves
TheexistingenvironmentincludesoneDataDomainsystemw/oneES20shelfrunningDD
OS5.0
YouwanttoaddtwoES20shelves.
AllnewshelvesareissuedaShelfCapacityLicense. However,keyscanonlybeappliedtoDD
OS5.1+.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 60

In this scenario you have an existing environment and want to add new ES30 shelves
InthisscenarioyouhaveanexistingenvironmentandwanttoaddnewES30shelves
TheexistingenvironmentincludesoneDataDomainsystemw/oneES20shelfrunningDD
OS5.0
YouwanttoaddtwoES30shelves.
YouwillbeissuedtwoShelfCapacityLicensekeys(oneforeachES30).
However,keyscanonlybeappliedtoDDOS5.1+.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 61

InthisscenarioyouhaveanexistingenvironmentandwanttoupgradeandaddnewES30
In
this scenario you have an existing environment and want to upgrade and add new ES30
shelves.
TheexistingenvironmentincludesoneDataDomainsystemw/oneES20shelfrunningDD
OS5.0
YouwanttoupgradetoDDOS5.1andaddadd twoES30shelves.
YouwillbeissuedtwoShelfCapacityLicensekeys(oneforeachES30).
Youwillhavetoapplyallkeys(two)sinceitisrequiredfornewshelvesrunningDDOS5.1+.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 62

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 63

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 64

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 65

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 66

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 67

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 68

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 69

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 70

This lessons describes how to establish network connectivity usingtheproceduresshown.


Thislessonsdescribeshowtoestablishnetwork
using the procedures shown

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 71

Attach a serial console to the controller


controllerss serial port; or use KVM connections to connect monitor
(VGA port), keyboard and mouse.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 72

The equipment comes with a null model cable.


cable If the PC doesn
doesntt have a serial port ensure that
you have a USB to RS232 cable or adapter in order to connect via the console.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 73

Here we see a summary of the Optional PCI-x


PCI x Cards.
Cards
Connecting the Appliance to the LAN uses single or dual port copper 1 Gb or 10 Gb Ethernet
NIC cards.
Connecting the Appliance to the Media server via Fiber Channel can use a single or dual
port 2 Gb or 4 Gb HBA VTL card.
Connecting the appliance to the ES20 or ES30 via Fiber Channel can use a single or dual
port 2 Gb or 4 Gb SAS HBA card.
card

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 74

Heressanexampleofabackupenvironment
Here
an example of a backup environment withDataDomainalongwiththeconnectivity
with Data Domain along with the connectivity andthe
and the
typeofPCIXcardsutilizedforeach.
TheyellowspecifiestheDataDomainconnectivitytoaLANnetworkviaEthernetcard.
ThebluespecifiestheDataDomainconnectivitytotheExpansionShelfviaFiberchannelspecifically
usingaSASFCHBAcard.
ThegreenspecifiestheDataDomainconnectivitytotheMediaserverviaaFiberchannelspecifically
using a VTL FC HBA card
usingaVTLFCHBAcard.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 75

Here sanexample
Heres
an example oftheEthernet(LAN)Cables.Allmodelsupportthe1GbEthernetcable
of the Ethernet (LAN) Cables All model support the 1GbEthernet cable
whileonlycertainmodelsupportthe10GbEthernet.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 76

Heressanexample
Here
an example oftheSAN(Fibre
of the SAN (Fibre Channel)Cable.UsedisanLCtoLCfibre
Channel) Cable Used is an LC to LC fibre Channelcable.
Channel cable

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 77

Thislessonsdescribeshowtopower
This
lessons describes how to power upthesystemandcheckoperationalstatususingthe
up the system and check operational status using the
proceduresshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 78

To provide redundant power to the system,


system connect power cables to both receptacles on the
controller.
On each cable, attach the cable rentention clips or restraints. Connect power cables to both
receptacles on each expansion shelf. Attach the power cable retention clips or restraints.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 79

Turn the system on


on. Power on all expansion shelves before the controller.
controller Turn the power switch
to on for each of the two power supplies for each expansion shelf. Wait approximately 3 minutes
after all expansion shelves are turned on, then push the power button on the controller.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 80

ToverifytheSASStateLEDconnectionStatussimplylookatthebackpaneloftheES20or
To
verify the SAS State LED connection Status simply look at the back panel of the ES20 or
ES30andtheLEDstate.

Whiteindicatestheexpansionshelfisoff.
FlashinggreenindicatesthattheexpansionshelfandtheDDapplianceare
establishingaconnection.

Solidgreenindicatestheconnectionhasbeenestablished.
Amberindicatesaconnectivityproblem.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 81

This module covered the topics shown


Thismodulecoveredthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 82

Afterhardware
After
hardware installation,youperforminitialconfigurationofthesystemasdescribedin
installation you perform initial configuration of the system as described in
thismodule.
Youwilllearnhowto:

Collectrequiredinformation
LoginwithaTerminalEmulator
L i ith T
i lE l t
UsetheConfigurationWizard
Bringexpansionshelvesonline

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 83

Thislessonsdescribeshowtoperforminitialsystem
This
lessons describes how to perform initial system configurationusingtheprocedures
configuration using the procedures
shown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 84

Obtain important configuration information beforeyoustartworkingintheconfigurationwizard.


Obtainimportantconfigurationinformation
before you start working in the configuration wizard
Thesysteminstallationdocumentationprovidesaworksheetforgatheringtheinformation.
Installationprofessionalsarealsostronglyencouragedtousethepreengagementquestionnaire,or
PEQ,provided toallfield personnel,which provides asectionforgathering comprehensive
configurationinformation,aswell asother sectionsforgathering importantdetails forthesite,such
ascontactinformation.
For the initial configuration make sure that you have the following information on hand during the
Fortheinitialconfiguration,makesurethatyouhavethefollowinginformationonhandduring
the
procedure:
Login default password. This value is the Data Domain systems serial number, located on its rear
panel. The DataDomainsystemdefaultusernameissysadmin whilethedefaultpasswordisthe
serialnumber.Theserialnumberlocatedonthebackpanelandshouldbea10digitnumber.
Initial configuration also requires a fully qualified hostname for the Data Domain system. You should also have Site
domain name, and any licenses for the site.
Very rarely a site might require use of the Dynamic Host Configuration Protocol (DHCP). If this is the case, youll need
to know the port on the switch for DHCP.
If you are not using DHCP, determine the values you need to enter during the configuration procedure:

Interface IP addresses

Interface netmasks

Routing gateway IP address

If using DNS, the list of DNS servers.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 85

If the information is available at initial configuration,


configuration you should also note CIFS authentication
details, and backup server and administrator details. Best practice is to have a separate
domain administrator account and password. For the backup servers, note that the
configuration default uses the asterisk to allow everyone in facility to write to the backup.
This could be a security violation at the site. In most cases, you should specify which hosts
are permitted. Space is also provided for a description of the physical location of the system.
The location should be descriptive enough to allow support to quickly identify the system, for
di
dispatch
t h iinformation.
f
ti
FFor example,
l thi
this might
i ht iinclude
l d th
the ffacility
ilit llocation,
ti
as well
ll as server
location within the facility.
For the mail server, note that this SMTP server in the location must be able to relay email
externally to data domain support; a change or addition in the mail relay may be necessary.
If using a Virtual Tape Library, obtain the WWN numbers of the initiators. World-Wide Name (WWN) is a
unique identifier in the Fibre Channel (FC) environment.
environment
If you will be configuring your Data Domain system to interface with a VLAN, the VLAN IP addresses should
be collected.
ThefirewallshouldbeconfiguredsothatonlyrequiredandtrustedclientshaveaccesstotheDataDomain
system.ConsultwithyourDataDomainsystemengineerforinstructionsonsettingupNFSandCIFSaccess
throughafirewall.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 86

Launch the terminal program on your laptop and configure the following
communication settings:
3. Enable logging of the session.
4. Log in to the system.
Setting Value
BAUD Rate 9600
Data Bits 8
Stop Bits 1
Parity None
Flow Control None
Emulation VT-100

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 87

Atthefirstlogin,theconfigurationutilitystarts.Therearesixsectionstotheconfiguration:Licenses,Network,
g ,
g
y
g
,
,
FileSystem,System,CIFS,andNFS.Theconfigurationutilityguidesyouthroughtheconfigurationsteps,one
sectionatatime.IftheCLIConfigurationWizarddoesnotstartimmediatelythefirsttimeyoulogin,youcan
runitatanytimebyenteringthecommand:config setup.Completeallsixsections.Thelistentriesinthe
utilitycanbecommaseparated,spaceseparated,orboth.Ateachprompt,enteravalue,OREnteraquestion
mark(?)formoredetails,ORPressEntertoacceptthevaluedisplayedinbraces.Followtheconfiguration
utilityinstructionsforenteringappropriatevalues.Attheendofeachconfigurationsection,youcanchooseto:
Save Savethedisplayedconfiguration.Cancel Deleteallnewvaluesandgotothenextsection.Retry
Restarttheinputentryatthebeginningofthecurrentsection.Thevalueenteredpreviouslyappearsasthe
defaultvalueateachprompt.Foreachconfigurationsection,youarepromptedtoansweraseriesof
q estions At the end of each section a s mmar of o r entries is displa ed Yo can accept or reject o r
questions.Attheendofeachsection,asummaryofyourentriesisdisplayed.Youcanacceptorrejectyour
changesandgotothenextsection,orreturntothebeginningofthatsectionandchangeanyofthesettings.
WhenyouselectRetry,youareshownyourpreviousentriesforeachprompt.#config setupTypeyto
configureasection.Typentoskipasectionandgotothenextone.Typeaquestionmark(?)ataprompt
todisplaymoreinformation.PresseithertheEnterorReturnkeytoacceptthegivenvalue,suchas[mail],or
typeanewvalue.Tomakemultipleentriesinthelist,separateeachentrywitheitheracommaoraspace.
Whenpromptedforahostname,entereitheritsIPaddressoritsfullyqualifiedhostname,suchas
srvr22.company.com.ToexittheCLI,youhavetoconfigureorskipeachofthesections,orenterCtrl+C.After
theconfigurationiscompleted,theCLIpromptsyoutorebootthesystemifarebootisrequired.Toactivate
licensed features installed on your system enter a valid license key Enter the license characters including
licensedfeaturesinstalledonyoursystem,enteravalidlicensekey.Enterthelicensecharacters,including
dashes,foreachfeatureyouhavelicensed.Forexample,enterABCDABCDABCDABCDIfyouhavenot
licensedacategory,makenoentry.IfusingtheCLI,presstheEnterkey.
ConfiguretheNetwork:
EntertheDataDomainsystemshostname,whichisafullyqualifiednamethatincludesthedomainname.For
example,enterdd01.xyz.com.Enteradomainname,suchascorporation.com,forusebytheDNS,oraccept
thedomainnamethatispartofthehostname.Forexample,enterxyz.comforthehostnamedd01.xyz.com.
ConfigureEthernetInterfaces(Ports)1.Enabletheport.2.SelectwhetherornottouseDHCPontheport.22
TheConfigurationWizardIfyouareconfiguringthesystemusinganEthernetinterfaceandyouchoosenotto
use DHCP the Ethernet connection is lost when you complete the configuration If you have already set up
useDHCP,theEthernetconnectionislostwhenyoucompletetheconfiguration.Ifyouhavealreadysetup
DHCPforoneormoreDataDomainsystemEthernetinterfaces,theIPaddressandnetmask promptsdisplay
thevaluesgiventotheDataDomainsystemfromaDHCPserver.PressEntertoacceptthesevalues.IfDHCPis
notconfiguredonaport,entertheIPaddressandthenetmask fortheport.Ifanyoftheportsarenotusing
DHCP,specifyanIPaddressforadefaultroutinggateway.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 88

IfnoneofyournetworkportsisconfiguredtouseDHCP,orDHCPisnotconfiguredtoprovidetheDNSservers,youcanspecifyone, two,or
threeDNSserverstoresolvehostnameswithIPaddresses.Dooneofthefollowing:Entertheservernameornames,separatingitemsin
h
DNS
l h
i h IP dd
D
f h f ll i
E
h
i i
i
thelistwitheitheracommaoraspace,orChoosetoenternoserversbypressingtheEnterkey.Inthiscase,usethenet hostscommand,
whichisdescribedintheDDOS5.0CommandReferenceGuide,toinformtheDataDomainsystemofIPaddressesforhostnames. Press
Enter.IfyouhaveadditionalEthernetports,setthemupasdescribedabove.Aftersavingtheportconfiguration,allowup to twominutes
fortheDataDomainsystemtoupdatetheinterfaces.
Enterthefollowinginformation:System:AdminHost(Required)EnterahostnamethatwillhaveadministrativeaccesstotheDataDomain
system.Whenyoulogintothishostviatheinternetorintranet,youcanviewsystemlogsandrunsystemcommands.Thehostname canbe
afullyqualifieddomainname,asimplehostname,oranIPaddress.Thehostisaddedtoalladministrativeaccesslistsandissetupasan
NFSclientforboththe/backupand/ddvar directories.AdminEmail(Required)Entertheemailaddressoragroupaliasthatistoreceive
emailfromtheDataDomainsystem.Bydefault,theDataDomainsystememaillistincludesanaddressfortheDataDomainSupport group.
Thesystemusestheemailaddressasthesenderofalertandautosupport emailmessagesfromthissystem,andalsoastherecipientfor
these messages Notes:
thesemessages.Notes:
Theautosupport featuresendsadailyreporttoDataDomainSupportthatshowssystemidentificationinformationandconsolidated
outputfromDataDomainsystemcommandsandentriesfromvariouslogfiles.
AlertsoccurwheneverthesystemsRestoreProtectionManagerdiscoversaproblemwithsoftwareoramonitoredhardware
component.Thealertcommandmanagesthealertshistoryfileandwhoreceivesemailnotificationforsystemalerts.
Formoreinformationaboutautosupport andalerts,seetheDDOS5.0AdministrationGuide.
SystemLocationEnteraphysicallocationthatidentifiesthissystemforuseinautosupport emails.Forexample,enterBldg4rack10.The
alertsandautosupport reportsdisplaythelocation.
SMTPMailServerEnterthenameofalocalSMTP(mail)serverthatrelaysDataDomainsystememails.IftheserverisanExchangeserver,
besurethatSMTPisenabled.}
TimeZoneThesystemdateisalreadyset.
Determineyourlocaltimezone.ThedefaulttimezoneforeachDataDomainsystemisUS/Pacific.
N t E h ti
Note:Eachtimezoneconsistsoftwoparts,whichareseparatedwithaslash(/).}
i t ft
t
hi h
t d ith l h (/) }
}NetworkTimeService(NTP)ServersThedefaultistoenableNTPandtousemulticastforNTP.IfDHCPissetup,dothefollowingonlyif
theDHCPserverisnotconfiguredtoprovidetheNTPservers:ToallowtheDataDomainsystemtouseoneormoreNetworkTime Service
(NTP)serverstosynchronizeitsclock,entertheirIPaddressesorservernames,separatedbycommas.
RebootingtheDataDomainSystem
Afterconfiguringthesystem,reboottheDataDomainsystemusingtheCLI.
Enter:#systemreboot
Note:IfyouareusingtheEnterpriseManager,logoutoftheEnterpriseManagerandcloseitsWebbrowserwindowbeforeenteringthe
systemrebootcommand.Otherwise,warningmessagesmightdisplaywhenthesystemreboots.
VerifyingNetworkConnections
ItisrecommendedthateachDataDomaininterfaceonwhichtrafficisexpectedistestedforconnectivityusingthepingcommand.
E
Enter:#pinghostname
# i h
wherehostnameisthehostnameoranIPaddressassociatedwiththeinterfacebeingtested.Eachinterfacemusthaveaunique hostname
orIPaddress.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 89

Bringing the expansion shelves online involves a number of steps


steps. First check the status of the
HBA by running the disk port show summary command. The status is online if the connection is
established between the data domain system and the expansion shelf. The output shows the port
for each sass connection the online status which is off-line at first. To verify that the data domain
system recognizes the shelves run the enclosure show summary command. This command shows
each recognized enclosure ID data domain system model number serial number and slot
capacity. To make each disk enclosure available to the data domain system run the storage add
enclosure command with the enclosure ID
ID. In this case we
well
ll add enclosure two.
two Note the disks
cannot be removed from the filesystem without reinstalling the DD OS after they've been added.
To verify the enclosure availability in space you can run the disk show state command or the DF
command. The DF command shows the capacity of the system. It should increase after adding an
expansion shelf.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 90

This module covered the topics shown


Thismodulecoveredthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 91

Following initial system configuration


configuration, you can perform additional configuration tasks as
described in this module.
In this module you'll learn how to:
Use the Enterprise Manager for additional configuration
configure remote management through IPMI and SOL
verify the installation according to the customer requirements
perform basic configuration of the data domain Archiver system
and get started with data domain GDA system configuration

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 92

After the initial configuration


g
of a new site using
g the CLI Wizard allowing
g basic connectivityy on a LAN,, you
y
can then perform additional configuration and system management tasks through a web browser
anywhere on the LAN using the Enterprise Manager.
To access the system using Enterprise Manager, open web browser and type the host name. Login to the
Enterprise Manager using the administrative username and password entered during initial configuration
with the CLI Wizard. On the left-hand side of the Enterprise Manager expand the network and select the
system you want to manage as a follow-up to your initial configuration of the system.
You may want to perform a number of simple tasks to complete the work. For example, under system
settings, you'll find licenses. You may want to confirm here that all licenses for the installation have been
added If a license was missed during the initial configuration or additional time and research was
added.
required to acquire license information, you can enter it here by clicking Add New License, and then simply
type in the license key and click OK. Under the Access Management tab, you can expand options for
management of the system providing access to various protocols. If any of this information was passed
over during the initial configuration you can add it here.
Click more tasks and one of these options:
Configure Telnet allows you to enable telnet and then determine the type of access you would like. For
limited access, you can add specific hosts by clicking the plus icon and typing in the name of the host and
then click okay. A similar configuration is available for FTP access, HTTP and secure HTTP, and SSH. And
you can also modify the password policy.
policy
You can also add new users to the system if after initial configuration you received additional information
about users. You can also modify and change passwords for existing users. To create a new user, click
create and add the user information.
Under the Data Management tab, you can perform additional CIFS configuration and NFS configuration if
necessary following the CLI configuration Wizard, or, under the Maintenance tab, click the More Tasks
button and launch a GUI-based configuration Wizard. The configuration wizard in the Enterprise Manager
walks you through all of the same configuration tasks found in the CLI Wizard.
Additional
dd t o al use
user related
elated co
configuration
gu at o tasks
tas s ca
can also be performed
pe o ed tthrough
oug tthe
eC
CLI.. You
ou can
ca add use
userss to
the system add users to the e-mail lists that report system problems, add users to the system report e-mail
list, and change a user's password using the CLI commands shown here. You can also perform the
additional network related tasks in the CLI including giving access to additional backup servers, enabling
FTP or telnet, and adding remote hosts to use the FTP or telnet connection.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 93

Thislessonsdescribeshowtoconfigure
This
lessons describes how to configure remotemanagementofDataDomainsystems
remote management of Data Domain systems
throughtheIPMIandSOLprotocols.Itcoversthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 94

DataDomainsystemsrunningwithDDOS5.0orgreaterutilizetwoindustrystandard
Data
Domain systems running with DD OS 5 0 or greater utilize two industrystandard
specifications,overIntelligentPlatform ManagementInterfaceIPMIandSerialoverLAN
(SOL),toenableremotepowerandconsolemanagementcapabliities whileawayfromthe
site.
TheseremotepowermanagementcapabilitiesaresupportedthroughIPMI:
PoweronoftheDataDomainsystemafterpoweroutage
PowercycleafteraDDOScrash
Poweroffforpowersavingsonsystemsnotcurrentlyinuse
Obtainpowerstatus
TheseconsoleactivitiesaresupportedthroughSOL:
Rundiagnostics
Install,upgrade,orreconfiguretheDDOS
AccesstheBIOS
ViewvaluablePOSTandbootmessages
To learnmoreabouttheIPMIandSOLspecifications,visitthewebsiteshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 95

To learnmoreabouttheIPMIandSOLspecifications,visitthewebsiteshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 96

IPMI and SOL access requires either:


IPMIandSOLaccessrequireseither:
TwoDataDomainsystems,oneInitiator andoneTarget;
A Target Data Domain system and any computer with ipmitool installed as an Initiator.
ipmitool isanopensourceprogramformanagementofsystemsthatsupportIPMIv2.0.
ToenableacomputertobeusedasanInitiator,locateacompatiblecopyoftheopensourceipmitool
1.8.10,download,andinstallitonthecomputer.Youcanfindacopyofthetoolatthe
d
l d d
ll
h
f d
f h
l
h
websitesshown.
NotethatyouneedtoknowTargetsIPMIIPaddresstouseipmitool commandstomanagepoweror
getSOLaccess.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 97

ToenableacomputertobeusedasanInitiator,locateacompatiblecopyoftheopensourceipmitool
To
enable a computer to be used as an Initiator locate a compatible copy of the open source ipmitool
1.8.10,download,andinstallitonthecomputer.Youcanfindacopyofthetoolatthe
websitesshown.
NotethatyouneedtoknowTargetsIPMIIPaddresstouseipmitool commandstomanagepoweror
getSOLaccess.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 98

DependingontheDataDomainsystemmodel,accesstotheTargetforIPMIandSOLis
Depending
on the Data Domain system model access to the Target for IPMI and SOL is
throughoneofthefollowing:
AdedicatedIPMImanagementEthernetport(outofband access)
OR
AsharedEthernetportonthesystemmotherboard(sidebandaccess)withtwoIPaddresses,
onefortheLANandoneforIPMI

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 99

A number ofnewerDataDomainmodels
Anumber
of newer Data Domain models haveadedicatedIPMImanagementEthernetport.
have a dedicated IPMI management Ethernet port
AnEthernetcableisconnectedtothededicatedEthernetportandthentotheLAN.
ThededicatedEthernetportis:

ConfiguredwithanyavailableIPMIIPaddress
Bestifonaseparatemanagementnetwork,incasethedataLANgoesdown
UsedonlyforIPMIandSOLaccess
U d l f IPMI d SOL
ThededicatedEthernetportnameis:bmc0a
TheEthernetportsonthemotherboardcontinuetobeusedonlyfordataandnormal
operations

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 100

On other supported models without a dedicated port:


Onothersupportedmodelswithoutadedicatedport:
OneorbothofthestandardEthernetportsonthemotherboardmustbeconfiguredfor
sharedaccesswithanIPMIIPaddressconfiguredinadditiontotheregularIPaddress

TheIPMIIPaddressmustbeinthesamenetwork
AnEthernetcableattachedtotheLANisconnectedtothesharedport
EachIPMI
Each
IPMIenabled
enabledEthernetportisthensharedbothfordataandnormaloperationsandfor
Ethernet port is then shared both for data and normal operations and for
IPMIpowermanagementandSOLaccess

Sharedportnamesare:bmceth01,bmceth02

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 101

You can perform these IPMI configuration in one location in the Enterprise Manager
YoucanperformtheseIPMIconfigurationinonelocationintheEnterpriseManager.
OntheEnterpriseManageronthetarget,gotoMaintenance>IPMI. Youcan:Enablethe
IPMIport, configuretheIPMIIPaddress, andaddoneormoreIPMIusers.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 102

Under the Maintenance tab in the Enterprise Manager you can configure IPMI for remote
management of the system.
To configure IPMI you must configure network ports. For manual entry, enter the IP address and
net mask. For the systems configured for DHCP you can choose dynamic. You must also add a
user by clicking the Add User button, typing the username and password.
After the configuration you manage the remote system by clicking Login to Remote system, and
then selecting
g a managed
g system
y
or typing
yp g in the IP address or DNS name of another system
y
on
the network, with the username and password for an IPMI enabled user.
The IPMI power management dialog box allows you to power up, power down, or power cycle the
remote system after installation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 103

In the Enterprise Manager on a Data Domain initiator you can avoid the need to enter the IP address
IntheEnterpriseManageronaDataDomaininitiatoryoucanavoidtheneedtoentertheIPaddress
ofthetargeteachtimeyouaccessit:Addthetargettothelistofmanagedsystemsintheleft
navigationbar.
AfteryoulogintotheGUI,expandthelistofmanagedsystemsintheleftnavigationbar.
ThenclicktheAddbutton.TheAddSystem(s)dialogappears
EntertheDNSnameorIPaddressinSystemNamefield,andsupplythecredentialsofan
administrative user in the appropriate fields
administrativeuserintheappropriatefields.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 104

TouseSOL,youmustredirecttheconsoleforSOLaccess.Thisconfigurationcanonlybe
To
use SOL you must redirect the console for SOL access This configuration can only be
doneintheCLI.
Ontargetsofanymodel,enterthesystem option set console lan CLIcommand.
Anexampleisshownonscreen.
EnterYestoproceedwhenprompted(thissetsthegrub settingtotty0).
Ifprompted,enteryestorebootthesystem.
Note:Youshouldrunthesystem option set console lan commandevenifyou
donotplantouseSOLduringnormaloperations.SOLshouldbeenabledonallsystemssoit
canbeusedwhenemergencyaccessisrequired.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 105

IPMIremotepoweroffandpowercyclecommandsperformahardresetandshouldonlybe
IPMI
remote power off and power cycle commands perform a hard reset and should only be
usedforemergencies
Ifatallpossible,itisbesttologindirectlyandrebootwiththesystem reboot command
ortheGUIMaintenance>RebootSystemoptionbothalternativesperformagracefulshut
downoftheremotesystem

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 106

Before leaving the site it


it'ss good practice to verify the installation against the customer
requirements and the site requirements. Make sure that you verify licenses purchased for the
system and add any licenses that might be missing. The best practice is to send an auto support
report with the install status of the system. You can use the CLI commands shown to send an email and then verify receipt of that e-mail at the specified e-mail address. And perform one final
review of the installation checklist.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 107

Thestepsfor
The
steps for initialconfigurationoftheDataDomainArchiveraresimilar
initial configuration of the Data Domain Archiver are similar tothosefora
to those for a
regularDataDomaincontroller.Followthe instructionsforInitialConfiguration.
Aftertheinitial setupiscomplete,implementtheArchiverspecific procedurescoveredin
this lesson.
ConsultwiththesitesadministratorandDataDomainsupporttoperformthespecific
configurationdetails.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 108

AfterinitialconfigurationofanewlyinstalledArchiversystemusingtheCLIwizard,setupthesystemintheEnterpriseManagerasfollows.
Selectthesystemtobeconfiguredfromthenetworklistontheleft.
IntheDataManagementtab,underFileSystem,clickMoreTasksandchooseCreateFileSystemfromthedropdownmenu.
IntheFileSystemCreatedialogbox,makesurethedefaultoptiontoCreateanarchivecapablefilesystemisselected,then clickNext.
Thedialognotifiesyouthatthefilesystemrequiresstoragetobeconfigured.Todoso,clickConfigure.
Carefullyreviewandconfirmthesizingrequirementsforthesite,andbasedontherequirements,selecttheappropriatestorage toaddas
theactivetier.
NotethatyoucanusethedropdownmenutodesignatethetypeofDDArchiverstorage.
Addtheappropriatestorageforthearchiveunit.
ClickOk.
The Configure Storage Status window displays the progress in setting up the storage
TheConfigureStorageStatuswindowdisplaystheprogressinsettingupthestorage.
ClicktheClosebuttonwhentheprocessiscomplete.
ClickNexttoviewasummary,andthenFinishtoexecutetheconfiguration.
Aftertheprocessiscomplete,clickOk.
ToconfigureDatamovementandcleaning, Undertheconfigurationtab,clicktheEditbuttonforDataMovementPolicy. Unlessinstructed
otherwise,acceptthedefaultsettingsandclickOK.
ClickEdittoviewthedefaultCleanSchedule.Unlessotherwiseinstructed,acceptthedefaultsettingsandclickOK.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 109

ToprotecttheArchiverincaseofadisaster,replicatethedatatoa
To
protect the Archiver in case of a disaster replicate the data to a secondArchiverata
second Archiver at a
remotesiteusingcollectionreplication.
Thebasictopologyandrequirementsforreplicationaredescribedhere.Consultwiththe
sitesadministratorandDataDomainsupporttoperformthespecific configuration
procedures.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 110

Here is the basic DD Archiver replication topology


topology. Boththesourceanddestinationin
Both the source and destination in
thereplicationpairmustbeconfiguredasDDArchivers, andthateachunitinthesourceDD
ArchiverisreplicatedtoitscorrespondingunitinthedestinationDDArchiver. Note thatonly
DataDomainsupportengineerscanperformsingleunitrecovery.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 111

The basic requirements for Data DomainArchiversystem


ThebasicrequirementsforData
Domain Archiver system areasfollows:
are as follows:
CollectionReplicationistheonlytypeofreplicationthatcanbeusedtoreplicateaDD
Archiver
Boththesourceanddestinationmustbeconfiguredas Archivers,withDDReplicator
licensesoneachsystem
Thenumberandsizeofthearchiveunitsatthereplicationdestinationmustbethesameor
greaterthanthesource.
Thefilesystemmustnotbeenabledonthedestinationuntilthe archiveunitshavebeen
addedtoit,andreplicationhasbeen Configured.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 112

This lesson provides a basic introduction to the installation and configuration of a Global
Deduplication Array system using the procedures shown.
ConsultwiththesitesadministratorandDataDomainsupportforthespecific configuration
details.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 113

installation and initial configuration of a controller in a Global Deduplication Array is


similar to that for a stand-alone Data Domain system. Followthe instructionsforInitial
Configurationforeachcontroller.
Afterthesetupiscomplete,performbasic GDAconfigurationusingtheConfigurationWizard
intheEnterprise Manager.
ConfigurationofadualcontrollerGDArequirestwopasses.Itisrecommendedtoconfigure
theworkercontrollerfirst.
h
k
ll f
Foreachcontroller,therequiredlicensesmustbepreconfiguredduring initialconfiguration,
oryoucanadd themduringthebasicGDAconfigurationphaseintheConfigurationWizard.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 114

Afterlaunching
After
launching theConfigurationWizardfromtheMoreTasksmenuintheMaintenance
the Configuration Wizard from the More Tasks menu in the Maintenance >
>
Systempageof theEnterpriseManager,inthefirstpageoftheGDAportionofthewizard,
selectDualControllerGDA,andthenselectWorkerController.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 115

ClickNexttoproceedtotheNetworkportionofthewizard.
Click
Next to proceed to the Network portion of the wizard Onthe
On the Interfaces
Interfaces page,thereis
page there is
aseparatesectionforsettingtheInterconnectforGDA. Defaultvalueswillbesupplied,but
theusermaychangetheInterconnectIPaddressand netmask.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 116

ForadualcontrollerGDA,oncetheworkercontrollerhasbeenconfigured,selectthesystem
For
a dualcontroller GDA once the worker controller has been configured select the system
intendedasthemastercontroller.
OnthefirstpageoftheGDAportionofthewizard,selectDualControllerGDA,andthen
selectMasterController.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 117

Clickingon
Clicking
on Next
Next proceedstotheGeneralpage,wheretheusermayassignanametothe
proceeds to the General page where the user may assign a name to the
GDA.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 118

ClickingNext
Clicking
Nextproceedstothepagetoaddaworkercontroller,iftheuserhasconfiguredany
proceeds to the page to add a worker controller if the user has configured any
workercontrollers.
Thepagetoaddaworkercontrollerdoesnotappearifnoworkercontrollerhasbeen
previouslyconfigured.Inthiscase,themastercontrollerwillbeconfiguredasasingle
controllerGDA.Aworkercontrollercanbeconfiguredandaddedtothesinglecontroller
GDAatalatertime,toconvertittoadualcontrollerGDA.
Alistofallpreconfiguredworkercontrollersappears,alongwiththemastercontrollerbeing
l
f ll
f
d
k
ll
l
h h
ll b
configured.TheusermustselectoneworkercontrollerfortheGDAcurrentlybeing
configured.Inthisexample,onlyoneworkercontrollerwasfound.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 119

ClickingNextproceedstotheSummarypage,wheretheusermayconfirmthedetailsbefore
Clicking
Next proceeds to the Summary page where the user may confirm the details before
submitting.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 120

ConfiguringasinglecontrollerGDAisverysimilartoconfiguringthemastercontrollerofa
Configuring
a singlecontroller GDA is very similar to configuring the master controller of a
dualcontrollerGDA.Ofcourse,itisnotnecessarytopreconfigure theworkercontroller.
InthefirstpageoftheGDAwizard,selectSingleControllerGDA.Inthiscase,thereisno
specialGDAconfigurationrequiredontheNetworkwizardInterfaces page. TheGeneralpage
allowstheusertoentertheGDAname. TheAddWorkerpagedoesnotappear,andthe
Summarycontainsonlyonecontroller.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 121

Incasethat
In
case that thesystemunderconfigurationisnotintendedtobepartofaGDA,selectSingle
the system under configuration is not intended to be part of a GDA select Single
System,andnoGDAconfigurationwilloccur.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 122

Thesteps
The
steps shownherecanbeusedtosetupDDBoostontheGDA.
shown here can be used to set up DD Boost on the GDA Takeamomenttoreview
Take a moment to review
beforeproceeding.
SeetheGDAAdministrationGuideformoreinformation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 123

Thesteps shownherecanbeusedtosetupVTLontheGDA. Takeamomenttoreviewbefore


proceeding.
SeetheGDAAdministrationGuideformoreinformation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 124

Thesteps
The
steps shownherecanbeusedtosetupDDBoostontheGDA.
shown here can be used to set up DD Boost on the GDA Takeamomenttoreview
Take a moment to review
beforeproceeding.
SeetheGDAAdministrationGuideformoreinformation.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 125

This module covered the topics shown


Thismodulecoveredthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 126

To learn about EMC Data Domain products and solutions


solutions, consult the following resources.
resources
For product information, including overviews, data and specification sheets, and white papers,
visit the link shown at EMCs website.
For product documentation, knowledge base articles, and additional white papers, visit
my.datadomain.com. This site requires a login.
To find and enroll in follow-on training covering a wide range of topics including system
installation and maintenance,
maintenance integration and implementation,
implementation administration and
troubleshooting, visit EMC Education Services, using the link shown. Search for Data Domain to
view a complete list of offerings.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 127

This course covered the topics shown


Thiscoursecoveredthetopicsshown.

Copyright 2012 EMC Corporation. Do not copy - All Rights Reserved.

EMC Data Domain System Installation 128