Вы находитесь на странице: 1из 226

Volumen LXXX

N 2

julio-diciembre 2012

Madrid (Espaa) | ISSN: 0013-6662

INSTITUTO DE LENGUAS Y CULTURAS DEL MEDITERRNEO Y ORIENTE PRXIMO

CONSEJO SUPERIOR DE INVESTIGACIONES CIENTFICAS

Volumen LXXX

N. 2

julio-diciembre 2012

GOBIERNO
DE ESPAA

Madrid (Espaa)

ISSN 0013-6662

MINISTERIO
DE ECONOMA
Y COMPETITIVIDAD

CONSEJO SUPERIOR DE INVESTIGACIONES CIENTFICAS

Volumen LXXX

N. 2

julio-diciembre 2012

Madrid (Espaa)

ISSN 0013-6662

EMERITA. Revista de Lingstica y Filologa Clsica


Revista publicada por el Instituto de Lenguas y Culturas del Mediterrneo y Oriente Prximo,
CCHS, CSIC
Fundada en 1933 por D. Ramn Menndez
Pidal, EMERITA publica dos nmeros por
ao, con cerca de 400 pginas de artculos
originales y reseas de Filologa Clsica,
de Lingstica griega, latina, indoeuropea
e ibrica, y de Historia antigua. EMERITA
es, desde su fundacin, una de las revistas
cientficas de alto nivel ms valoradas en
su campo.

Founded in 1933 by D. Ramn Menndez Pidal, EMERITA publishes two issues


per year, about 400 pages of articles and
reviews concerning Classical Philology,
Greek, Latin, Indoeuropean and Iberian
Linguistics and Ancient History. EMERITA
is, since its foundation, one of the best
known and valued high level scientific
journals in its field.

Edicin electrnica:
http://emerita.revistas.csic.es

Electronic edition:
http://emerita.revistas.csic.es

Director:
Francisco Rodrguez Adrados (Reales Academias de la Lengua y de la Historia).
Secretario:
Jos Antonio Berenguer (Centro de Ciencias Humanas y Sociales, CSIC).
Consejo de Redaccin:
Antonio Alvar Ezquerra (U. de Alcal)
Jos Antonio Berenguer Snchez (CSIC)
Jos Manuel Caas Rello (CSIC)
Matilde Conde Salazar (CSIC)
Luis Alberto de Cuenca y Prado (CSIC)
Emilio Fernndez-Galiano Ardanaz (CSIC)
Elvira Gangutia Elcegui (CSIC)
Benjamn Garca-Hernndez (U. Autnoma
de Madrid)
Jos Garca Lpez (U. de Murcia)
Ciriaca Morano Rodrguez (CSIC)
Domingo Plcido Surez (U. Complutense)
Francisco Rodrguez Adrados (RAE y de la
Historia)
Helena Rodrguez Somolinos (CSIC)
Juan Rodrguez Somolinos (CSIC)
Jos Luis Vidal (U. de Barcelona).

Consejo Asesor:
Pedro Bdenas (CSIC)
Francis Cairns (Florida State Univ.)
Gualtiero Calboli (U. de Bolonia)
Carl Joachim Classen (U. de Gotinga)
Monique Clavel-Levque (U. Franche-Comt,
Besanon)
Dulce Estefana (U. de Santiago)
M. Paz Garca-Bellido (CSIC)
Juan Gil (U. de Sevilla)
Ana Mara Gonzlez de Tobia (U. Nacional de
la Plata)
Jacques Jouanna (U. Pars-Sorbonne)
Javier Lpez Facal (VICYT - CSIC)
Jos M. Lucas de Dios (UNED)
Francisco Villar (U. de Salamanca)
Georgia Xanthakis-Caramanos (U. del
Peloponeso)
Ernst Vogt (Ludwig-Maximilians-U. de Munich)

Coordinacin y gestin editorial y tcnica:


Unidad de Apoyo a la Edicin de Revistas (Centro de Ciencias Humanas y Sociales, CSIC)

REDACCIN E INTERCAMBIO:
Revista Emerita
Unidad de Apoyo a la Edicin de Revistas
Centro de Ciencias Humanas y Sociales, CSIC
Albasanz, 26-28
28037 Madrid (Espaa)
Telfono: +34 916 022 316
Fax: +34 916 022 971
e-mail: emerita.cchs@cchs.csic.es
www.cchs.csic.es
DISTRIBUCIN, SUSCRIPCIN Y VENTA:
Editorial CSIC
Vitruvio, 8
28006 Madrid
Telfonos:
Informacin: +34 91 568 14 02
Libros: +34 91 562 96 33
Revistas: +34 91 561 28 33
Fax: +34 91 562 96 34 / 561 48 51
editorial.csic.es
E-mail: publ@csic.es

Librera Cientfica del CSIC


Duque de Medinaceli, 6
28014 Madrid
Tfno./Fax: +34 91 369 72 53
E-mail: libreria@ch.csic.es

SERVICIOS DE INFORMACIN:
EMERITA es recogida sistemticamente por las bases de datos Arts & Humanities Citation Index,
A&HCI (ISI, USA); SCOPUS (Elsevier B.V., NL); MLA Bibliography (Modern Languages Association, USA); Linguistics and Language Behavior Abstracts, LLBA (Sociological Abstracts Inc., USA);
Linguistic Bibliography, BL (Brill, NL); LAnnee Philologique, APH (SIBC, FRA); Francis (CNRSINIST, FRA); Periodical Index Online, PIO (Chadwick-Healey, ProQuest, UK); Gnomon (Catholic
University Eichsttt-Ingolstadt, GER); TocsIn (Tables of Contents of Interest to Classicists, University
of Toronto, CA) e ISOC (CSIC, SPA). Presente en Latindex (en Catlogo) y European Reference Index
for the Humanities, ERIH (ESF).
CSIC 2012
Las opiniones y hechos consignados en cada artculo son de exclusiva responsabilidad de sus autores.
El Consejo Superior de Investigaciones Cientficas
no se hace responsable, en ningn caso, de la credibilidad y autenticidad de los trabajos.
Los originales de la revista Emerita, publicados en
papel y en versin electrnica son propiedad del
Consejo Superior de Investigaciones Cientficas,
siendo necesario citar la procedencia en cualquier
reproduccin parcial o total.

The opinions and facts stated in each article are the


exclusive responsibility of the authors. The Consejo
Superior de Investigaciones Cientficas is not responsible in any case for the credibility and authenticity of the studies.
Original texts published in both the printed and online versions of the journal Emerita are the property
of the Consejo Superior de Investigaciones Cientficas, and this source must be cited for any partial or
full reproduction.

ISSN 0013-6662
eISSN 1988-8384
NIPO (en papel): 723-12-064-2
NIPO (en lnea): 723-12-063-7
Depsito legal: M. 552-1958
Impreso en Espaa - Printed in Spain
por Cromagraf PessCO, S.L.U.
En esta edicin se ha utilizado papel ecolgico sometido a un proceso de blanqueado TCF, cuya fibra
procede de bosques gestionados de forma sostenible.

Volumen LXXX

N. 2

julio-diciembre 2012

Madrid (Espaa)

ISSN 0013-6662

EMERITA
REVISTA

DE

LINGSTICA

FILOLOGA CLSICA

NDICE DEL SEGUNDO FASCCULO


Pgs.

Artculos
JULIN MNDEZ DOSUNA6REUHHOVLJQLILFDGRGHHQTLocri 15.15:
qu es la pez spera?
About the meaning of LQTLocri 15.15: what is rough pitch?....

245-256

MILAGROS QUIJADA SAGREDO: Intriga cmica versus intriga trgica en Tesmoforiantes de Aristfanes
Comic intrigue versus tragic intrigue in Aristophanes Thesmophoriazousae ..

257-274

JUAN LUIS LPEZ CRUCES: Crcidas y la Antope de Eurpides


Cercidas and Euripides Antiope ........................................................................

275-294

TOM VTEK: Heraclitus, DK 22 B 44 (frg. 103, Marcovich)


Herclito, DK 22 B 44 (frg. 103, Marcovich) ...................................................

295-320

VIRGINIA MUOZ LLAMOSAS: Y busqu su alma como a mi otro yo: comentarios a Himerio 10.86-90
And I searched for his soul as my alter ego: On Himerius 10.86-90...........

321-339

KRZYSZTOF RZEPKOWSKI: Isidore of Seville and comici ueteres. Ad Isid.,


Orig. VIII 7.7
Isidoro de Sevilla y los comici ueteres. Ad Isid., Orig. VIII 7.7 ......................

341-353

MARCOS CARMIGNANI: Ille quidem totam gemebundus obambulat Aetnen: el


Cclope ovidiano como inspiracin pardica en Petronio, Sat. 100.3-5
Ille quidem totam gemebundus obambulat Aetnen: Parodic allusions to Ovidian Cyclops in Petronius, Sat. 100.3-5.............................................................

355-370

JANA MIKULOV: Ablativo de gerundio anterior en la Crnica mozrabe


Anterior ablatives of the gerund in the Mozarabic Chronicle ...........................

371-385

VI

N D I C E D E L FA S C C U L O

Pgs.

NOTAS

E INFORMACIN

ANTONIO RO TORRES-MURCIANO: El canto de Quirn y el ethos de la msica. A propsito de Silio Itlico XI 453-458
The song of Chiron and the ethos of music. Note on Silius Italicus XI 453458 ......................................................................................................................

387-399

SARA MACAS OTERO: Dioniso y el vino en el Cclope de Eurpides


Dionysus and wine in Euripides Cyclops .........................................................

RESEAS
I.

401-410

DE LIBROS

Ediciones y tcnica filolgica

Simonides lyricus. Testimonia und Fragmente . Einleitung, kritische Ausgabe, bersetzung und Kommentar von Orlando Poltera (HELENA RODRGUEZ SOMOLINOS) .

411-414

PAGANO, V., LAndromeda di Euripide (Sara Macas) .............................................

414-416

        
 (PEDRO REDONDO REYES) ................... 416-418

II.

Lingstica

DENIZOT, CAMILLE, Donner des ordres en grec ancien: tude linguistique des formes de linjonction (M. DOLORES JIMNEZ LPEZ) .............................................

418-422

RUIZ DARASSE, COLINE Y LUJN, EUGENIO R. (eds.), Contacts linguistiques dans


lOccident Mditerranen antique (JOS A. CORREA) ........................................

423-425

III.

Literatura y filosofa

ROTSTEIN, ANDREA, The Idea of Iambos (FRANCISCO R. ADRADOS) ...........................

425-426

MANZANO VENTURA, M. VICTORIA, Los discursos de exhortacin militar en la


Farsalia de Lucano (ANTONIO RO TORRES-MURCIANO) ......................................

426-428

CASALI, SERGIO Y STOK, FABIO (eds.), Servio: stratificazioni esegetiche e modelli


culturali / Servius: Exegetical Stratifications and Cultural Models (JUAN A.
ESTVEZ SOLA) .....................................................................................................

428-431

DPP, SIEGMAR, Eva und die Schlange. Die Sndenfallschilderung des Epikers Avitus im Rahmen der bibelexegetischen Tradition (ROSARIO MORENO SOLDEVILA).
LANGSLOW, DAVID Y MAIRE, BRIGITTE (eds.), Body, Disease and Treatment in a
Changing World. Latin texts and contexts in ancient and medieval medicine
(MATILDE CONDE).................................................................................................
Emerita LXXX 2, 2012, pp. VII-VIII

433-435

ISSN 0013-6662

VII

N D I C E D E L FA S C C U L O

Pgs.

IV.

Historia, religin y sociedad

KNOEPFLER, DENIS, La Patrie de Narcisse (LUIS ALBERTO DE CUENCA) .....................

436-437

SOARES, LUCAS, Platn y la poltica (LUIS ANDRS BREDLOW) ..................................

437-439

BARCEL, PEDRO (ed.), Religiser Fundamentalismus in der rmischen Kaiserzeit


(MARA PAZ DE HOZ GARCA-BELLIDO) ................................................................

440-443

BARNES, TIMOTHY, Constantine: Dynasty, Religion and Power in the Later Roman
Empire (PABLO TORIBIO PREZ) ............................................................................

443-448

Relacin de libros recibidos durante el segundo semestre de 2012 ........................

449-450

ndice del tomo LXXX .............................................................................................

451-545

Normas de presentacin de originales......................................................................

456-456

Emerita LXXX 2, 2012, pp. VII-VIII

ISSN 0013-6662

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 245-256
ISSN 0013-6662 doi: 10.3989/emerita.2012.12.1215

Sobre el significado de en TLocri 15.15:


qu es la pez spera?*
Julin Mndez Dosuna
Universidad de Salamanca
mendo@usal.es

About the meaning of in TLocri 15.15: what is rough pitch?


/D IRUPD  HQ TLocri 15.15 ha dado pie a
varias interpretaciones: una referencia a un terreno
spero, la fraccin de un stater o un tipo de pez:
pez dura como trmino equivalente de lo que se
VXHOHOODPDUSH]VHFD  (VWHDUWtFXOR
SUHWHQGHGHPRVWUDUTXHHQUHDOLGDGGHEH
UHIHULUVH D OD SH] HQ EUXWR TXH QR KD VLGR D~Q
HODERUDGD\SURFHVDGD  

7KH IRUP  LQ TLocri  KDV EHHQ YDULously interpreted as denoting a rough terrain, a
fraction of a stater or a type of pitch: hard pitch
as an alternative term for what was commonly
FDOOHG GU\ SLWFK   7KLV SDSHU WULHV
WRGHPRQVWUDWHWKDWPXVWDFWXDOO\UHIHUWR
SLWFKLQWKHURXJKWKDWKDVQRW\HWEHHQSURFHVVHG
DQGUHILQHG  

Palabras clave FDPELR VHPiQWLFR /RFURV (SL]HILULRVSH]

Keywords VHPDQWLF FKDQJH (SL]HSK\ULDQ /RFUL


pitch.

(QODWDEODQGHODUFKLYRGHOWHPSORGH=HXVGH/RFURV(SL]HILULRV TLocriFDD& VHFRQVLJQDQORVSUpVWDPRVFRQFHGLGRVDODFLXGDGHQ


el arcontado de Queredamo de la fratra Ane O 1 y
GHVWLQDGRVDREUDVGHIRUWLILFDFLyQ O $XQFUpGLWRGH
WDOHQWRV\HVWDWHUHVVHDxDGHQRWUDVFDQWLGDGHVREWHQLGDVGHUHFXUVRV
GLYHUVRVHOGLQHURVXPDGRDORVGHSyVLWRV "  OO PiVODQRYHQDSDUWH
*
 (VWHWUDEDMRVHHQPDUFDHQHOSUR\HFWR)), &RQWDFWRVLQWHUGLDOHFWDOHVHQJULHJR
DQWLJXR (VWXGLR D SDUWLU GH ORV WH[WRV HSLJUiILFRV  GHO 0LQLVWHULR GH &LHQFLD H ,QQRYDFLyQ 0,&,11(VSDxD 7HQJRTXHDJUDGHFHUD$OFRUDF$ORQVR'pQL]ODFXLGDGRVDOHFWXUDGHXQDYHUVLyQ
SUHOLPLQDU\VXVYDOLRVDVREVHUYDFLRQHV\VXJHUHQFLDV7DPELpQGHERH[SUHVDUPLDJUDGHFLPLHQWRD
dos revisores annimos de EmeritaSRUVXV~WLOHVFRUUHFFLRQHV\FRPHQWDULRVFUtWLFRV
1
 1RVDEHPRVFRQH[DFWLWXGDTXpFODVHGHDJUXSDFLyQFtYLFDFRUUHVSRQGHQHVWDVDEUHYLDWXUDV
denominadas convencionalmente demticos. Para la sintaxis peculiar de estos demticos anteSXHVWRVYpDVH0pQGH]'RVXQDHQSUHQVD

246

-8/,10e1'(='2681$

  GHO SUHFLR GH ORV SURGXFWRV OtTXLGRV YLQR DFHLWH  OO   \
GHODYHQWDGLDULDGHFHUHDOHV OO 
/D~OWLPDSDUWLGD OO FRUUHVSRQGHDODSURGXFFLyQGHSH]TXHVH
YHQGLyDXQSUHFLRGHWDOHQWRVHO(VWRVVRQHOWH[WR\ODWUDGXFFLyQ
GH&RVWDELOHS2:
VW
W^VW`
inoltre, il prezzo di 40 anfore di pece a 3 st. ad anfora di solido per un
SURGRWWRGLW^VW`3.

(OHUDXQDHVSHFLHGHiQIRUDGHFXHUSRJOREXODUFRQXQDERFDPX\
ancha para facilitar la manipulacin del contenido. Su capacidad se calcula
HQWUH ORV  \ ORV  OLWURV SDUD ORV GDWRV DUTXHROyJLFRV FI $ORQL 
6DQJLQHWR HQ /XSSLQR \ 6DQJLQHWR  SS  \ &DYDVVD  
&RPRGRFXPHQWDSURIXVDPHQWH&RVWDELOHSSFRQSDVDMHVGH
fuentes antiguas griegas y latinas complementadas con datos epigrficos y
arqueolgicos, la exportacin de la pez extrada de las conferas que crecan
HQORVERVTXHVGHO$VSURPRQWH SLQRODULFLRDEHWREODQFR GHVHPSHxDEDXQ
papel fundamental en la economa del Bruttium.
(Q HO SDVDMH FLWDGR HO VHQWLGR GH  TXH PRUIROyJLFDPHQWH QR
SXHGH VHU PiV TXH HO JHQLWLYR GH VLQJXODU PDVFXOLQR R QHXWUR GHO DGMHWLYR
HVFRQWURYHUWLGR&RVWDELOHUHFKD]DFRQUD]yQLQWHUSUHWDFLRQHVSUHFHGHQWHV$VtQRVHMXVWLILFDODUHIHUHQFLDDXQWHUUHQRiVSHUR\SHGUHJRVRTXH

 (QODVWDEODVGH/RFURVODVFDQWLGDGHVGHGLQHUR\GHORVSURGXFWRVTXHVHUHJLVWUDQVH
H[SUHVDQ PHGLDQWH XQ VLVWHPD QXPHUDO IXQGDPHQWDOPHQWH DFURIyQLFR _       
HWF  \ ODV DEUHYLDWXUDV WDPELpQ DFURIyQLFDV GH ODV GLYHUVDV XQLGDGHV PRQHWDULDV R GH
FDSDFLGDG SRU HMHPSOR 7   WDOHQWR    HVWDWHU /RV GRV WLSRV GH DEUHYLDWXUDV SXHGHQ
FRPELQDUVHSDUDIRUPDUDQDJUDPDV = 10 talentos, etc. Por razones tcnicas, en la inmensa
PD\RUtD GH ODV FLWDV ORV QXPHUDOHV DSDUHFHUiQ DTXt WUDQVOLWHUDGRV FRQ FLIUDV DUiELJDV \ OD
LQLFLDOGHODXQLGDGPRQHWDULDRGHFDSDFLGDGHQFDUDFWHUHVODWLQRV 7 W VW 
 VW HWF  VLJXLHQGR OD FRQYHQFLyQ TXH VH DSOLFD HQ HO FRUSXV GH LQVFULSFLRQHV JULHJDV GHO
Packard Humanities Institute <http://epigraphy.packhum.org/inscriptions/>.
3
 &RPR\DREVHUYy'H)UDQFLVFLVHQODeditio princepsGHORVkdoi de pez multiplicados por los 3 estateres de cada kdos DUURMDQ XQ WRWDO GH  HVWDWHUHV TXH HTXLYDOHQ
DWDOHQWRV/RVHVWDWHUHVGHODOtQHDVREUDQ\VHGHEHQDXQDGLVWUDFFLyQGHOJUDEDGRU
que ha repetido el final de la lnea anterior.
2

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

62%5( (/ 6,*1,),&$'2 '( EN TLOCRI 15.15



SRVWXODED'H)UDQFLVFLVS\S7DPSRFRSXHGHWUDWDUVH
de la fraccin de un staterFRPRFUHtDQ%ORPTYLVWSS\9DWLQ
 S  TXLHQ \HQGR D~Q PiV OHMRV SURSRQtD FRUUHJLU OD OHFWXUD GHO
EURQFH HQ  (VWD FRQMHWXUD HV LQYHURVtPLO WDQWR GHVGH HO SXQWR GH
vista de la paleografa como del de la sintaxis.
&RVWDELOHSOOHJDDODFRQFOXVLyQGHTXHGHQRWDXQD
cualidad de la pez con el sentido de slido. Formalmente, se tratara de un
JHQLWLYRQHXWURVXVWDQWLYDGRRPiVSUREDEOHPHQWHGHXQJHQLWLYRPDVFXOLQR
UHIHULGRDXQVXVWDQWLYRSURGXFWRTXHSHUPDQHFHHOtSWLFR4. SintctiFDPHQWHGHSHQGHUtDGHWDOFRPRUHIOHMDHQVXWUDGXFFLyQ
a 3 st. ad anfora di solido.
&RVWDELOH FUHH TXH OD   HV H[DFWDPHQWH HO PLVPR SURGXFWR
TXHODVIXHQWHVJULHJDVGHQRPLQDQVHFDRGXUD\ODV
latinas, pix spissa HVSHVD duraSRUFRQWUDSRVLFLyQDODK~PHda, fluida y la pix liquida.
'XERLVSDFHSWDVLQUHVHUYDVHVWDH[SOLFDFLyQ\UHVDOWDHOLQWHUpV
GHXQSDVDMHGH7HRIUDVWRHP,,,TXHWDPELpQFLWD&RVWDELOHHQHOTXH
VXSXHVWDPHQWHODSH]VyOLGDUHFLELUtDHOFDOLILFDWLYRGH(QDSR\R
GHODDFHSFLyQGHGXURSDUD'XERLVUHPLWHD'H/DPEHUWHULH
pp. 405-406.
&RPRYDPRVDYHUHQVHJXLGDHVWDVROXFLyQGH&RVWDELOHQRHVVDWLVIDFWRULDSRUGLYHUVDVUD]RQHVSHURDQWHVGHVHJXLUDGHODQWHSXHGHQUHVXOWDU~WLOHV
algunas aclaraciones en materia de terminologa5(OWpUPLQR iW 
HUDSROLVpPLFR3XHGHUHIHULUVHDODUHVLQDREWHQLGDGHODVFRQtIHUDVSRUUHVLQDFLyQ SH]FUXGDR RSRUFDOHQWDPLHQWRGHDVWLOODVGH
PDGHUD GH FRQtIHUDV SH] HQ EUXWR  &RQ HO WLHPSR HVWD UHVLQD QDWXUDO VH
GLVJUHJD HQ XQD FDSD VHPLIOXLGD   UHVLQD OtTXLGD  TXH HV OD
FRORIRQLD\RWUDVyOLGDGHDVSHFWRFULVWDOLQR UHVLQDVHFD 
 (V HYLGHQWH TXH HO JpQHUR JUDPDWLFDO IHPHQLQR GH  KDUtD HVSHUDEOH XQ JHQLWLYR
(OPDVFXOLQRRQHXWURVRORVHMXVWLILFDVLVXSRQHPRVTXHFDOLILFDDXQVXVWDQWLYRHOtSWLFRuel simileFRPRTXLHUH&RVWDELOHRTXHKD\XQDFRQFRUGDQFLDLUUDFLRQDO
FRQ $XQTXH HO SDUDOHOR QR HV H[DFWR SRUTXH QR LQWHUYLHQH OD GLVFRUGDQFLD GH JpQHUR
VH DWHVWLJXD XQD HOLSVLV FRPSDUDEOH HQ HO VLQWDJPD K   UHQWD GH ODV >WLHUUDV@
sagradas (TLocri HQHOTXHGHEHVREUHQWHQGHUVHXQJHQLWLYRGHSOXUDO
5
 3DUD WRGR OR UHODWLYR D OD HODERUDFLyQ GH OD SH] \ ORV RWURV GHULYDGRV GH OD UHVLQD GH
FRQtIHUDV HQ OD$QWLJHGDG \ SDUD OD WHUPLQRORJtD WpFQLFD UHIHULGD D HVWRV SURGXFWRV PH KH
EDVDGRHQ$QGUp:DUWNH\&DYDVVD
4

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

248

-8/,10e1'(='2681$

(QHOXVRPiVFRP~QVHUHILHUHDORVGHULYDGRVGHODUHVLQD&Dlentando moderadamente la materia prima para extraer por destilacin la


WUHPHQWLQD DFHLWHGHSH]IORUGHSH]
VXHUR GH SH]  \ RWURV DFHLWHV YROiWLOHV VH REWHQtD OD   QXHVWUR
alquitrn vegetal. La pix BruttiaHUDDOTXLWUiQHVSHVDGRFRQYLQDJUHVHJ~QXQ
SURFHVR TXH GHVFULEH 3OLQLR NH ;9,  3UHFLVDPHQWH SRU VX XQWXRVLGDG
HVWHSURGXFWRHUDPX\DSUHFLDGRSDUDHOFDODIDWHDGRGHEDUFRV\SDUDLPSHUPHDELOL]DUHOLQWHULRUGHORVUHFLSLHQWHVGHPDGHUDRGHFHUiPLFD/D
 VH SRGtD FRFHU HQ UHFLSLHQWHV GH FREUH KDVWD WUDQVIRUPDUOD HQ 
RSH]UH FRFLGD TXHFRUUHVSRQGHDQXHVWUDEUHD$ORTXH
SDUHFHFRQWUDORTXHVXSRQH&RVWDELOHODpix Bruttia era una variante de la
SH]IOXLGD \QRGHODVHFD 
El hecho de que en Locros Epizefirios la pez se venda por kdoi, una meGLGDGHFDSDFLGDG\QRSRUWDOHQWRVXQDPHGLGDGHSHVRLQGLFDTXHOD
HUDXQIOXLGRSRUPiVYLVFRVRTXHIXHUD YpDVHQ $SDUWLUGHOH[DPHQGH
los kdoi llenos de pez destinada a la exportacin que han aparecido intactos
en distintos pecios de la costa del sur de Italia, Cavassa 2008, pp. 103-106,
deduce que el producto se verta en los contenedores en estado fluido y luego,
DOHQIULDUVHWRPDEDXQDFRQVLVWHQFLDPiVHVSHVDTXHKDFtDPiVIiFLOHOWUDQVporte. Por lo tanto, parece difcil que la pez de TLocri 15 fuera una pez dura
FRQXQDVXSHUILFLHUXJRVDTXHSXGLHUDMXVWLILFDUHOXVRGHODGMHWLYR
Por lo que se refiere a la presunta acepcin de duro, slido que CostaELOH\'XERLVDWULEX\HQDORVDUJXPHQWRVTXHDGXFHQHVWRVDXWRUHV
son poco consistentes. Para empezar, en Thphr., HP,,,SDVDMHDOTXH
WDQWDLPSRUWDQFLDFRQFHGHQ&RVWDELOH\ HVSHFLDOPHQWH'XERLVQR DSDUHFHQ
QL HO FRPSDUDWLYR  QL QLQJXQD RWUD IRUPD GH  3RU FRQVLJXLHQWHHODGMHWLYRQRVHSUHGLFDQLGHODPDGHUDGHOSLQRVDOJDUHxR 
Pinus nigra FRPRDILUPD&RVWDELOHQLWDPSRFRGHODSH]GXUD  FRPRFUHH'XERLV6. En HP,,,SDVDMHGHOTXHPHRFXSDUpPiVDEDMR
6
 /D IRUPD  DSDUHFH XQ SRFR PiV DGHODQWH HP ,,,   SHUR DSOLFDGD D
OD FRUWH]D GHO DUFH  UHVTXHEUDMDGD HQ ORV HMHPSODUHV DGXOWRV (Q HP III 9.4,
7HRIUDVWR FRPSDUD HO SLQR SLxRQHUR  Pinus pinea  FRQ HO SLQR VDOJDUHxR FX\D PDGHUD HV PiV GHQVD \ OLVD \ HO WURQFR PiV DOWR     
En HP ,,,  GHVFULEHODVFDUDFWHUtVWLFDVGHODEHWRKHPEUD  GHPDGHUDPiV
EODQFDPiVEODQGD\PiVIiFLOGHWUDEDMDU  
\GHODEHWRPDFKR  FX\DPDGHUDGHXQWRQRPiVGHVLJXDOHVPiVGHQVD\PiV
GXUD  

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

62%5( (/ 6,*1,),&$'2 '( EN TLOCRI 15.15

249

7HRIUDVWRQRKDEODGHODSH]SURSLDPHQWHGLFKDVLQRGHODPDWHULDSULPDVLQ
HODERUDUHVGHFLUGHODUHVLQD
&RPRHUDGHHVSHUDUHQHVWRV\RWURVSDVDMHVGHODHistoria plantarum,
7HRIUDVWRXVDORVDGMHWLYRVGXUR\EODQGRSDUDSUHFLVDU
el grado de dureza-tenacidad (resistencia de un material a la presin antes de
URPSHUVHRGHIRUPDUVH PLHQWUDVTXHUXJRVRiVSHUR\VXDQWyQLPR
OLVRVXDYHGHQRWDQODUXJRVLGDGDVSHUH]D DFDEDGRGHXQDVXSHUILFLH
\VHQVDFLyQTXHSURGXFHDOWDFWR ELHQGHODPDGHUDELHQGHODFRUWH]DGH
DOJXQDVHVSHFLHVDUEyUHDV FIHOFRPSXHVWRGHFRUWH]DUXJRVD
HP, 3RUVLHVWRQREDVWDUDHQHP I 4.1 el propio Teofrasto distingue
FRQQLWLGH]ODVGRVSURSLHGDGHVGXUH]DEODQGXUD\
DVSHUH]DOLVXUD
(OFRQWUDVWHGHVLJQLILFDGRHQWUH\VHDSUHFLDELHQSHM
en la descripcin de dos especies de fresno (HP,,, 
            
         

8QD>HVSHFLHVFHOIUHVQRFRP~QFraxinus excelsior@HVDOWDGHEXHQSRUWH
FRQODPDGHUDEODQFDGHILEUDILQDPiVEODQGDFRQPHQRVQXGRV\GHWH[WXUD
PiV FRPSDFWD /D RWUD >HVSHFLH VF HO IUHVQR IORULGR Fraxinus ornus@ HV GH
PHQRUDOWXUDPHQRVYLJRURVD>GHPDGHUD@PiVEDVWDPiVGXUD\PiVDPDULOOD

7DPELpQ-HQRIRQWHMem. XXX 10, en un contexto muy distinto, distingue


FRPRFRQFHSWRVGLYHUVRVORGXUR\OREODQGRSRU
XQODGR\ORiVSHUR\OROLVRSRURWUR
3HVH D OR TXH GD D HQWHQGHU 'XERLV WDPELpQ 'H /DPEHUWHULH 
SS  VRVWLHQH TXH HQ VHQWLGR SURSLR  GHQRWD XQD FXDOLGDG
fsica relacionada con el tacto (fr. rugueux, aux artes vives, rocheux, pre,
rude (V~QLFDPHQWHHQORVXVRVILJXUDGRVTXHGH/DPEHUWHULHOODPDacceptions morales GRQGH VH GLIXPLQDQ ODV IURQWHUDV FRQ  GH PRGR TXH
SXHGHRSRQHUVHDFIXQMXH]LPSODFDEOH
$A (VWDQHXWUDOL]DFLyQHVSRVLEOHSRUTXHODGXUH]D\ODDVSHUH]D
VRQ VHQVDFLRQHV WiFWLOHV GHVDJUDGDEOHV 3RU OD PLVPD UD]yQ HQ ODV OHQJXDV
PRGHUQDVORVHTXLYDOHQWHVGH\SXHGHQUHVXOWDUPiVRPHQRV
LQWHUFDPELDEOHV HQ OD HVIHUD GHO OHQJXDMH ILJXUDGR XQ debate spero y un
trato spero vienen a ser lo mismo que un debate duro y un trato duro.
Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

250

-8/,10e1'(='2681$

(QFDPELRHVWDFXDVLVLQRQLPLDQRVHGDFXDQGRORVDGMHWLYRVVHHPSOHDQ
en sentido propio. La dureza-tenacidad es una propiedad de la estructura interna de la materia y la rugosidad se refiere a la textura natural o el pulimenWRGHXQDVXSHUILFLH6HWUDWDSRUWDQWRGHSURSLHGDGHVLQGHSHQGLHQWHVSHM
XQDSLHGUDSXOLGDRXQPHWDOEUXxLGRVRQPDWHULDOHVGXURVSHUROLVRV\VXDYHV DO WDFWR SRU HO FRQWUDULR XQ HVWURSDMR HV EODQGR \ FRPSULPLEOH SHUR
spero al tacto(QGHILQLWLYDODH[SOLFDFLyQGH&RVWDELOH\'XERLVVREUHOD
  LPSOLFD XQ FDPELR VHPiQWLFR iVSHUR ! GXUR TXH UHVXOWD
poco verosmil.
$PLPRGRGHYHUHODGMHWLYRHQTLocri 15.15 no se refiere a la
pez densificada mediante el proceso de coccin, sino al producto en su estado natural (pez bruta  /D   VHUtD SRU WDQWR VLQyQLPD GH OD
$XQTXHQRFRQR]FRSDUDOHORVHQJULHJR8, este tipo de polisemia
HVFRUULHQWHHQODVOHQJXDVDFWXDOHVFILQJOa rough surface, a diamond in
the rough, a rough draftFIWDPELpQHVSdiamante (en) bruto (sin pulir, ni
FRUWDU HQ IDFHWDV  miel en bruto PLHO FRQ HO SDQDO  harina en bruto (sin
FHUQHU  aceite en bruto, petrleo (en) bruto VLQ UHILQDU  piedra en basto,
lana en basto, harina en bastoIUdiamant brut, ptrole brut. El deslizamiento semntico surge en el contexto del pulimento de las piedras: una piedra sin
GHVEDVWDUVXHOHSUHVHQWDUVXSHUILFLHVGHVLJXDOHV\iVSHUDV FI
Hom., Il9 IUHQWHDODVVXSHUILFLHVOLVDV \VXDYHVGHXQDSLHGUD
WDOODGD \ SXOLGD 'H DTXt VH H[WLHQGH D RWURV SURGXFWRV QR HODERUDGRV TXH
evidentemente, no producen sensacin de aspereza.

 6H SRGUtD DUJLU TXH S HM LQJO soft puede equivaler tanto a squashy, spongy (soft
groundWHUUHQREODQGR FRPRDsmooth (soft velvetWHUFLRSHORVXDYH IUHQWHDVXVDQWyQLmos hard y roughTXHVHPDQWLHQHQQHWDPHQWHGLVWLQWRV3HURGHKHFKRQRKDKDELGRXQD
HYROXFLyQ GH EODQGR D VXDYH R YLFHYHUVD VLQR TXH HVWDV GRV DFHSFLRQHV \ RWUDV OLJDGDV
a una amplia gama de sensaciones placenteras derivan de ingl. ant. VIWDJUDGDEOHSOiFLGR
(cf. al. mod. sanft 
8
En PCair.Zen. V,,,D& VHPHQFLRQDQSHURHOFRQWH[WRLQGLFD
TXHVRQHVSRQMDViVSHUDVDOWDFWRIUHQWHDRWUDVPiVEODQGDV \SRUWDQWRPiV
suaves. En PCair.Zen. D& VHKDEODGHXQDSDUWLGDGHODQDPXJULHQWD\EDVWD
 3RGUtDSHQVDUVHTXHHVPDWHULDSULPDTXHD~QQRVHKDODYDGR\
FDUGDGR6LQHPEDUJRGHOFRQWH[WRVHLQILHUHTXHVHWUDWDGHODQDVXFLDGHPDODFDOLGDG'H
igual forma en el Edictum Diocletiani de pretiis D& GHOTXHVHFRQVHUYDQHMHPSODUHV
HQ YHUVLyQ ODWLQD \ JULHJD UHSDUWLGRV SRU HO WHUULWRULR GHO ,PSHULR 5RPDQR /DXIIHU  
H[SUHVLRQHVFRPRRGHOD
versin griega, corresponden a ex lanis grossioribus, ex lino grosso, etc., de la versin latina.

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

62%5( (/ 6,*1,),&$'2 '( EN TLOCRI 15.15

251

(QJULHJRDQWLJXRORVWpUPLQRVXVXDOHVSDUDUHIHULUVHDODSH]EUXWD\DOD
SH]HODERUDGDVHWRPDURQGHOFDPSRGHODFRFFLyQ\UHIOHMDQHOSURFHVRUHDO
GH HODERUDFLyQ GHO SURGXFWR &RPR YLPRV PiV DUULED OD PDWHULD SULPD VH
GHQRPLQDSH]FUXGD  HQGLVWLQWDVREUDVHQVXPD\RUtDWRGR
KD\TXHGHFLUORGHIHFKDEDVWDQWHWDUGtD9/DSH]HODERUDGDHVSH]FRFLGD
 10. Los equivalentes en latn son pix cruda &HOV,,,9
&RO;,, \pix cocta &RO9,, /DPLVPDGLVWLQFLyQVHGDHQODV
lenguas europeas actuales (cf. esp. pez cruda y pez cocida, fr. poix crue y
poix cuite, ingl. raw pitch y boiled pitch \VHJHQHUDOL]DDSURGXFWRVHQFX\D
HODERUDFLyQ QR LQWHUYLHQH OD FRFFLyQ SURSLDPHQWH GLFKD HVS seda cruda,
cuero crudo, petrleo crudoIUsoie ()crue, cuir ()cruLQJOraw silk, raw
leather, crude oil.
/RV DGMHWLYRV  \  VH DSOLFDQ HQ JULHJR D GLVWLQWDV PDWHULDV
HODERUDGDV$VtMXQWRDRURUHILQDGRHQXQSDVDMHGH
Simnides (fr. 64 PMG TXHFLWD3OXWDUFR MorE UHPLWHDOSURFHVR
de copelacin del oro11/RVGRVDGMHWLYRVYHUEDOHVVHDSOLFDQDODPLHOFDOHQtada12(QXQDLQVFULSFLyQGH$FUHILDSEG;9 FDD&" VH
PHQFLRQDHODFHLWHDURPDWL]DGRTXHVHXVDEDSDUDOXEULFDUODSLHOHQHOJLPQDVLR ORFDO        
/RXLV 5REHUW  S  VHxDOD TXH OD FRFFLyQ QR LQWHUYHQtDHQ QLQJXQD
IDVHGHODH[WUDFFLyQ\ODHODERUDFLyQGHODFHLWH\HQFRQVHFXHQFLDDYHQWXUD
ODKLSyWHVLVGHTXHHOSURGXFWRVHFDOHQWDEDSDUDIDYRUHFHUODPH]FODFRQOD
SURIXVLyQ GH SHUIXPHV FRQ TXH HVWDED DURPDWL]DGR (O   GH
9
Cf. Hp., Mul7KSKUHP,,,3OE9'VF(XS,*DO;,,S
O  S  O  .KQ 2ULE Syn ,,,  9,,  3DXO$HJ ,,,  Hipp.Berol.
;;9,,,Gp. 6.5.5.
10
 &I$HVFKULR IU  Hell *DO ;,, S  O  .KQ Hipp.Paris ;;9,,,  Gp.
9,
11
 &I WDPELpQ   >@ RUR SXULILFDGR WUHV YHFHV ,E\F IU D
PMG     XQD HVWDWXD GH RUR SXUR +GW ,   
XQSHVRGHWDOHQWRVGHRURSXUR 7K,, HWF
12
 3 HM            
           
 PLHOFRFLGDGHIRUPDPRGHUDGDSXHVODFUXGDSURGXFHIODWXOHQFLD\UHVXOWD
acre, la cocida en exceso es astringente, pero la cocida con moderacin depura suavemente
HOHVWyPDJR\HOYLHQWUH 6RU,, 
$QGUyPDFRQRHVFULELyFyPRGHEHPH]FODUVHOD
PLHOVLFUXGDRVRORHVSXPDGD *DO;,,SO.KQ 

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

252

-8/,10e1'(='2681$

$FUHILD SXHGH VHU HO   TXH PH]FODGR FRQ XQ SRFR GH FHUD
fundida para conferirle mayor densidad, Sorano II 52.1 recomienda para casos de erupcin cutnea y comezn.
3DUDODGLVWLQFLyQHQWUH\VRQHVSHFLDOPHQWHVLJQLILFDWLYRVDOJXQRVSDVDMHV(QHP III 9.2, Teofrasto se ocupa de la pez que
VHH[WUDHGHODUHVLQDGHOSLQRGHO,GD XQDVXEHVSHFLHGHOSLQRVDOJDUHxR 



/DYDULHGDGGHO,GDHVXQiUEROPiVGHUHFKR\PiVJUXHVR\DGHPiVHOiUERO
HQFRQMXQWRHVPiVULFRHQSH]FRQXQDSH]PiVQHJUDPiVGXOFHPiVILQD
y ms aromtica cuando est cruda. Una vez cocida, resulta peor por contener
mucha materia lquida.

(Q3OE9VHYHTXHODSH]FUXGDHVHOWpUPLQRPDUFDGRGHODRSRVLFLyQIUHQWHDODFRFLGDODSH]SRUDQWRQRPDVLDTXHQRSUHFLVDGHQLQJ~Q
calificativo:
         

$QWtJRQR FRQFHGLy >D ORV URGLRV@ PLO WDOHQWRV GH SH] PLO PHGLGDV GH RWUD
>SH]@FUXGD13.

En el tratado de agronoma y agricultura compilado en Constantinopla en


el s. X d. C. y conocido como Geopnica, se contraponen los trminos que
aqu se han analizado:

'HLJXDOIRUPDHVPHMRUODSH]FRFLGDTXHODFUXGD\ODVHFDTXHODOtTXLGD
(Gp. 9, 

13
 1yWHVHTXH3ROLELRHPSOHDXQDXQLGDGGHSHVRHOWDOHQWR FDNJ SDUDODSH]HODERUDGD PiV HVSHVD SHUR XQD XQLGDG GH FDSDFLGDG SDUD OtTXLGRV HO  PHGLGRU FD
OLWURV SDUDODSH]FUXGDPiVIOXLGD

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

62%5( (/ 6,*1,),&$'2 '( EN TLOCRI 15.15

253

9ROYLHQGRDTLocriHVSUHFLVRVHxDODURWURSXQWRGpELOHQODLQWHUSUHWDFLyQGH&RVWDELOHTXHDIHFWDDODVLQWD[LV$PLHQWHQGHUHVLPSUREDEOHTXH
HOJHQLWLYRGHSHQGDGH/DVHFXHQFLD
SUHVHQWDUtD XQ RUGHQ GH SDODEUDV VRUSUHQGHQWH FRQ HO SUHFLR LQWHUFDODGR GH
forma poco natural entre los dos componentes del supuesto sintagma.
3RU WRGR HOOR SDUHFH PiV OyJLFR TXH  GHSHQGD GHO FXDQWLILFDGRU
TXHOHVLJXHWRWDOGH>SURGXFWR@EUXWR(VWDFRQVWUXFFLyQHQFXHQWUDXQ
SDUDOHOR HQ OD H[SUHVLyQ   >@ WRWDO GH OD FHEDGD GH TLocri
HQXQSDVDMHTXHSUHVHQWDLPSRUWDQWHVSpUGLGDVGHWH[WR

>@
>@
WVWO>@
VW>@
 \ GHO FHUHDO >\@ HO WULJR  PHGLPQRV \ WUHV FXDUWRV YDORUDGR HO PHGLPQRD>total@ del trigoWDOHQWRVHVWDWHUHV\OLEUDV\PHGLDGH
FHEDGD PHGLPQRV YDORUDGR HO PHGLPQR D  HVWDWHU WRWDO GH OD FHEDGD
(TLocri

&IWDPELpQFRQHOVLQyQLPR JHQLWLYR14:
 
   
!!PHG
VWOLW >WDO@WDOVWDOLW
&RPRUHQWDGHODV>WLHUUDV@DxDGLGDVHQHOSHUtPHWUR " PHGLPQRVGH
FHEDGD9DORUGHOPHGLPQRHVWDWHU\XQDOLEUDMonto del valor 390 talentos,
HVWDWHUHV\OLEUDV TLocri

(OJLURVHUHSLWHHQGLVWLQWDVWDEODVGHODUFKLYR 
monto de la deuda (TLocri     PRQWR GHO WRWDO
(TLocri  PRQWRGHOR>GHSRVLWDGR@HQ
el registro de los fatarcos (TLocri  
14
 SDUHFH XQ WpUPLQR XWLOL]DGR HQ HO iPELWR GyULFR 0HVHQLD 'HOIRV *HOD
DGHPiVGH/RFURV(SL]HILULRV TXHHTXLYDOHDMyQ +GW,,, FI
recapitular, resumir.

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

254

-8/,10e1'(='2681$

PRQWRGHORTXHODFLXGDGGHEHDOGLRVHQHO
DUFRQWDGR GH 'LRJQHWR >GH OD IUDWUtD@ Pur. (TLocri   
    PRQWR GH OR TXH FRQWLHQH HO EURQFH TLocri  
>@PRQWR
GH OR TXH OD FLXGDG GHEH DO GLRV HQ HO DUFRQWDGR GH )LORQGDV >GH OD IUDWUtD@
Lak. (TLocri   >@       >
@ PRQWR GH OR TXH OD FLXGDG WRPy SUHVWDGR HQ HO DUFRQWDGR GH
+HUDFOHWR>GHODIUDWUtD@Thra. (TLocri 
Para terminar, no est de ms discutir sumariamente la sintaxis de la oraFLyQ QRPLQDO SDUHQWpWLFD    HQ OD TXH FRQ WRGD SUREDELOLGDG OD
DEUHYLDWXUD VH OHtD   HQ QRPLQDWLYR (Q FXDQWR D OD IXQFLyQ
VLQWiFWLFDGHOJHQLWLYRFDEHVXSRQHUTXHGHWHUPLQDDXQVXVWDQWLYR
HOtSWLFRIiFLOPHQWHGHGXFLEOHGHOFRQWH[WR>SUHFLR@GHOkdos: 3 estateres.
/DIyUPXODJHQLWLYRVHDWHVWLJXDHQGRVWDEODV15:
KVWDWDO!
11 tal., 1 sta.,
KVWDOLW
XQF!XQF
WDOOLWXQF
'H  PHGLPQRV GH WULJR SUHFLR GHO PHGLPQR  HVWDWHUHV >SUHFLR@
GHOWRWDOWDOHQWRV\HVWDWHUGHPHGLPQRVGHFHEDGDSUHFLRGHO
PHGLPQRHVWDWHUOLEUDVRQ]DV>SUHFLR@GHOWRWDOWDOHQWRV
OLEUDVRQ]DV TLocri 
          !
PHG!VWD
WDOOLWvacat
WHP PiV GHO FHUHDO TXH KD FRQVXPLGR OD FLXGDG  PHGLPQRV GH
HVHSUHFLRGHOPHGLPQRHVWDWHUHVWRWDOWDOHQWRV\OLEUDV TLocri
 

15
 /RVJLURVHOtSWLFRVDEXQGDQHQODV7DEODVGH/RFURV$GLIHUHQFLDGHTLocri 15, estas
GRV WDEODV HPSOHDQ VLJQRV GH LQWHUSXQFLyQ SDUD OD IXQFLyQ GH HVWRV VLJQRV HQ ODV7DEODV GH
/RFURV\HQRWURVWH[WRVGHOD0DJQD*UHFLDYpDVH0pQGH]'RVXQDHQSUHQVD.

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

62%5( (/ 6,*1,),&$'2 '( EN TLOCRI 15.15

255

(QOXJDUGHODIyUPXODSDUHQWpWLFDRWUDWDEODHPSOHDXQD
FRQVWUXFFLyQGHJHQLWLYRDEVROXWR>
 
>@
>@
WDOVWDOLW>@
VWD>@
<GHOFHUHDOGHPHGLPQRVGHWULJRYDORUDGRHOPHGLPQRD>@WRWDO
GHO WULJR  WDOHQWRV  HVWDWHUHV  OLEUDV GH >@ PHGLPQRV GH FHEDGD
YDORUDGRHOPHGLPQRDHVWDWHUWRWDOGHODFHEDGD>@ TLocri 

1R HV HVWD VLQ HPEDUJR OD ~QLFD H[SOLFDFLyQ SRVLEOH SDUD OD RUDFLyQ
HQTLocri 15. Si se prefiere no recurrir a la elipsis, se puede
SHQVDUTXHHOJHQLWLYRH[SUHVDHOREMHWRSRUHOTXHVHSDJDXQGLQHURHQXQD
WUDQVDFFLyQ SRU HO kdosHVWDWHUHV /DFRQVWUXFFLyQVHUtDHTXLSDUDEOH
DFDVRVFRPR7UHVPLQDVSRUXQ
FDUULWR \ XQ SDU GH UXHGDV D$PLQLDV $U Nu       
  <D QR GDUtD XQ WULyEROR SRU ORV GLRVHV $U Pax  
(QWRGRFDVRDQDGLHOHFREUDV
dinero por estar contigo (Xen., Mem. , FI&RRSHUS
$PRGRGHUHFDSLWXODFLyQGHWRGRORH[SXHVWRUHSLWRDTXtHOSDVDMHTXH
hemos analizado con una traduccin que intenta reproducir la sintaxis rudimentaria del original:
VW
W^VW`
tem ms, el valor de la pez, de 40 kdoi>SUHFLR@GHOkdos: 3 estateres (o
por kdosHVWDWHUHV 
>YDORU@WRWDOGH>SURGXFWR@EUXWRWDOHQWRV^HVWDWHUHV`

BIBLIOGRAFA
$ORQL02VVHUYD]LRQLVXJUAcme 36, pp. 43-49.
$QGUp-/DUpVLQHHWODSRL[GDQVO$QWLTXLWp7HFKQLTXHHWWHUPLQRORJLH
ACSS
%ORPTYLVW-7KHGLDOHFWRI(SL]HSK\ULDQ/RFUL OATHSS
Cavassa, L. 2008: Les kadoi poix du Bruttium, MAFRASS
Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

256

-8/,10e1'(='2681$

&RRSHU,,,*/Attic Greek Syntax E\*/&RRSHU,,,DIWHU.:.UJHU 


YRO,$QQ$UERU
&RVWDELOH) HG Polis ed Olympieion a Locri Epizefiri. Costituzione, economia e finanze di una citt della Magna Grecia. Editio altera e traduzione delle
tabelle locresi6RYHULD0DQQHOOL
'H)UDQFLVFLV$Stato e societ in Locri Epizefiri (Larchivio dellOlympieion
locrese), Npoles.
'H)UDQFLVFLV$/HWDYROHGL/RFULQHJOLVWXGLGDODGRJJLHQ0XVWL
' HG SS
'XERLV//HVWDEOHVGH/RFUHVQRWHGHOHFWXUHCCG 6, pp. 33-40.
*LJDQWH 0  /H WDYROH GL /RFUL FRPH WHVWR VWRULFR HQ 0XVWL ' HG 
pp. 36-59.
/DPEHUWHULH &K GH  /HV DGMHFWLIV JUHFV HQ . Smantique et comparaison,
Lovaina la Nueva.
/DXIIHU6Diokletians Preisedikt, Berln.
/XSSLQR6\6DQJLQHWR%$SSHQGLFH,OGHSRVLWRGLDQIRUHGL7UHELVDFFH
ed un recipiente per la pix BruttiaHQ&RVWDELOH) HG SS
0pQGH]'RVXQD-HQSUHQVD1RWDVDXQWHVWDPHQWRGH7HULQD\ODVDEUHYLDWXUDV
GHGHPyWLFRVHQ0DJQD*UHFLDRFIC.
0XVWL ' HG   Le tavole di Locri. Atti del colloquio sugli aspetti politici,
economici, cultuali e linguistici del testi del archivio locrese (Napoli 26-27 aprile
1977), Roma.
5REHUW/eWXGHVVXUOHVLQVFULSWLRQVHWODWRSRJUDSKLHGHOD*UqFH&HQWUDOH
9,'pFUHWVG$NUDLSKLDBCH 59, pp. 438-452.
:DUWNH5%3HFKHQ&DQFLN+\6FKQHLGHU+ HGV Der neue Pauly.
Enzyklopdie der Antike. Altertum %DQG  2U3RL 6WXWWJDUW:HLPDU SS 

9DWLQ&O'LVFXVLyQVREUH*LJDQWHHQ0XVWL' HG SS

)HFKDGHUHFHSFLyQGHODSULPHUDYHUVLyQGHODUWtFXOR
Fecha de aceptacin: 12/09/2012
)HFKDGHUHFHSFLyQGHODYHUVLyQGHILQLWLYD

Emerita LXXX 2, 2012, pp. 245-256

ISSN 0013-6662

doi: 10.3989/emerita.2012.12.1215

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 257-274
ISSN 0013-6662 doi: 10.3989/emerita.2012.13.1120

Intriga cmica versus intriga trgica en Tesmoforiantes


de Aristfanes*
Milagros Quijada Sagredo
milagros.quijada@ehu.es
Universidad del Pas Vasco (UPV/EHU)

Comic intrigue versus tragic intrigue in Aristophanes


Thesmophoriazousae
Tesmoforiantes es una comedia con una amplia presencia de elementos pardicos tomados de las tragedias de salvacin de Eurpides. En el presente
artculo analizamos la forma en la que Aristfanes,
a la hora de configurar la accin en esta comedia,
recrea la secuencia tpica de una intriga de salvacin trgica, en particular de Eurpides. Sostenemos que los elementos que siguen a la parbasis en
Tesmoforiantes tienen un valor orgnico y no interrumpen la accin cmica al continuar presentndonos al hroe en la persecucin de sus metas, de
modo que la paratragedia abarca la configuracin
de la accin cmica de principio a fin.

Thesmophoriazousae is a play with a wide presence of parodic elements taken from the rescue
tragedies of Euripides. In the present article we
analyze the way in which Aristophanes, when plotting the comic action in this comedy, recreates the
typical sequence of a tragic rescue intrigue, in particular Euripides. We hold that the elements which
come after the parabasis in Thesmophoriazousae
have an organic value and do not disrupt the comic
action since they continue presenting the hero in
the pursuit of his goals, thus the paratragedy covers
the configuration of comic action from the beginning to the end.

Palabras clave: Tesmoforiantes; paratragedia; parodia; intriga cmica; intriga trgica; tragedias de
salvacin; Eurpides.

Key words: Thesmophoriazousae; paratragedy;


parody; comic intrigue; tragic intrigue; rescue tragedies; Euripides.

I. Tesmoforiantes es una comedia que ha despertado un enorme inters


entre los estudiosos de la comedia aristofnica en las ltimas dcadas, podramos decir, a partir de 1980. Algunas observaciones, siquiera sean someras,
*
El presente trabajo se ha realizado en el marco del Proyecto de Investigacin HUM200910130, financiado por el MICINN (Plan de I+D+I). Agradecemos al Ministerio la ayuda recibida. Igualmente queremos dar las gracias a los dos informantes externos de Emerita por
las sugerencias y observaciones aportadas.

258

MILAGROS QUIJADA SAGREDO

sobre las lneas bsicas que han orientado este inters dentro de la crtica y
del estudio modernos de la comedia aristofnica pueden servir de fondo a la
hora de explicar y de justificar los objetivos que persigue este trabajo.
Se podra sealar en primer lugar el carcter paradigmtico que tiene
Tesmoforiantes en el estudio de la comedia como metateatro, en el que convergen aspectos como la libertad de este gnero literario para llamar la
atencin sobre su propia teatralidad1, la fuerte presencia en el mismo de
formulaciones poticas explcitas2 y la cuestin de la parodia cuando menos.
El inters en este campo ha estado dirigido no solo al estudio de las vertientes meramente literarias de este concepto usado muchas veces con una
libertad e imprecisin notables3, sino tambin a la implcita instruccin
que el poeta ejerce sobre el espectador de teatro al hacer evidentes sus propias prcticas en el manejo del lenguaje y al poner a disposicin de la crtica del pblico al propio autor y sus mtodos de trasmitir opinin4. Esta
tendencia crtica didctica enlaza, en cierto modo, con la antigua investigacin de la comedia en esta lnea y est presente tambin en algunos otros
trabajos modernos, como, por ejemplo, los que se ocupan de la utopia5.

A ttulo de ilustracin podran mencionarse trabajos como los de Zeitlin 1996, Gruber
1986, Carter 1987 o Taafe 1987, en esa direccin.
2
Cf. las referencias recogidas por Von Mllendorf 1995, pp. 18-19, esto es, Bremer 1991
o Murray 1987. El primero, seala Von Mllendorf, resalta la proclamacin que el poeta
hace con frecuencia de su excelencia artstica, esto es, del dominio de registros lingsticos
distintos procedentes de otros gneros, pero sin intencin pardica, su acercamiento, sobre
todo, a Eurpides; el segundo, la cautela con la que han de tomarse estas manifestaciones del
propio poeta, que muchas veces estn al servicio de aumentar la comicidad de un chiste en
el plano metapotico.
3
Dos estudios cannicos sobre el metateatro son Abel 1963, y Hornby 1986.
4
En esta direccin se orienta claramente Slater 2002, quien hace una revisin crtica de
trabajos anteriores en las pp. 1-21 de su libro (The Naming of Parts). En cuanto a la parodia
y sus alcances polticos y poticos, son representativos Foley 1988 (que se ocupa de Acarnienses) y Goldhill 1991, respectivamente (este ltimo, desde un punto de vista ms atento
a la produccin esttica, al destacar la polifona presente en la comedia: un mismo personaje
puede hablar con voz propia, pero tambin con la de otro al parodiar).
5
Cf. Von Mllendorf 1995, pp. 17-18, quien reenva a Zimmermann 1983. Este ltimo
distingue dos tipos de utopa, por un lado, la representada por Acarnienses (con una especie
de higiene social como efecto) y, por otro, la de Aves y Asamblestas (con una funcin
crtica ms evidente). Sobre la lengua de la utopa, esto es, sobre la existencia en griego de
ciertos trminos que poseen en s la capacidad de conjurar la presencia de mundos fantsticos
1

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

259

En segundo lugar habra que mencionar la investigacin relacionada con


la sociologa de la comedia (y del teatro en general), en particular, la que
se ocupa de la posicin de la mujer en la polis ateniense, del significado de
sus cultos para la estructura de la obra, de la relevancia poltica que sus
contrapropuestas sociales podan tener, aspectos estos ltimos para cuyo
estudio Tesmoforiantes aparece de nuevo como una comedia emblemtica6.
La relacin estrecha que para la sociedad ateniense del siglo V a. C. haba
entre el discurso poltico, esttico/artstico y de diferencia de gneros, y que
ayuda a explicar la comedia el teatro, en general como un exponente y
catalizador de las tensiones existentes en la sociedad ateniense de la poca,
encuentra en esta comedia una de sus expresiones ms claras y ricas. Como
en el caso del alcance didctico de la comedia, tambin el estudio relacionado con la sociologa de la comedia enlaza en cierto modo con una investigacin ms tradicional en este campo.
Desde luego, podramos encuadrar este trabajo dentro del inters por el
estudio de la parodia en la comedia de Aristfanes y en particular de la
parodia de Eurpides, en la que entran toda suerte de procedimientos de
escritura y de prstamos dramatrgicos cuyo denominador comn es la creacin de una discordancia entre el modelo trgico y su recreacin cmica7. El
inventario de elementos estudiados es aqu amplio, y abarca desde los ms
breves de carcter verbal o no hasta los ms extensos secuencias ms
desarrolladas de tragedias, como ciertas escenas tpicas de las que es difcil
evaluar en muchos casos la deuda en particular a Eurpides y la que deriva
de las convenciones de la tragedia en general. Pero ocurre que en una obra
como Tesmoforiantes la parodia, que tiene como punto de partida la analoga
puntual entre la intriga cmica y la intriga trgica, alcanza a la configuracin
de la accin cmica de principio a fin, de manera que nos pareci interesante abordar la cuestin de si en la manera en la que Aristfanes da forma a
los sucesivos momentos por los que atraviesa la accin en esta comedia hay

e imposibles puede verse Melero 2004. Sobre la utopa en la comedia antigua y los motivos
que son tpicos de la misma puede verse Farioli 2001 (con amplia bibliografa).
6
Algunos nombres y trabajos significativos en esta lnea de estudio son Zeitlin 1996,
Gruber 1986, Foley 1988 o Taafe 1993.
7
El trabajo clsico en este campo es Rau 1967. Sobre el concepto de parodia pueden verse
algunos trabajos clsicos, como Koller 1956, o Genette 1982. Sobre el concepto en relacin
con la parodia literaria griega o en la antigedad, entre otros, Delaney 1984 y Glei 1992.
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

260

MILAGROS QUIJADA SAGREDO

una recreacin de la secuencia propia de una intriga de salvacin trgica, y


en particular, euripidea. Este es el objetivo principal de este trabajo.
Alguna observacin puede ser precisa respecto a las posibilidades de la
comparacin. Las convenciones narrativas de la tragedia, atada a un universo de historias tradicionales conformadas al modo de la narracin homrica
pero en un proceso de reelaboracin continuo que dio como resultado un
enriquecimiento en la manera de contar historias, poco tienen que ver con
ODVGHODFRPHGLD/DDXVHQFLDHQHVWDGHXQDDWDGXUDDODVOH\HVGH
la causalidad, de la consistencia en el manejo del espacio y del tiempo, de
la ilusin dramtica la distinguen claramente de la tragedia. Su potica est
presidida por una combinacin flexible de principios formales y temticos
encaminados a dirigir las expectativas del espectador. Ms o menos garantizados de que aparezcan en su lugar y secuencia regulares estn el prlogo,
OD  OD SDUiEDVLV HO  ILQDO PLHQWUDV TXH HO  OD 
musical y esa serie de sucesivas y rpidas escenas en las que aparecen nuevos personajes representados por el segundo y/o tercer actores que se
enfrentan al personaje principal son opcionales y estn a disposicin de las
necesidades del poeta. Este rico conjunto de elementos formales tradicionales contribuye a configurar y marcar el ritmo de la accin, activando, en lo
que tienen de predecible, las expectativas del pblico. Al mismo tiempo, la
marcha de la accin sigue un desarrollo temtico que pasa por la presentacin de la premisa situacional en el prlogo generalmente una modificacin fantstica del orden natural, el establecimiento de quin va a ser el
protagonista o conductor de la accin, la meta que este se propone conseguir
de acuerdo con la situacin expuesta, las fuerzas o personajes oponentes. El
choque entre los fines que el hroe persigue y los de sus antagonistas sirve
para dar expresin a un experimento intelectual, dramatizado dialcticamente a travs de una serie de confrontaciones personales que pasan por unos
patrones episdicos fijos y que conducen a un final de triunfo y celebracin.
Como se ve, la comedia aristofnica ofrece una atractiva y poderosa alternativa al modo en el que la tragedia o la pica dirigan las expectativas
de su pblico. Pero la proximidad de la primera en el certamen potico que
los festivales dramticos suponan debi de ejercer cierta presin ya en la
poca de Aristfanes. Se ha sealado que las comedias de su etapa intermedia, Aves, Lisstrata, Tesmoforiantes y Ranas, muestran ciertas tendencias
que la aproximan a aquella: un uso coherente del espacio, un reparto cada
vez ms cerrado, una temprana informacin sobre la meta que persigue el
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

261

hroe protagonista, y, algo importante en relacin con la hiptesis planteada


en este trabajo, una continuidad de la meta final que persigue el hroe cmico ms all de la parbasis.
Desde luego, no se est siguiendo aqu sin ms la tesis sostenida por
Schmid 1946, pp. 413, 423 ss., de un Aristfanes en parodia continua de las
expresiones, los versos, los motivos y las escenas de la tragedia, en particular de la de Eurpides. No queremos decir que como sostena Schmid en
la manera en la que Aristfanes configura la accin de sus comedias haya
que ver una parodia de las tragedias de salvacin de Eurpides8, pero s
creemos que merece la pena someter a consideracin esa proximidad, sorprendente por su alcance, en la que Aristfanes coloca la accin de Tesmoforiantes respecto a la de una tragedia con intriga. O dicho de otra manera:
aunque la potica trgica no tiene por qu ser el medio a travs del cual
explicar la potica cmica, pues distinta es la esttica de una y otra, tambin
es cierto que la proximidad en el certamen dramtico de formas de poesa
como las representadas por estos dos gneros (adems del drama satrico),
que compartan tantos recursos, as como el hecho de que un poeta no pudiera practicar al mismo tiempo tragedia y comedia, constituyen un hecho
llamativo y bastante nico del drama griego del siglo V a. C. que invita a
una consideracin en paralelo de ambos gneros teatrales9. Desde luego, a
8
Cf. Schmid 1946, p. 413: In ganzen kann die erhaltenen Komdien des Aristophanes
ihrer Anlage nach als Parodien der euripideischen Retterstcke betrachten. Tambin otros han
insistido en la idea, como seala Rau 1967, p. 177, en su crtica a la tesis de Schmid, citando a
Garzya 1962, pp. 165-167 y Frey 1948, p. 168 ss. (con posterioridad a Rau se han mostrado
tambin cercanos a la tesis de Schmid, entre otros, Schwinge 2002). Garzya hace suya la idea de
XQDSDURGLDGHODHXULSLGHD\)UH\FRQVLGHUDTXHODWHPiWLFDGHVDOYDFLyQHQ$ULVWyIDQHV
remite a Eurpides dados los puntos de contacto (situacin de necesidad, hroe, plan, peligro).
Jouanna 1997, por su parte, considera que la intriga de Tesmoforiantes comprende la parodia de
una escena de espionaje, de una escena de splica y la idea de una substitucin de personaje
inspirada en el modelo trgico de Alcestis. Pero el concepto de tragedia de salvacin que
manejan estos autores es demasiado general: en Andrmaca, Heracles o Alcestis, la salvacin
puede originarse de forma espontnea, mientras que aqu el concepto tragedia de salvacin
se est utilizando de una manera mucho ms concreta, para definir una organizacin de los inciGHQWHVHQODTXHODLQWULJDHQHOVHQWLGRTXHFRPSRUWDHOWpUPLQRJULHJRVH
tematiza en una escena de deliberacin y otra de engao, de realizacin escnica del plan urdido
FRQWUDHORSRQHQWH\FRPSRUWDXQDVHFXHQFLDGHDFFLyQGHILQLGDTXHVLJXHDOD.
9
Se suma a esto el hecho de que las oposiciones entre gneros literarios nunca son totales,
sino que lo ms frecuente es que estos compartan elementos dentro de un sistema dado. Ms
adelante nos referiremos a este hecho en relacin con la paratragedia de la comedia.

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

262

MILAGROS QUIJADA SAGREDO

ello parece que quera invitar Aristfanes a su pblico cuando compuso una
comedia como Tesmoforiantes.
II. La manera en la que se articulan los elementos formales tradicionales
en Tesmoforiantes es la siguiente. a) En el prlogo (vv. 1-278), compuesto de
tres escenas, se expone la situacin de partida: comienza con la escena en la
que Eurpides y su pariente10 se dirigen a la casa de Agatn y concluye con el
disfraz del segundo, dispuesto a ofrecer a Eurpides la ayuda que Agatn no
ha querido darle. b) La prodos (vv. 279-379) trae consigo un cambio en el
lugar de la accin, que se traslada a la Pnx, donde se celebra la asamblea de
las Tesmoforiantes; estas plantean el caso de Eurpides. c) El desarrollo de la
intriga principal de la obra, que acaba con el fracaso del pariente, incapaz de
convencer a las Tesmoforiantes en su falso discurso de mujer, ocupa los verVRV(VDTXtGRQGHHQFRQWUDPRVHQORTXHSDUHFHQVHUGRV
ymbicas, varias parodias de tragedias euripideas. En la primera, en los vv.
466-519 que pronuncia el pariente, este parodia un recurso de la intriga de
la tragedia Tlefo (ya usado, por otro lado, en Acarnienses); en la segunda,
tras su desenmascaramiento y en un intento de liberarse, el pariente toma un
odre de vino como rehn, en una parodia, de nuevo, del Tlefo de Eurpides;
despus, tras ser apresado, escribe en una tablilla pidiendo ayuda parodia
de un recurso tomado del Palamedes de Eurpides11. Ante el fracaso de
todos estos intentos, el pariente espera que Eurpides lo salve. d) Sigue a continuacin la parbasis, una defensa del gnero femenino (vv. 85-845). e) Tras
ella se suceden cuatro escenas episdicas (vv. 846-928, 929-946, 1001-1035
y 1160-1225) con dos cantos corales en medio (vv. 947-1000 y 1136-1159),
en las que Eurpides aparece como hroe salvador y en las que se escenifican
varias estratagemas de Helena y de Andrmeda, separadas por la escena

Su nombre no es mencionado en la obra. El que aparece en los manuscritos (Mnesloco)


corresponde al del suegro de Eurpides, y su proyeccin al protagonista que procede de
FRPHQWDULVWDVGHpSRFDKHOHQtVWLFDVHDSR\DHQHOVLJQLILFDGRGHODSDODEUDJULHJD
(pariente). La ausencia de nombre es nica en la obra conservada de Aristfanes y exige
explicacin (cf. a este respecto Von Mllendorf 2002, p. 53 ss.)
11
Las secuencias en tetrmetros en las que se escenifican las parodias de Tlefo y de
Palamedes de Eurpides ocupan los vv. 689-759 y 760-784, respectivamente. Adems del
texto, con traduccin y comentario, en Collard, Cropp y Lee 1995 (Tlefo), y Collard, Cropp
y Gibert 2004 (Palamedes), pueden verse para estas dos tragedias conservadas en estado
fragmentario, Preiser 2000 y Falcetto 2002, respectivamente.
10

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

263

en la que el pariente es puesto bajo la vigilancia del arquero escita, que


no tienen xito; as que, sin solucin de continuidad, Eurpides llega a un
acuerdo con las mujeres en la cuarta escena. f) La xodos (vv. 1226-1231)
trae consigo el final de la fiesta, de modo que todas las celebrantes se van a
sus casas.
Se ha sealado que la estructura global de esta comedia est modelada
siguiendo muy de cerca el tipo tradicional de trama de escape que Eurpides
haba hecho tan suya, con un villano no griego (el arquero escita en el caso
de Tesmoforiantes) convertido en uno de los personajes familiares de las
representaciones teatrales de Atenas en el siglo V a. C.12. Y desde luego es
claro que el intertexto trgico que Aristfanes maneja con ms ambicin a
la hora de configurar Tesmoforiantes es el conjunto de tragedias representadas en el ao 412 a. C., esto es, Helena y Andrmeda con toda seguridad,
aunque la proximidad de Ifigenia entre los tauros y el Cclope puedan haber
jugado tambin un papel importante en el trabajo de recreacin pardica del
cmico13. Esta ltima, si en ella la presencia de un ser primitivo como el
Cclope, a quien la astucia griega engaa, es tpica del gnero del drama
satrico y ms all de su problemtica proximidad en la fecha de representacin con Tesmoforiantes14.
12
Cf. Hall 2006, pp. 241 s., en su discusin de la Paratragic Escapology: The Barbarian
Detainer, esto es, la parte de la obra en la que aparece el arquero escita. Hall comienza sealando que the whole structure of Thesmophoriazusae is of course reminiscent of the ancient
theme of Greek heroes escaping from non-humans or non-Greeks by means of their superior
intelligence (p. 241). Sobre la explotacin que hace la comedia de la figura del meteco en
el ltimo cuarto del siglo V a. C. en relacin con el arquero escita de Tesmoforiantes, puede
verse Silva 2011, pp. 209-215.
13
La hiptesis de una triloga trgica constituida por Helena, Andrmeda e Ifigenia entre
los tauros, seguidas, quizs, por Cclope ha sido defendida por Wright 2005, en particular,
pp. 6-55 (aunque ya antes Wilamowitz 1875 haba sugerido la posibilidad de que estas tres
tragedias se representaran el mismo ao). Tesmoforiantes, producida al ao siguiente, habra
sido una reaccin directa a la extraeza y la repetitividad de las tragedias de escape que Eurpides haba hecho representar sobre la escena en 412 a. C.
14
De una tetraloga pardica por parte de Aristfanes hablan Austin y Olson 2004, p. 339,
a propsito de la escena con el arquero escita en Tesmoforiantes: esta habra jugado el papel
de la obra satrica dentro de la tetraloga trgica, tras las parodias de Palamedes, Helena y
Andrmeda. Sobre las similitudes con Cclope, cf. Ussher 1978, pp. 197-198 o Seaford 1984,
p. 49. El primero parece defender la idea de una representacin en 412 a. C., junto con Helena,
Andrmeda y otra tragedia no identificada. Sobre el personaje del Cclope en la comedia y el
drama satrico del siglo V a. C. puede verse Mastromarco 1998.

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

264

MILAGROS QUIJADA SAGREDO

Muchos son los puntos de coincidencia que se han intentado sealar,


cuando menos, entre dos tragedias conservadas completas, Ifigenia entre los
tauros y Helena por un lado, y una comedia como Tesmoforiantes por otro15.
Hasta qu punto son todos ellos pertinentes a la hora de hablar de paratragedia cmica es otra cuestin. Hall menciona el escenario extico (versus el
otro mundo femenino del festival de las Tesmoforias), el que la obra est
compuesta desde el punto de vista de la vctima (el pariente de Eurpides),
ODSUHVHQFLDGHXQD (en la parodia del reconocimiento de Helena), el engao que el protagonista lleva a cabo sobre el personaje masculino
de un brbaro (el arquero escita) desplegando una invencin y un ritual caratersticamente griegos (la representacin de una tragedia), la aparicin
tarda en la obra del personaje al que hay que engaar (en Tesmoforiantes,
v. 929), el escape de la cautividad como premisa de toda la accin y ello a
travs de la puesta en prctica de estratagemas que van fracasando para
acabar satisfactoriamente solo en el ltimo minuto, con una escena final que
nos muestra la frustracin del brbaro engaado y su determinacin de perseguir y recapturar a su vctima16.
Ahora bien, dejando de lado la distinta entidad de los elementos seleccionados por Hall y las cuestiones de interpretacin que estos suscitan a la
hora de considerarlos como una recreacin cmica de elementos propios de
la tragedia17 y en particular de la tragedia euripidea, la relacin anterior
revela a nuestro entender algo incuestionable, que ciertos elementos pueden
15
Cf. Hall 2006, en especial pp. 241-255. Para el caso de Andrmeda, conservada en
estado fragmentario, pueden verse las monografas de Bubel 1991 y Klimek-Winter 1993.
16
Cf. Hall 2006, pp. 242-243.
17
Dos gneros literarios pueden compartir elementos que estn en la propia tradicin
literaria de la que derivan, en el mito, o en el folclore, sin tener que interpretarlos por ello
en clave de prstamo. De ah que la semejanza entre gneros haya sido a veces explicada
apelando a la nocin de family resemblance de Wittgenstein. Sobre la cuestin de los lmites entre los gneros (en particular, entre tragedia y comedia), puede verse Quijada 2011,
pp. 31-48. Ahora bien, para poder hablar de paratragedia es preciso que haya una dependencia intertextual entre elementos. Como seala Silk, 1993, p. 479, paratragedia es the cover
term for all of comedys intertextual dependence on tragedy, some of which is parodic, but
some is not; la parodia es, pues, un tipo de paratragedia. Silk define la parodia como any
kind of distorting representation of an original, which in the present context will be a tragic
original (ibd., p. 479). Una cuestin interesante y que siempre suscita la paratragedia es la
que incluye al receptor en el fenmeno; puede verse al respecto, entre otros, Mastromarco
2006, o Quijada 2004.

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

265

HVWDUSUHVHQWHVHQJpQHURVOLWHUDULRVGLVWLQWRVODHVXQHMHPSORODLQWULJDHVWRHVHOGHVDOYDFLyQRWURVLQVHUH[FOXVLYRV
de ninguno de ellos, y que es siempre no lo que estos elementos o lo que los
gneros tienen en comn sino lo que les diferencia lo que sirve para definirlos. La manera de organizar los incidentes en torno a una intriga de salvacin
en el caso de la tragedia y su posible presencia paratrgica en una comedia
como Tesmoforiantes nuestra hiptesis de partida, recordemos debe
pasar, pues, necesariamente, por establecer qu relaciones pero sobre todo
qu diferencias son literariamente significativas entre ambos gneros literarios para poder hablar de paratragedia cmica. A ellas nos hemos referido
antes al hablar de las posibilidades de la comparacin.
,,, (OXVRGHWpUPLQRVFRPRXRWURVSDUDGHVFULELUFXDOquiera de las estratagemas que utiliza el poeta como cebo en orden a crear y
mantener viva la atencin del espectador y a frustrar sus expectativas hasta
que se produce el resultado ltimo de la historia que est contando ocupa
un lugar destacado en las modernas aproximaciones narratolgicas al relato,
bien que sea discutible hasta qu punto el drama lo es18. Y en cierto sentido, la
discusin de Aristteles en la PoticaVREUHODVQHFHVDULDVGRVLVGH
GH VRUSUHVD TXH OD  \ OD  IRUPDV PDUFDGDV GH OD
 WUiJLFD WUDHQ FRQVLJR QR SXHGH HQWHQGHUVH VLQ DSHODU D 
iniciales. Pero este uso del concepto sirve para explicar estrategias que unen
al poeta que da forma a la historia con su receptor y no a las que tienen lugar
en el interior del drama, que son a las que nos estamos refiriendo.
(Q HVWH VHQWLGR HO FRQFHSWR GH LQWULJD   TXH HVWDPRV
manejando no se encuentra en la teora literaria de la Antigedad que nos ha
llegado, de manera que han sido los dramas mismos en los que una intriga
articula un segmento significativo de la accin (la perspectiva que aqu interesa) el punto de partida utilizado en los diversos intentos de definicin
18
Pueden verse las aclaraciones al respecto de De Jong 2004, pp. 1-10. De Jong propugna
un uso especfico del trmino narracin, frente a aquellos que lo identifican con el
aristotlico, esto es, la organizacin de los incidentes que constituyen la historia. Falta en el
drama un marco narrativo y por ello, usando la terminologa de esta autora, el narrador es
siempre un narrador interno y secundario. De igual forma ocurre con los narratarios
primarios (los espectadores) y los narratarios secundarios (los personajes), que son siempre
internos en el caso del drama. En cuanto a la narracin, esta es siempre una narracin embedded within drama.

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

266

MILAGROS QUIJADA SAGREDO

que ha habido por parte de la crtica moderna19. Desde luego, con una ms
temprana aplicacin al caso de la tragedia que de la comedia, y dentro de
esta ltima, a la comedia griega de Menandro y la latina de Plauto y Terencio, donde este elemento de la trama juega un papel importantsimo20. Lo
dicho anteriormente a propsito de las peculiaridades de la comedia aristofnica en la forma de manejar las expectativas del espectador explica que
HVWH FRQFHSWR QR VH KD\D DSOLFDGR D OD FRPHGLD  FX\R DQiOLVLV KD
seguido unos cauces distintos, que la han aproximado, en muchos casos, a
formas literarias de corte popular. Pues es cierto que una secuencia de situaciones relacionadas, denominadas de una manera u otra pero que pasa por
la presencia de una situacin de descontento, la bsqueda de una solucin,
un conflicto con el oponente, una victoria y una celebracin es visible en las
comedias de Aristfanes21 sin que por ello su desarrollo se someta a los
imperativos de una lgica y de una ordenacin temporal de tipo realista. Ms
an, sin que responda al requisito del engao (ms all del uso del disfraz
como medio de suscitar una determinada respuesta emocional, como ocurre,
por ejemplo, con Dicepolis disfrazado de Tlefo en Acarnienses) como
medio de superar la situacin de descontento inicial, o que esta pueda equipararse a una necesidad de salvacin en sentido estricto.
/DLQWULJDHVWRHVHOGHVDOYDFLyQFRPRHOHPHQWRGHWHUPLQDQte de la marcha de la accin, precisa de unos personajes, un portador que la
planifica y conduce, y de un objeto claramente determinable, la vctima; de
una meta, algo que todava no se ha conseguido (o no de un modo seguro)
19
Cf. la temprana definicin de Solmsen 1932, p. 4, para el caso de la tragedia: Die berechnende, listige Wahl und Anwendung geeigneter Mittel zu egoistisch erstrebten Zwecken.
'DVVWHKWIHVWVLQGHVZRUDXIGDV$XJHQPHUNGHUqua
JHULFKWHWLVW(WKLVFKH%HGHQNHQVLQGRIIHQEDUEHLVROFKHQDXVJHVWDOWHWGDVH[LVWLHUWIUVLHQLFKW'LHHLJHQHXQGRGHUGDV9HUGHUEHQ
des Gegners ist das Ziel; dazu gilt es den Weg zu finden und das kommt entscheidend
KLQ]XGHQJHJHQGHQVLFKGDVULFKWHWEHU0RWLYXQG=LHOH]XWlXVFKHQ2OD
definicin de Schwinge 1965, Col. 1874, s. u. Mechnema: Ein auf einer List basierender
Plan einiger Spieler im Drama, der ihnen zur Erreichung eines bestimmten Zieles dienen soll:
der Rache an anderen = Rache-M., der eigenen Rettung = Rettungs-M..
20
Para la comedia griega de Menandro y la latina de Plauto y Terencio puede verse, entre
otros, la monografa de Dieterle 1980.
21
Es la nomenclatura que utiliza Silk 2000, p. 270, que habla de dissatisfaction, quest,
conflict, victory, celebration. Cf. la terminologa utilizada supra, a propsito del desarrollo
temtico de la comedia aristofnica.

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

267

de la vctima; de un plan o estratagema que pasa por la creacin de una


apariencia de que algo es como no es; de una interaccin entre el portador
de la intriga y la vctima, de modo que cuando aquel interfiere en la esfera
de los intereses de esta, la vctima reacciona ante el engao.
La intriga tiene una funcin dentro de la esfera interna de comunicacin
del drama: es el medio por el que se intenta escapar de una situacin precaria y, dado que va asociada al engao, pone de manifiesto la compleja relacin entre apariencia y realidad; de esta irona interna participan por igual
tragedia y comedia, aunque desde premisas y tonos distintos, desde luego.
Pero dentro de la esfera externa de comunicacin del drama, la tragedia ve
aumentadas sus posibilidades de ofrecer al pblico una mayor distancia a
su favor en la informacin que este posee frente a los personajes, ayudada por la temtica tradicional y por la explotacin que de la intervencin de
fuerzas divinas en el destino humano hace. Estas posibilidades son ms reGXFLGDV HQ OD FRPHGLD DXQTXH HQ DTXHOODV FRQ SUHVHQFLD GH 
todos los personajes participan de una ignorancia que solo el desvelamiento
de la verdadera identidad resuelve. Tambin aqu, desde luego, son distintos
en tono los efectos sobre el pblico siendo la intriga en la comedia un
elemento que contribuye a la creacin de comicidad, aunque no falten los
TXH YHQ HQ OD FRPSOLFDFLyQ GH DOJXQRV  GH OD WUDJHGLD VREUH
todo euripidea, un desarrollo ficcional que la aproxima a la comedia.
(Q OD WUDJHGLD HXULSLGHD XQ  GH VDOYDFLyQ VXHOH FRQIRUPDU HO
VHJPHQWRGHDFFLyQTXHVLJXHDOD(OUHFRQRFLPLHQWRFRQVWLtuye, as, en la articulacin sintctica de los incidentes, el impulso real del
que surge la intriga, que pasa por la elaboracin de un plan, su ejecucin y
las consecuencias del hecho22. Consideremos ahora el caso de Tesmoforian-

22
Strohm 1957, p. 66 ss., seal la sucesin de cinco elementos constitutivos de todo
en la tragedia: el origen de la enemistad, el plan, la superacin de impedimentos,
la ejecucin y las consecuencias del hecho. Por lo que se refiere al origen de la enemistad tal
como es entendido por Strohm, este es difcil de determinar en muchos casos; sin embargo,
creemos que, desde el punto de vista de la organizacin de los incidentes que dan forma a la
historia () en la tragedia, lo que constituye el punto de partida de la intriga es con claridad la \ODVSRVLELOLGDGHVTXHODUHXQLyQGHORV crea. En cuanto
a la superacin de impedimentos que Strohm sita entre el plan y su ejecucin puede
adquirir una significacin particular en determinados dramas en tanto que en otros propiamente no existe. En el caso de la tragedia Helena, por ejemplo, la presencia de un personaje
de poderes especiales como Tenoe, la hermana de Teoclmeno el rey de Egipto y vctima

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

268

MILAGROS QUIJADA SAGREDO

tes, una comedia llena de transformaciones y donde Aristfanes parece haberse adueado de los recursos ms espectaculares del teatro de Eurpides:
YHVWLGR\GLVIUD]DFFHVRULRVTXHSRUWDQORVDFWRUHVHVFHQDVGH
movimiento y persecucin, situaciones por las que pasan los personajes, que
en su necesidad extrema como la amenaza que se cierne sobre el pariente
de Eurpides recurren a procedimientos de salvacin ingeniosos tomados
de la tragedia de Eurpides (Tlefo, Palamedes), cuando no a una recreacin
cmica de escenas famosas de sus tragedias, Helena, sobre todo, y Andrmeda.
El punto de partida de la comedia, la amenaza de muerte que pesa sobre
Eurpides, establece, de entrada, una analoga entre la intriga cmica y la
intriga trgica, pues no se trata aqu de cualquier tipo de necesidad o de
precariedad que deba ser superada por el hroe cmico, sino de la amenaza
ms urgente y vital que pueda darse, la amenaza de muerte. El origen de la
enemistad es brevemente expuesto por Eurpides en el prlogo, de manera
que la accin se construye desde el punto de vista del amenazado lo habitual en una tragedia de Eurpides, y su intento de reaccin. El portador
de la intriga principal de la obra, la que tiene que ver con el plan de engaar
a las mujeres reunidas en festividad, no va a ser, sin embargo, Eurpides,
sino su pariente, que desempea el papel que el poeta Agatn no ha querido
hacer. De manera que en el prlogo, y tras el primer intento fallido, se decanta el que va a ser propiamente el hroe de la comedia, el pariente de
Eurpides.
La ejecucin de la intriga principal trae a escena a los actores de la misma. La situacin anunciada en el prlogo es tematizada ahora a travs de las
intervenciones de varias mujeres23, y de la visin distinta que de los hechos
hace el pariente disfrazado. Un hecho llamativo ha sido observado a propsito de la manera ininterrumpida y extensa en la que hablan la Mujer Primera, sobre todo, y el pariente. Como si la longitud de un discurso en la comedia no fuera tolerable sin cierta preparacin y auto-justificacin24, el coro
del engao, da lugar a que la superacin de impedimentos, esto es, el intento de vencer
sus posibles reticencias, preceda a la elaboracin definitiva del plan, en lugar de seguirla.
23
Se trata de los vv. 383-432 y 443-458, en tetrmetros (primera ymbica).
24
Cf. Bowie 2004, p. 282. Salvo en ciertas situaciones o partes de la obra, como, por
HMHPSORHOSUyORJRORVGHEDWHV\ODVHQTXHVRQHVSHUDGRVORVODUJRVGLVFXUVRV
narrativos, en los que la narracin transcurre sin interrupcin, son comparativamente raros
en Aristfanes.
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

269

exclama antes de la intervencin de la Mujer Primera: Calla, silencio, pon


atencin, que ya carraspea como hacen los oradores. Al parecer va a hablar
largo y tendido25 (vv. 381-382). En cuanto a la del pariente, contiene uno
de esos relatos falsos, que tambin encontramos en la tragedia, que origina
el desenmascaramiento del infiltrado y la frustracin de sus planes26. Lo
que el pariente narra no es sino una historia ficticia que provoca el fin contrario al que este pretenda tras la reaccin de las mujeres, alertadas por el
afeminado Clstenes. El disfraz un elemento que juega un papel visual de
primer orden, desde luego como elemento de engao falla, pero falla sobre todo, por su inadecuacin, la falsa historia que sobre su vida como
mujer y su visin de los hechos como mujer cuenta el pariente27, primero en
un largo discurso, luego a travs de sucesivas intervenciones.
La reaccin de las mujeres y el desenmascaramiento y apresamiento del
pariente convertido ahora en el personaje que precisa salvacin dan
paso a los intentos desesperados de este de poner fin a la situacin de necesidad en que se encuentra, lo que hace echando mano de recursos tomados
de las tragedias de Eurpides (Tlefo, Palamedes). Este es el momento en
que el coro pasa a ejecutar la parbasis.
Como es sabido, esta tiene como tema la exculpacin de los males atribuidos a las mujeres y su defensa al compararlas con los hombres28. Las

La brevedad de la narracin como parte del discurso oratorio aparece como una recomendacin clara en el primer tratado de retrica griega que nos ha llegado, la Retrica de Anaxmenes (30.5, 1438a 22); Aristteles propugna una longitud de la narracin en su justa medida (Retrica III 16, 1416b 30-1417a 16).
25
Traduccin de Maca Aparicio y Villa Polo 1987, p. 4.
26
La falsedad afecta aqu a la personalidad de quien refiere una historia de mujeres siendo
como es un hombre, no al relato de algo que no ha sucedido, como ocurre, por ejemplo, en la
Electra de Sfocles con el anuncio que hace el pedagogo de que Orestes ha muerto.
27
Para Zeitlin 1996, p. 380, el discurso del pariente corrobora la familiaridad de Eurpides
con los secretos domsticos de las mujeres y, en este sentido, es una rplica de la trasgresin
del decoro trgico por parte del poeta trgico.
28
De una forma reducida y absurda, seala Zeitlin 1996, p. 391, el coro introduce una
teora de la imitacin que Crtilo har famosa en el clebre dilogo platnico que lleva su
nombre, segn la cual los nombres propios imitan la naturaleza de aquellos que los llevan.
En este juego epnimo las mujeres intentan salir al paso de los hombres sobre su propio terreno, el de la guerra y el de la poltica. As, ningn hombre puede competir con Nausmaca
(La que batalla en el mar), con Aristmaca (La mejor en la batalla), etc. La introduccin del
nombre de Salabaco (una famosa cortesana) lleva de nuevo la defensa al terreno de lo sexual.
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

270

MILAGROS QUIJADA SAGREDO

mujeres deben ser tratadas socialmente como madres de buenos o malos


ciudadanos, acaba sosteniendo el coro. La parbasis en Tesmoforiantes supone un punto de inflexin importante dentro de esta comedia, que gira
hacia una defensa implcita del pariente, convertido ahora en el personaje
femenino al que hay que salvar tpico de las tragedias de salvacin de Eurpides, y en la que este va a tomar parte tambin como personaje y pareja
masculina del primero. No es, por tanto, el habitual elemento disruptivo que
rompe con la continuidad temporal de los hechos que la comedia representa,
sino un momento de pausa que da paso a un nuevo comienzo, con una posicin y funcin similares, en este sentido, al amebeo que corona el reconocimiento y que encontramos en la tragedia. Es este amebeo el que en las
WUDJHGLDVGHVDOYDFLyQHXULSLGHDVGRQGHXQDSUHFHGHDODLQWULga (Helena, Ifigenia entre los tauros, Electra29, In en esta ltima, un
falso reconocimiento) corona el reconocimiento, constituyendo as, en la
sintaxis de la obra, el impulso real del que surge la intriga. En Tesmoforiantes, la intriga principal de la obra fracasa antes de la parbasis, tras la
peripecia que supone el desenmascaramiento del pariente, pero esta trae a
escena nuevos momentos, en una secuencia cuya sintaxis ofrece una doble
cara.
En efecto. Una interpretacin de la funcin de la parbasis como un elemento no disruptivo en esta comedia supone conceder a las escenas que
vienen a continuacin un carcter en cierto sentido orgnico dentro de la
secuencia de acontecimientos que representa Tesmoforiantes, por ms que el
salto de un texto a otro (de Helena a Andrmeda), y el amplio juego con
narratarios distintos en las escenas en que est presente la Mujer Segunda30
En la Electra de Eurpides, una tragedia con reconocimiento e intriga, falta el amebeo
que corona la , que es desplazado al final de la obra (vv. 1177-1232): es este
amebeo el que pone de manifiesto el punto de encuentro ms profundo entre los dos hermanos,
ese comn que representa el reconocimiento y que preside los planes de venganza, ahora
cumplidos. Puede verse al respecto Quijada 2005, en particular pp. 497-499.
30
Como se ha sealado, cf. Bowie 2004, p. 294, gran parte del humor en la escena de la
parodia de Helena deriva de la existencia de la Mujer Segunda, encargada de vigilar al pariente
\TXHMXHJDHOSDSHOGHGHXQDPDQHUDHVSHFLDO YY FRQYLUWLpQGRVHHQ
una narrataria (secundaria) intrusa junto con el pblico, el narratario primario; el papel
de narrador y narratario secundarios se confunden en ciertos momentos de esta escena en
tanto Eurpides y su pariente representan sus papeles de Menelao y Helena, respectivamente,
en beneficio de la Mujer, pero esta rechaza el papel de narrataria y, a su vez, les narra a ellos
los acontecimientos recientes de la Atenas contempornea.
29

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

271

y el arquero escita revelen para algunos el fracaso de la tragedia euripidea


para mantener la necesaria ilusin dramtica que tendra como efecto la
salvacin del pariente31. En cierto sentido, pues, las escenas tras la parbasis
pueden ser interpretadas como variantes metateatrales de las habituales escenas episdicas de la comedia, escenas en las que una serie de personajillos
irrumpen en el mundo del hroe cmico y son expulsados del mismo; pero
ledas de otra manera algo que siempre posibilita la parodia por su propio
carcter ambiguo, constituyen elementos de una secuencia que forma
parte integral de la accin en su conjunto. Una vez que la salvacin de Eurpides ha resultado fallida por la inhabilidad del pariente, que utiliza los
recursos propios de la comedia, este, convertido tras la parbasis en el personaje al que hay que salvar, pone en marcha una parodia que va a traer a
escena a Eurpides para que represente los papeles trgicos que ha compuesto, en una imitacin de la tpica trama de salvacin euripidea donde el plan
GHHQJDxRVLJXHDODHQODVLQWD[LVGHODDFFLyQ
As, como en una tragedia con intriga de salvacin de Eurpides, el pariente debe poner en marcha recursos diversos que, a pesar de su fracaso y
de los elementos disruptivos que comportan, constituyen una secuencia integral e integradora de elementos de la accin cmica. Aunque no ha sido
observado, una tragedia como Helena ofrece tambin repeticiones de esta
naturaleza (dos escenas de deliberacin, dos escenas en las que se represenWDHOMXHJRGHORVFRQHOHQJDxDGR FRPRLQVLVWHQWHSDUHFHVHU
por otro lado, el inters de Eurpides por esos aos en construir tragedias
con una intriga de salvacin, algo que sin duda est en el origen de la parodia aristofnica de Tesmoforiantes. La acumulacin y variedad de la secuencia total que constituye la accin de intriga en esta comedia, y la manera en
la que esta est construida, con una parbasis que no interrumpe, sino que
supone la aparicin de momentos nuevos en el desarrollo de la intriga cmica, son en este sentido ms fieles a la tragedia de Eurpides, y en particular a Helena, con su variacin y copia en la representacin de la intriga y el
papel central que en la sintaxis de la accin juega el reconocimiento, que la

Como observa Zeitlin 1996, p. 388, el hecho de que el xito de la ltima estratagema
de Eurpides descanse en la utilizacin de un recurso cmico (cuando introduce al flautista y
a la bailarina encargada de seducir al arquero escita, al tiempo que l simula ser una mujer
vieja) confirma la habitual valoracin de la parodia como un medio de poner en entredicho
los valores estticos de la obra de otro poeta.
31

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

272

MILAGROS QUIJADA SAGREDO

parodia que de este ltimo hace Aristfanes en su comedia, donde un elePHQWRWDQFDUDFWHUtVWLFRFRPRODH[LVWHQFLDGHOGH+HOHQDQRHVQL


siquiera mencionado.
BIBLIOGRAFA
Abel, L. 1963: Metatheatre: A New View of Dramatic Form, Nueva York.
Austin, N. y Olson, S. D. (eds.) 2004: Aristophanes Thesmophoriazusae, Oxford.
Bowie, A. 2004: Aristophanes, en Jong, I. J. F. de, Nnlist, R. y Bowie, A. (eds.),
Narrator, Narratees, and Narratives in Ancient Greek Literature, Leiden-Boston,
pp. 281-295.
Bremer, J. M. 1991: Aristophanes on his Own Poetry, en Reverdin, O. y Grange,
B. (eds.), Aristophane, Entretiens de la Fondation Hardt 38, VandoeuvresGinebra, pp. 125-165.
Bubel, F. von (ed.) 1991: Euripides, Andromeda, Stuttgart.
Carter, E. 1987: Actor, Author and Audience in Aristophanes Thesmophoriazusae,
Diss. J. Hopkins University.
Collard, C., Cropp, M. J. y Lee, K. H. 1995: Euripides: Selected Fragmentary Plays,
Volume 1, Warminster.
Collard, C., Cropp, M. J. y Gibert, J. 2004: Euripides: Selected Fragmentary Plays,
Volume 2, Oxford.
Delaney, C. 1984: Studies in Greek Literary Parody, with Special Reference to
Aristophanes and Plato, Oxford.
Dieterle, A. 1980: Die Strukturelemente der Intrige in der griechisch-rmischen
Komdie, msterdam.
Falcetto, R. 2002: Il Palamede di Euripide, Alessandria.
Farioli, M. 2001: Mundus alter: utopie e distopie nella commedia greca antica,
Miln.
Foley, H. 1988: Tragedy and Politics in Aristophanes Acharnians, JHS 108,
pp. 33-47.
Frey, V. 1948: Die Komdie des Aristophanes, MH 5, pp. 16-177.
Garzya, A. 1962: Pensiero e tecnica drammatica in Euripide. Npoles.
Genette, G. 1982: Palimpsestes. La littrature au second degr, Pars.
*OHL5$ULVWRWHOHVEHU/LQVHQEUHL,QWHUWH[WXDOLWlWXQG*DWWXQJVJHQHVHDP
Beispiel der antiken Parodie, Philologus 136, pp. 42-59.
Goldhill, S. 1991: The Poets Voice, Cambridge.
Gruber, W. 1986: Comic Theaters. Studies in Performance and Audience Response,
Atenas-Londres.
Hall, E. 2006: The Theatrical Cast of Athens. Interactions between Ancient Greek
Drama & Society, Oxford.
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

INTRIGA CMICA VERSUS INTRIGA TRGICA

273

Hornby, R. 1986: Drama, Metadrama, and Perception, Londres-Toronto.


Hunzinger, C. 2000: Aristophane, lecteur dEuripide, en Le theatre grec antique:
La comdie, Actes du 10me colloque de la Villa Krylos, Pars, pp. 99-110.
Jong, I. J. F. de 2004: Narratological Theorie on Narrators, Narratees, and Narratives, en Jong, I. J. F. de, Nnlist, R. y Bowie, A. (eds.), Narrator, Narratees,
and Narratives in Ancient Greek Literature, Leiden-Boston, pp. 1-10.
Jouanna, J. 1997: Structures scniques et personnages: essai de comparaison entre les Acharniens et les Thesmophories, en Menu, M y Thiercy, P. (eds.),
Aristophane: la langue, la scne, la cit, Bari, pp. 253-268.
Klimek-Winter, R. 1993: Andromedatragdien: Sophokles, Euripides, Livius Andronikos, Ennius Accius. Text, Einleitung und Kommentar, Stuttgart.
Koller, H. 1956: Die Parodie, Glotta 35, pp. 17-32.
Maca Aparicio, L. y Villa Polo, J. de la (eds.) 1987: Tres Comedias de Aristfanes.
La Asamblea de las Mujeres, Lisstrata, Las Tesmoforiantes, Madrid.
Mastromarco, G. 1998: La degradazione del mostro. La maschera del Ciclope nella
commedia e nell dramma satiresco del quinto secolo a. C. , en Belardinelli, A.
et al. (eds.), Tessere. Frammenti della commedia greca: studi e commenti, Bari,
pp. 9-42.
Mastromarco, G. 2006: La paratragodia, il libro, la memoria, en Medda, E., Mirto,
M. S. y Pattoni, M. P. (eds.), ,QWHUVH]LRQLGHOWUDJLFRH
del comico nel teatro del V secolo a. C., Pisa, pp. 137-191.
Melero, A. 2004: La lengua de la utopa, en Lpez Eire, A. y Ramos Guerreira,
A. (eds.), Registros lingsticos en las lenguas clsicas, Salamanca, pp. 149-172.
Mllendorf, P. von 1995: Grundlagen einer sthetik der Alten Komdie: Untersuchungen zu Aristophanes und Michail Bachtin, Tubinga.
Mllendorf, P. von 2002: Aristophanes, Hildesheim.
Murray, R. 1987: Aristophanic Protest, Hermes 115, pp. 146-154.
Preiser, C. 2000: Euripides, Telephos. Einleitung, Text, Kommentar, Zrich-Nueva
York.
Quijada, M. 2004: Dioniso, lector de Andrmeda en Ranas, en Bartolom, J.,
Gonzlez, M. C. y Quijada, M. (eds.), La escritura y el libro en la Antigedad,
Madrid, pp. 239-256.
Quijada, M. 2005: La anagnrisis como materia y forma de la tragedia griega,
en Martino, F. de y Morenilla, C. (eds.), Entre la creacin y la recreacin. La
recepcin del teatro greco-latino en la tradicin occidental, Bari, pp. 491-509.
Quijada, M. 2011: El Eurpides tardo y los lmites de la tragedia, en Quijada
Sagredo, M. (ed.), Estudios sobre tragedia griega. Eurpides, el teatro griego de
finales del siglo V a. C. y su influencia posterior, Madrid, pp. 31-48.
Rau, P. 1967: Paratragodia, Zetemata 45, Mnich.
Schmid, W. 1946: Geschichte der griechischen Literatur IV, Mnich.
Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

274

MILAGROS QUIJADA SAGREDO

Schwinge, E. R. 1965: Lexikon der Alten Welt, 1965, Col. 1874, s. v. Mechnema.
Schwinge, E. R. 2002: Aristophanes und Euripides, en Ercolani, A. (ed.), Spoudaiogeloion. Form und Funktion der Verspottung in der aristophanischen Komdie (Drama. Beitrge zum antiken Drama und seiner Rezeption 11), Stuttgart,
pp. 3-43.
Seaford, R. (ed.) 1984: Euripides Cyclops, Oxford.
Silk, M. S. 1993: Aristophanic Paratragedy, en Sommerstein, A. H. et al. (eds.),
Tragedy, Comedy and the Polis, Bari, pp. 477-504.
Silk, M. S. 2000: Aristophanes and the Definition of Comedy, Oxford.
Silva, M. de F. 2011: The Foreign Living in Athens: A Dramatic Type Character of
the Last Quarter of the 5th Century B.C., en Quijada Sagredo, M. (ed.), Estudios
sobre tragedia griega. Eurpides, el teatro griego de finales del siglo V a. C. y
su influencia posterior, Madrid, pp. 201-218.
Slater, N. W. 2002: Spectator Politics. Metatheatre and Performance in Aristophanes, Pensilvania.
Solmsen, F. 1932: Zur Gestaltung des Intrigenmotivs in den Tragdien des Sophokles und Euripides, Philologus 87, pp. 1-17.
Strohm, H. 1957: Euripides. Interpretationen zur dramatischen Form, Mnich.
Taafe, L. K. 1987: Gender, Deception, and Metatheater in Aristophanes Ecclesiazusae, Diss. Cornell University.
Taafe, L. K. 1993: Aristophanes and Women, Oxford.
Ussher, R. G. (ed.) 1978: Euripides Cyclops, Introduction and Commentary, Roma.
Wilamowitz, U. von 1875: Analecta Euripidea, Berln.
Wright, M. 2005: Euripides Escape-Tragedies, Oxford.
Zeitlin, F. I. 1996: Playing the Other: Gender and Society in Classical Greek Literature, Chicago-Londres, cap. 9 (=Travesties of Gender and Genre in Aristophanes Thesmophoriazousae, en Foley, H. P. (ed.), Reflections of Women in Antiquity, Londres-Nueva York, 1981, pp. 169-217).
Zimmermann, B. 1983: Utopisches und Utopie in den Komdien des Aristophanes, WJA 9, pp. 57-77.

Fecha de recepcin de la primera versin del artculo: 07/10/2011


Fecha de aceptacin: 18/05/2012
Fecha de recepcin de la versin definitiva: 17/09/2012

Emerita LXXX 2, 2012, pp. 257-274

ISSN 0013-6662

doi: 10.3989/emerita.2012.13.1120

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 275-294
ISSN 0013-6662 doi: 10.3989/emerita.2012.14.1111

Crcidas y la Antope de Eurpides*


Juan Luis Lpez Cruces
Universidad de Almera
juanluis@ual.es

Cercidas and Euripides Antiope


Anlisis de las reminiscencias de la Antope de
Eurpides detectables en los restos del meliambo
III de Crcidas: primero, la caza musical (cf. E.,
frs. 187, 198 Kn); segundo, el vnculo entre msica y filosofa, y tercero, quiz, el contraste entre el
filsofo y el atleta (cf. E., fr. 201 Kn). Crcidas
puede haber reconocido en el Anfin euripideo un
precursor mtico de su propia actividad poltica y
musical.

Analysis of the reminiscences of Euripides Antiope which may be detected in the remains of Cercidas third meliamb: first, the musical hunting (cf. E.
frs. 187, 198 Kn); second, the link between music
and philosophy, and, third (perhaps), the contrast
between the philosopher and the athlete (cf. E. fr.
201 Kn). Cercidas may have seen in Euripides
Amphion a mythical forerunner of his own political
and musical activity.

Palabras clave: Crcidas; Eurpides; Antope;


caza; alimentacin; atletismo; msica; murallas.

Keywords: Cercidas; Euripides; Antiope; hunting;


food; athletics; music; city walls.

I. Las columnas 7-8 del POxy. 1082 conservan los restos del meliambo III
Livrea de Crcidas de Megalpolis (= 3 Lomiento). La composicin se interpreta habitualmente en trminos autobiogrficos como una retrospectiva del
declinar de los aos en la que el poeta contempla con satisfaccin el camino seguido1. Ms all de este acuerdo bsico las interpretaciones divergen,
Este trabajo forma parte del proyecto FFI2009-12687-C02-0, financiado por el Ministerio de Ciencia e Innovacin de Espaa. Ha contado con el apoyo del Dr. F. Javier Campos
Daroca (Universidad de Almera), quien me anim a estudiar los fragmentos de Antope, y el
Dr. Frederick Willians, experto conocedor de Crcidas, cuyo asesoramiento no implica la
plena aceptacin de mi propuesta (sobre todo en lo relativo a la acentuacin del hapax
&  /RV IUDJPHQWRV GH Antope se citarn conforme a la edicin de
Kannicht 2004, pp. 274-312 (frs. 179-227), con la abreviatura Kn.
1
Hunt 1911, p. 22 (mi traduccin). Sobre la naturaleza autobiogrfica del poema, cf.
adems Schmidt 1912, p. 637 (Frg. 3 enthlt einen elegischen Rckblick des alternden
*

276

JUAN LUIS LPEZ CRUCES

entre otras cosas, en funcin de la mayor importancia que se d a los elementos filosficos o a los poticos existentes en el fragmento.
Ahora bien, toda vez que Crcidas es a un mismo tiempo poeta y filsofo2,
parece natural que al exponer sus ideas filosficas emplee, como la mayora
de los poetas helensticos, referencias poticas especialmente refinadas. En
lo que respecta al meliambo III, han aparecido en los ltimos decenios dos
trabajos que dan fe de ello y que analizan los siguientes versos del poema,
en los que se describe la juventud de Crcidas3:
@ 
 >@4
>@

Dichters auf sein Leben); Croiset 1911, p. 486; Fraccaroli 1912, p. 129; Livrea 1986, p. 95;
Lomiento 1993, p. 232. Tratndose de un poema autobiogrfico, tiene que ser significativo
que Crcidas haya evitado el empleo de la primera persona; los sujetos gramaticales son su
FRUD]yQ YY ODVFRVDVKHUPRVDV @Y 
VXDOPD >@Y VXVFDQDV >@>@Y
  TXL]i VX PHQWyQ DPDULOOHQWR >@   Y   \ ILQDOPHQWH VX HGDG DYDQ]DGD
>@YY 
2
La subscriptio del POxy. 1082, que transmite los restos ms extensos de su poesa (un
gnero nuevo, resultado de la fusin de las tradiciones mlica y ymbica), describe esta como
ORV0HOLDPERVGHOFtQLFR &pUFLGDVFI infra nota 37.
3
Cerc. III 5-7 Livrea (= Lomiento). El establecimiento de la colometra del fragmento es
una tarea especialmente ardua, dado que nos encontramos ante el poema que menos se adecua
a los esquemas bsicos de la poesa melimbica individuados por Maas 1911a. Colometras
alternativas recientes pueden verse en Lomiento 1988 y en Lpez Cruces y Campos Daroca
1994, p. 91; esta ltima propuesta ha sido reforzada por Lpez Cruces 1997 a partir de las
recurrencias fnicas del fragmento, que compensan la continua variacin mtrica. En el verso
PDQWHQHPRV IUHQWHDODFRUUHFFLyQGH/LYUHD
4
 8Q HVFROLR DO SDVDMH JORVD HO VLQWDJPD      FRQ ODV SDODEUDV
HVGHFLUODVSLH]DVGHODFD]D\ODDFWLYLGDGSRpWLFD /RPLHQWR
1993, p. 238). Las diferentes interpretaciones que se han dado del sintagma pueden consultarse
en Livrea 1986, p. 107 s. Destacamos la de Wilamowitz 1918, p. 1150 (= Kl. Schr. 142), quien
lo interpret como las piezas que el poeta cazaba y pescaba en los bosques de las Musas.
Poco apoyo han encontrado, en cambio, Knox 1923, p. 9, quien pens en una referencia a los
poemas cercideos, pero en concreto a su labor antolgica de poemas colimbicos (algo que
carece de slido fundamento, cf. Livrea 1986, p. 108), y Webster 1964, p. 232, quien consiGHUyODSRVLELOLGDGGHTXHFRQ&pUFLGDVVHUHILULHVHDORVSURSLRVSHUURV SHUKDSV
then the tender cubs of the Muses are not the quarry but the hounds), pero eso parece una
anticipacin de lo que Crcidas dice a continuacin de ser un pescador y cazador inigualable.
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

277

Jams se te escapaba nada hermoso; en tus entraas


tenas todas las tiernas bestezuelas de las Musas5,
y de las Pirides pescador fuiste, alma ma, y cazador excelente.

En 1996 Liana Lomiento detect en el poema un influjo de la sexta Nemea


de Pndaro: el hecho de que Crcidas se defina a s mismo pescador y cazador
GHODV3LpULGHV >@ SDUHFHXQDUHHODERracin de la descripcin que en esa oda haba hecho Pndaro de los poetas en
JHQHUDOFRPRDUDGRUHVGHODV3LpULGHV Y 6. Aos ms
tarde, en 2002, Frederick Williams ha mostrado que, para su semblanza de s
PLVPRFRPRDOJXLHQDTXLHQMDPiVVHOHHVFDSDEDQDGDKHUPRVR 
 &pUFLGDVKDHPSOHDGRXQOHQJXDMHSURSLRGHODFD]DTXH
VHUHPRQWDSRUODVLJQLILFDWLYDSUHVHQFLDHQHOSDVDMHGHOWpUPLQRDO
nico pasaje de la Odisea donde este aparece, que es aquel en el que Eumeo
HORJLDGHOVLJXLHQWHPRGRD$UJRVHODQFLDQRSHUURGH2GLVHR
_7. Segn Williams,
Crcidas el cnico parece querer caracterizarse en el poema como un perro
cazador Homerico more.
No debe sorprendernos la integracin de los modelos pindrico y homrico
en la elaboracin del pasaje. Crcidas vivi en la poca helenstica, perodo en
el que, con la extensin de la escritura y la lectura, tiene lugar una reescritura
plural que permite descubrir en cada texto niveles de lectura e interpretacin
diferentes que a menudo presuponen hipotextos igualmente diversos8. En esta
medida, y teniendo en cuenta que en el corazn de Crcidas caban todas las
tiernas bestezuelas de las Musas, creo que an hay sitio para postular el influ  WRGDV ODV EHVWH]XHODV GH ODV WLHUQDV 0XVDV VL FRPR SURSRQH:KLWH  S 
debe reconocerse aqu un caso de enlage.
6
Lomiento 1996, p. 68, afirma que tambin hubo de influir en el meliambo la descripcin pindrica de Alcmidas como alguien que se ha revelado como afortunado cazador
 N. 9,   HQ OD OXFKD SXHV VXV SDVRV ORV GD VREUH ODV KXHOODV  Y  
consanguneas de su abuelo Praxidamante (trad. de E. Surez de la Torre).
7
Hom., Od. XVII 316 s. Williams 2002, p. 40, aduce como paralelos venatorios los siguientes: Ant. Lib. XLI 5, Arr., Cyn. ,,;;9\HQFRQFUHWRVREUHHOSRHWLVPR
en contextos de caza, Opp. Apam., C. I 425 s., Opp. Anaz., H. I 16 s. White 1998, p. 248 s., a
SDUWLUGHODSUHVHQFLDGHORVGRVKRPpULFRVGHOIUDJPHQWR DGHPiVGH
 HQ HO YHUVR   KD SURSXHVWR LQWHUSUHWDU HO SRHPD FRPR XQD FRQILUPDFLyQ GH OD
pasin de Crcidas por la poesia homrica, a la que seguir consagrndose durante la vejez.
8
V. Cusset 1997, pp. 7-23.
5

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

278

JUAN LUIS LPEZ CRUCES

jo en estos versos de un tercer poeta: Eurpides, el tragedigrafo a quien Crcidas cita al comienzo del meliambo II y de cuyos versos parte all para reflexionar sobre el poder ambivalente de Eros9. Mi propuesta es que Crcidas
ha tomado de l la imagen de las canciones como tiernas bestezuelas de las
Musas que el poeta caza. Aparece esta en Antope, tragedia representada hacia
410-409 a. C.10 que goz de gran fama durante la Antigedad; por recordar los
hitos esenciales de su recepcin anteriores y posteriores a Crcidas, en el siglo IV a. C. Platn reelabor en Gorgias un episodio muy famoso de la tragedia (la discusin entre los gemelos Zeto y Anfin, cf. infra) y Eubulo model
sobre ella una comedia homnima, y en el II a. C. Pacuvio compuso en latn
una adaptacin que Cicern calific de traduccin fidedigna11.
La obra, a juzgar por los fragmentos que nos han llegado de ella, debi de
contener numerosas imgenes venatorias12. Especial relevancia tienen para el
SDVDMHTXHQRVRFXSDDTXHOODVTXHDSDUHFHQHQHO entre los hijos
gemelos de Antope. Uno de ellos, Anfin, un msico enamorado de su arte,
tiene que hacer frente a los reproches de su hermano Zeto, hombre de accin
entregado a la ejercitacin y a las tareas comunitarias, que le echa en cara su
excesiva dedicacin a la msica (fr. 187 Kn):
 &HUF ,, /LYUHD   /RPLHQWR  YY         _ 
_(OSDVDMHJORVDGRSRU&pUFLGDVHQ
HVWHPHOLDPERHVWiUHODFLRQDGRFRQ(IUD.Q
10
En realidad, el Schol. Ar. Ra. 53 (Antiopa, test. II Kn) la sita entre 412 (ao de representacin de Andrmeda de Eurpides) y 405 a. C. (Ranas), pero el relieve que Eurpides
daba en la tragedia al enclave fronterizo de noe, que los atenienses perdieron en el otoo de
411, invita a no alejarla demasiado de 410-409; cf. Lpez Cruces 2007, p. 32.
11
Cf. Pl., Grg. 485e-486d; Eu., Antiop. frs. 9-12 K.-A. (de estas dos reelaboraciones
hablar ms adelante); Pa., frs. 1*-19 Schierl; Cic., fin. I 4. Puede que, adems, haya existido
una Antope cnica; cf. infra nota 45. En general v. Collard 2004, pp. 269 s. (pervivencia
literaria) y 259 (bibliografa sobre su repercusin en la tradicin iconogrfica).
12
De la obra se conservan los frs. 179-227 Kn. Sobre el empleo euripideo del lenguaje
de la caza cf. Brberi Squarotti 1993, p. 37, quien define como polos semnticos bsicos que
concentran la mayora de los usos figurados de la caza en Eurpides la violencia encaminada a
capturar a alguien u obtener algo por la fuerza y, segundo, el engao en el que cae la vctima.
Esto es, justamente, lo que encontramos en el xodo de Antope, donde Anfin idea un plan
para, mediante engao, conseguir que el rey de Tebas entre solo y desarmado en la cueva
donde los gemelos se han escondido para capturarlo y darle muerte. Anfin apela a Zeus de
HVWH PRGR SDUD TXH SURSLFLH OD FDSWXUD GHO UH\  FRQFpGHnos! marchar con xito a la
FD]D SDUD DWUDSDU DO PiV LPStR GH ORV KRPEUHV @      >@ _
>@IUYY.Q 
9

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

279



,



Un hombre que se gana bien la vida
pero descuidando las cosas de casa por incuria las abandona
y, en cambio, goza con los cantos y a esa caza se entrega sin cesar13,
se volver perezoso para la casa y para la ciudad,
y ser un don nadie para los amigos. La naturaleza se echa a perder
cuando uno sucumbe a la dulzura del placer.

En su rplica (fr. 198 Kn) Anfin mantiene la imagen de la caza14, usada


por su hermano para devaluar la dedicacin a la msica, y pronuncia unas
SDODEUDV TXH VXPDGDV DO KRPpULFR     FI supra), explican
ELHQHOFHUFLGHR

,


Si alguien que sea afortunado y se gane la vida
no trata de cazar nada hermoso de lo que en casa tiene,
lo que es yo, a ese jams lo llamar bienaventurado
sino, ms bien, venturoso custodio de su dinero15.

Cf. Brberi Squarotti 1993, p. 126 n. 29: A menudo en Eurpides las imgenes venatorias se refieren a deseos vanos e ilcitos o bien a la bsqueda de algo que o se ha negado a los
hombres o bien es prohibido por las normas morales y por la voluntad divina (mi traduccin),
para ejemplificar lo cual cita, entre otros, este fragmento de Antope. Sobre el uso intelectual
y filosfico de las imgenes de la caza, cf. Kambitsis 1972, p. 26 (ad E., Antiopa, fr. VIII =
187 Kn), Livrea 1986, p. 109, Lomiento 1993, p. 239 s., y 1996.
14
Schaal 1914, p. 16, llam la atencin sobre esta responsin verbal en las intervenciones
de los hermanos.
15
 6RUSUHQGHHOHPSOHRSRUSDUWHGH$QILyQGHODGMHWLYRFIHOHOHQFRGHLQWHUpretaciones que ofrece Kannicht 2004, p. 294 s. ad loc.
13

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

280

JUAN LUIS LPEZ CRUCES

II. La aceptacin de este nuevo modelo junto a los de Pndaro y Homero


sugiere, en primer lugar, que Crcidas tuvo acceso a la tragedia euripidea o,
en su defecto, a amplias secciones de ella; en cualquiera de los dos supuestos,
hubo de conocer el primer episodio, donde se escenificaba el debate entre los
gemelos Zeto y Anfin a propsito de las vidas activa y contemplativa, simbolizadas por la pasin de los hermanos por la caza y la msica. En segundo
lugar, permite formular nuevos argumentos respecto de dos de los muchos
problemas que ha suscitado el fragmento cercideo: uno, el contraste existente en el meliambo III entre la juventud y la vejez del poeta, y otro, la acentuacin del trmino &en el verso 4. Veremos que los argumentos, aunque no permiten resolver los problemas de forma definitiva, invitan a reforzar una de las dos posiciones en conflicto o, en su defecto,
aportan argumentos nuevos16.
En primer lugar, debido a la mala conservacin del fragmento, que se
interrumpe antes de que el meliambo llegue a su fin, desconocemos cmo
se resolva el contraste existente en el poema entre la juventud del poeta,
entregada a la caza y la pesca al servicio de las Musas (vv. 1-7), y el momento presente de la vejez (vv. 8-12). Dos opciones parecen, en principio,
posibles. Arthur S. Hunt, el primer editor del papiro de los meliambos, pens que la distincin de edades era un modo de anunciar el abandono de la
poesa para consagrarse a otra actividad, quiz la filosofa17. Sin embargo, la
idea de que Crcidas leyese la Antope euripidea da mayor peso a la otra
opcin, es decir, que entre juventud y vejez no ha habido un cambio sustancial de actividad, porque entre poesa y filosofa no hay solucin de continuidad18. Es lo que sugiere el propio desarrollo del debate entre los hijos de
Antope en la tragedia euripidea: por lo que indican los antiguos, en su rplica al ataque que Zeto haba hecho de su dedicacin a la msica, Anfin
no se limitaba a defender esa actividad, sino que haca una apologa de la
sabidura en general. Tanto Cicern como el autor de la Retrica a Herenio
16
Suscribo la observacin de Williams 2002, p. 40 a propsito del poema: to some of
its problems, given the fragmentary nature of the papyrus, definitive solutions are unlikely
to be found.
17
Hunt 1911, p. 22: Perhaps it is his farewell to poetry. Han respaldado la sugerencia
Nachov 1973, p. 45 y Campos Daroca y Lpez Cruces 1992, p. 28 a partir del paralelo con
Hor., Ep. I 10-12 y Prop. III 5, 19-25.
18
As Pennacini 1955-1956, p. 262, secundado por Livrea 1986, p. 108 y 2007, p. 77 s.,
y por Lomiento 1993, p. 238 s.

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

281

criticaron esta extensin del tema del debate, pero la crtica no est plenaPHQWHMXVWLILFDGDSXHVSDUDXQJULHJRHOWpUPLQRDEDUFDEDHOFRQjunto de las artes liberales, incluida la filosofa19. Semejante uso amplio del
trmino explica, en primer lugar, por qu en el Gorgias platnico (485e486d)20 el pragmtico Calicles asume el papel de Zeto para, mediante la
asimilacin de Scrates a Anfin, criticar la dedicacin del sabio a la filosofa; en segundo lugar, por qu, mientras que en Eurpides Zeto critica el
ocio de su hermano asocindolo a la msica, en la adaptacin de Pacuvio
proclama: Odio a los hombres entregados a una holganza perezosa y a los
dichos filosficos21, y, finalmente, por qu Dion Crisstomo en su breve
escrito Sobre la confianza (Or. LXXIII) ana msica y filosofa del siguienWHPRGRDTXHO VF Zeto) aconsejaba a su hermano que no vala la pena
que se dedicara a la filosofa ni que gastara el tiempo en la msica si tena
que abandonar el cuidado de sus propios asuntos22.
En resumidas cuentas, Crcidas puede haber heredado del Anfin euripiGHRHOVHQWLGRODWRGHODVWLHUQDVEHVWH]XHODVGHODV0XVDVVRQ
al mismo tiempo poesa y filosofa (no en vano, los meliambos son lo uno
y lo otro) y, por lo tanto, tiene poco sentido pensar en un abandono de la
poesa para abrazar la filosofa en el trnsito de la juventud a la vejez del
poeta.

Cf. Cic., Inu. I 150.94 (= E., fr. 182b, iia Kn = Pac., test. 46 Schierl) ut Amphion apud
Euripidem, item apud Pacuuium, qui uituperata musica sapientiam laudat; Rhet. Her. II 27,
43 (= E., fr. 182b, ii b Kn = Pac., test. 45 Schierl) uti apud Pacuuium Zethus cum Amphione, quorum controuersia de musica inducta disputatione in sapientiae rationem et uirtutis
utilitatem consumitur; Joly 1956, p. 64: Zeto no se limitaba a criticar la msica en sentido
UHVWULQJLGR3DUDXQJULHJRODHVHOFRQMXQWRGHODVDUWHVOLEHUDOHV$UUHPHWtDFRQWUD
la filosofa, contra la cultura en general, como mostrar con claridad la rplica de Anfin
(mi traduccin); tambin Snell 1964, p. 82.
20
Los escolios dan fe de la paratragedia; cf. Olymp., in Grg. 484b 1 s. (26.13.12 ss. WesteULQN 
          \ WDPELpQ Sch. vet. in
Grg. 484e 2-4.
21
Cf. Pac. fr. 4* Schierl (= 348 Ribbeck3, 8 DAnna) odi ego homines ignaua opera et
philosopha sententia. Obviamente, nada impide que la crtica a la filosofa la profiriera ya
el Zeto euripideo.
22
Cf. D. Chr., Or/;;,,,
 WUDGGH*GHO&HUUR
Caldern, ligeramente modificada).
19

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

282

JUAN LUIS LPEZ CRUCES

III. El segundo problema sobre el que Antope puede arrojar cierta luz es la
controvertida acentuacin del trmino &en el verso 4:
      

&

En el siglo III de nuestra era, un fillogo residente en Oxirrinco interpret


el hapax & como una forma de participio de un hipottico
YHUERUHIHULGDD\FRPSOHPHQWDGDSRUHOVLQWDJPD
 23. En consecuencia, puso un acento circunflejo sobre la
~OWLPD YRFDO GHO YHUER  \ VHJXUDPHQWH IXH pO PLVPR
TXLHQDxDGLyVLJQRVGHYRFDOEUHYHDSDUDLQGLFDUTXHVH
trataba de formas de acusativo plural y no del genitivo singular drico (en
FX\RFDVRKDEUtDHVFULWR 24. Tales marcas implican traducir
los versos como sigue: T, en cambio, inmarcesible corazn tenas en tu
pecho e invencible, que devoraba pingemente todas las preocupaciones25.

Cf. Hunt 1911, p. 56 (adIULL 7KHWHUPLQDWLRQLVDSSDUHQWO\D'RULFFRQWUDFWLRQ RI  IRU ZKLFK FI HJ &,*     &RPR
SDUDOHOR GH OD FRQVWUXFFLyQ SDUWLFLSLR  FRPSOHPHQWR GHO VLQWDJPD  VF
   FI HO YHUVR  GHO PLVPR SRHPD  VF  
 
24
V. Lomiento 1993, pp. 40-42, sobre la base drica de la lengua de los meliambos y,
sobre el nmero de revisores del texto, McNamee 1981, pp. 80, 84 s., quien incluye el POxy.
1082 entre los que llama textos de eruditos (VFKRODUVWH[WV) por la presencia de variantes
y notas crticas debidas a dos revisores distintos. Las marcas de cantidad en el POxy. 1082
(inventario en Livrea 1986, p. X) no responden todas a una nica funcin. Lomiento 1993,
S  KD LQWHUSUHWDGR ODV GH   FRPR XQD LQGLFDFLyQ GLDOHFWDO GH TXH VH WUDWD
de acusativos dricos breves; efectivamente, puede ser as, pero adems sirven para evitar la
confusin entre formas homgrafas (ac. pl./gen. sing.), que es la funcin que tienen en: col.
,, @ GDW VLQJQRP SO  FRO ,9  HUUyQHDPHQWH PDUFDGR FRPR IHP
VLQJFXDQGRHQUHDOLGDGHVQHXSO FRO9 DFXVSOJHQVLQJ FRO,;
\FRO;,,@ IHPVLQJQHXSO :LODPRZLW]SURSXVRXQDWHUFHUDSRVLELOLGDGTXHODV
marcas de slabas breves sean una mala lectura de iotas suprascritas; cf. infra nota 38.
25
 &I&URLVHWS XQFRHXUTXLGHVSHLQHVHOOHVPrPHVVHIDLVDLWXQHJUDVVH
QRXUULWXUH 3DVTXDOLS LOVXRFXRUHKDGLYRUDWRRJQLFXUD 3DTXHW2,
p. 135 (se nourrisant grassement de multiples proccupations); tambin Steinrck 2009,
S GDV+HU]IUHVVHQGGHU)HWWElXFKH)OHLVFKLQMHGHP*HGDQNHQ FX\DWUDGXFFLyQ
SUHVXSRQHHOWH[WR FIinfra nota 38).
23

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

283

En 1992 defendimos la lectio del papiro en esta misma sede26; segn nuestra propuesta, Crcidas establece un paralelo entre la caza de las Musas y
la victoria sobre las preocupaciones, mediante el cual da a entender que se
ha apropiado de los diferentes factores de inspiracin potica, tanto activos
como pasivos27. En lo que respecta a estos ltimos, en lugar de ser devorado por las preocupaciones, imaginadas desde antiguo por los griegos como
PRQVWUXRVDQLPDOHVFRVTXHFRQVXPHQODFDUQHKXPDQD VLJQLILFD
en su sentido etimolgico, la que devora los miembros)28, el corazn invencible de Crcidas29, concebido aqu como ha sealado Williams como un
perro de caza, devora todas las preocupaciones, del tipo que sean.
La inversin es, qu duda cabe, atrevida y, como indic Enrico Livrea,
nica30; sin embargo, es perfectamente defendible. Como explic Richard B.
Onians31, las preocupaciones atacan a los rganos del pecho y, entre ellos, al
corazn; por ejemplo, en la Odisea Penlope describe el acoso nocturno de las
preocupaciones del siguiente modo (XIX 515-517): cuando llega la noche y
Campos Daroca y Lpez Cruces 1992 (tras Lens 1990). Destacbamos (ibd., p. 23 s.) el
argumento lingstico: a favor de la acentuacin del papiro est la naturaleza del compuesto:
SRGHPRVSHQVDUTXHHODXGLWRULRGHOSRHWDQRHQWHQGLyFRPRFRPHUFDUQHJUDVD  VLQRTXHLQGLYLGXyXQYHUERTXH\DH[LVWtDHQVXOHQJXD
FX\RXVRLQWUDQVLWLYRHVWiELHQWHVWLPRQLDGRSUHFHGLGRGHXQDGMHWLYR  
que le dara un matiz adverbial. El verbo presentara, por tanto, una estructura semejante a la
GHYHUERVFRPRKDEODUHQYR]DOWDMDFWDUVHRFRPR
REUDU ELHQ &I DGHPiV /ySH] &UXFHV  S  VHJ~Q TXLHQ OD HOHFFLyQ FHUFLGHD GHO
SULPHUHOHPHQWRGHOFRPSXHVWR  VHH[SOLFDELHQFRPRODFUHDFLyQGHXQDUHVSRQVLyQ
sonora entre  \   VHPHMDQWH D OD TXH HQ +RP Od. XX
56 s. y XXIII 342 s. se establece entre el adjetivo \HOVLQWDJPD
 YDOUHVSHFWR$UULJKHWWLSV 
27
Entre los pasivos cabe contar las cuitas amorosas y la preocupacin por conseguir el
sustento, que empujan al poeta a componer.
28
Cf. Hes., Op.    FRQ HO Schol. ad loc. (p. 38.9 Pertusi)
 @           
            
EM
tambin esp. FRPH]yQfr. GpPDQJHDLVRQ9DOUHVSHFWR/LYUHDS
29
Diehl 19523, p. 147 ad loc., adujo como paralelo Pl., R. ,, E   
               

30
Cf. Livrea 1997, p. 39 s., quien se muestra contrario a nuestra propuesta.
31
Onians 19862S7KHLGHDWKDWHPRWLRQDOWKRXJKWVFDUHVZHUHOLYLQJFUHDWXUHV
troubling the organs in ones chest has not, I think, been adequately recognised.
26

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

284

JUAN LUIS LPEZ CRUCES

el sueo se apodera de todos, yazgo en mi lecho y en torno a mi agitado cora]yQVHDUUHPROLQDQSXQ]DQWHVLQTXLHWXGHVTXHPHSURYRFDQHOOODQWR 


_ &pUFLGDVKDFH
que el corazn, vctima de estas asechanzas, responda al ataque y para ello
aprovecha la circunstancia de que, aparte de la alimentacin fsica del estmago, los griegos como nosotros conocan una alimentacin figurada del
corazn, el cual a menudo encuentra sustento en el llanto, los lamentos, las
penas y las esperanzas fundadas o vanas; sirva de ejemplo el lamento de las
Coforos de Esquilo, quienes declaran que a lo largo de sus vidas el corazn
VHQXWUHGHODPHQWRV Y 32. De acuerdo con esta
interpretacin, Crcidas habra integrado la alimentacin figurada del corazn
aqu las preocupaciones con su autopresentacin perruna, de lo que resulta que el poeta es un perro que devora las preocupaciones en vez de ser devorado por ellas. Y puede que el modelo de esta osada imagen se encuentre de
nuevo en la Odisea. En el canto XX el corazn del hroe es comparado con un
perro, imagen que, segn un estudioso autorizado, supuso en su momento una
innovacin tan atrevida como la que hemos defendido para Crcidas33. El enoMDGRFRUD]yQGH2GLVHRODGUD Y \HVFRPSDUDGR SRU HO SRHWD FRQ XQ SHUUR ODGUDGRU      YY  V  D
continuacin, para marcar an ms el smil, Odiseo tranquiliza su corazn con
esta palabras: Paciencia, corazn mo, que cosas ms perras tuviste que soSRUWDU HQ RWUD RFDVLyQ        
v. 18). En resumen, la acentuacin del papiro permite una interpretacin vlida
del pasaje sin necesidad de corregir el texto. De acuerdo con ella, Crcidas
habra planteado en el comienzo del fragmento conservado del meliambo un
contraste entre aquellos hombres que, angustiados por las preocupaciones, en
especial por la muerte, cierran los ojos a causa del miedo, y el corazn valiente del poeta, que devora esas mismas preocupaciones34.
Para la idea proverbial de alimentarse de esperanzas cf. A., Ag.   
 E., Ph. 396, Bacch. 617; S., Ant. 1246; Eub., fr. 9.7
K.-A. (Antiopa).
33
V. Rose 1979 y tambin Russo 1968, p. 291 ss., quien considera el pasaje una distorsin
especialmente sorprendente de un patrn tradicional. Livrea 1986, p. 110, recoge el pasaje
homrico entre los paralelos de apstrofe al corazn; cf. tambin Steinrck 2009, p. 106.
34
 &HUF ,,, /LYUHD   /RPLHQWR   VV @     _ 
 HODGYHUELRLQLFLDOSXHGHVHULJXDOPHQWH@SURSXHVWR
por Lpez Cruces y Campos Daroca 1994, p. 91 s.; cf. tambin Lpez Cruces 1997, p. 133).
32

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

285

Sin embargo, la mayora de los estudiosos de Crcidas ha considerado


HUUyQHDODDFHQWXDFLyQGHOSDSLUR\KDDSR\DGRODFRUUHFFLyQ
propuesta por August Mayer en 191135. Segn esta, Crcidas habr tenido en
su pecho un corazn que no se dejaba vencer por ninguna de las preoFXSDFLRQHV GH ORV GHYRUDGRUHV GH FDUQH JUDVLHQWD   
 GHPRGRTXHHOSRHPDHVWDUtDFHQtrado en un contraste entre el filsofo austero que se alimenta de lo estrictamente necesario y los devoradores compulsivos de carne grasienta
JHQSOGHODGMHWLYR 36. La interpretacin tiene la ventaja de asimilar la imagen cercidea al contraste ms general
entre la frugalidad filosfica y la incontinencia del hombre corriente37 pero,
como ocurra con la otra posicin, tambin ha sido objeto de crtica por su
FDUiFWHU~QLFR/DFRQVWUXFFLyQVLQWiFWLFDGHODGMHWLYRFRQXQUpJLmen en acusativo es, en efecto, inusual. El nico paralelo que suele aducirse
SDUDODFRQVWUXFFLyQHVHOIDPRVR

Sobre las diferentes interpretaciones de la potencia que hace que el hombre corriente cierre
los ojos cf. los comentarios de Livrea (1986, p. 102) y Lomiento (1993, p. 233). La tendencia mayoritaria reconoce en esa potencia las preocupaciones en general (Wilamowitz 1918,
p. 1150 = Kl. Schr. 142) y, ms concretamente, la desesperacin ante la muerte (Hunt 1911,
S6FKPLGWS%DUEHUS3HQQDFLQLS*LJDQWH
p. 289; Nachov 1973, p. 44; Livrea 1986, p. 102).
35
En Maas 1911b, col. 1215 n. 2.
36
 0H\HU  S  JORVy HO WpUPLQR FRPR      &I SRU
HMHPSORODVWUDGXFFLRQHVGH/LYUHDS LOGL&>HUFLGD@QRQqVWDWRRWWHnebrato da tutte le cure dei divoratori di carne grassa, citando a Haussleiter 1935, p. 181
Q   \ GH /RPLHQWR  S   XQ FXRUH LQPDUFHVFLELOH H LQYLWWR GDO WDUOR FKH URGH
glingordi di carni adiposa). Otros estudiosos que admiten la correccin de Mayer (Barber
 S  *LJDQWH  SS  V 5RFD )HUUHU  S   LQWHUSUHWDQ HO FRPSXHVWR
FRPRVHSXOFURVGHFDUQHJUDVDSHURHVWDDFHSFLyQGHHVWi
atestiguada solo a partir de Juvenal (X 172), es decir, varios siglos despus de Crcidas; cf.
los comentarios de Livrea (1986, p. 105) y Lomiento (1993, p. 236 n. 4).
37
La exaltacin de la propia frugalidad es coherente con la imagen que del poeta ofrece
*UHJRULRGH1DFLDQ]RHQDe uirt. 595-600 (PG XXXVII 723 = Cerc., fr. 66 Lomiento) como
alguien que come sal y escupe salado sobre la propia molicie. Esta semblanza fue pronto
interpretada como una evidencia de su filiacin cnica (Meineke 1863, p. 387), interpretacin
que hall su confirmacin en la subscriptio del POxy. 1082 (cf. supra nota 2). Con todo, puede
TXHHOFRPHQWDULRGH*UHJRULRWHQJDTXHYHUPiVTXHFRQVXSRHVtDFRQXQDDQWRORJtDFtQLFD
de versos colimbicos que circul en la Antigedad a nombre del poeta; cf. Knox 1930, p. 321
y Lpez Cruces 1995, pp. 33-35.
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

286

JUAN LUIS LPEZ CRUCES

GHODAntgona GH6yIRFOHV Y SHURHQ6yIRFOHVQRGHVHPSHxDODIXQFLyQGHDJHQWHFRPRHQ&pUFLGDVVLQRTXH


es el mbito donde Eros resulta invencible; dicho de otro modo, sera preocupante que el poeta fuera invencible en las preocupaciones de los devoradores
de carne grasienta del mismo modo que Eros es invencible en el combate38.
Adems, mientras que en el pasaje sofocleo el adjetivo verbal y su complePHQWRHVWiQMXQWRV  HQ&pUFLGDVVHHQFXHQWUDQELHQGLVWDQWHV
(     ), de modo que
su relacin quiz no fuera tan evidente en este caso como en el otro39.
Como vemos, las dos acentuaciones del trmino & tienen
sus pros y sus contras y en consecuencia, a falta de argumentos definitivos
que inclinen la balanza en uno u otro sentido, la cuestin debe quedar abierta. La caza potica de Antope puede haber influido, junto con el corazn
perruno de Odiseo, en la autopresentacin del poeta, pero la lectura de Antope por parte de Crcidas puede igualmente reforzar la correccin de Mayer, en la medida en que en la tragedia existe otro pasaje de la discusin
entre los hijos de la herona donde se plantea un rechazo de los hbitos alimenticios inmoderados. En el fr. 201 Kn, Anfin se defiende del ataque de
su hermano Zeto, quien le ha reprochado su caza de canciones, criticando a
los atletas Zeto, al parecer, lo es40 por tener un vientre insaciable:
38
La dificultad la ha sealado Williams 2002, p. 41 n. 5, quien, sin embargo, aduce un
contraste entre perros bien criados y aquellos otros alimentados a base de carne que refuerza la conjetura de Mayer. De aceptarse la correccin, no solo sera errnea la acentuacin
 VLQR WDPELpQ ODV PDUFDV GH VtODEDV EUHYHV HQ   DVt
Livrea 1986, p. X), de manera que el sintagma se entendera mejor como genitivo agente
sin preposicin que como acusativo de relacin (cf. las traducciones recogidas supra, nota
36). Ya Wilamowitz 1918, p. 1149 (= Kl. Schr. 141) consider problemtica la construccin
resultante de la conjetura de Mayer y por ello propuso una segunda correccin para sanar el
pasaje corregido (lo cual, aunque posible, no deja de ser cuestionable desde un punto de vista
PHWRGROyJLFR LQWHUSUHWDUORVVLJQRVGHVtODEDEUHYHGHFRPRXQDOHFWXUD
HUUyQHDGHGRVLRWDVVXSUDVFULWDV LH FRQORTXHUHVWLWXtDXQRVGDWLYRV
que solucionaban la dificultad sintctica. Su propuesta fue secundada por Haussleiter 1935,
p. 181, y por Diehl 19523, p. 147; tambin Frederick Williams se muestra partidario de ella.
39
A pesar de ello, la construccin es perfectamente posible; cf. la distancia considerable
que hay entre un nombre y su complemento determinante en E., Hyps. fr. 757, vv. 844 s.
.Q_ (Oh, proa y agua que la sal del mar
blanquea de Argo), una construccin poco frecuente.
40
Es lo que da a entender la pintura de una cratera de cliz de Apulia datada hacia 330 D & SRU7UHQGDOO  S  V 0HOERXUQH FROHFF GH *UDKDP *HGGHV$   TXH

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

287





Y, adems, cuantos para vigorizar las carnes
se pasan la vida ejercitndose, si les falta el dinero
resultan ser ciudadanos cobardes, pues el hombre acostumbrado
al incontinente hbito del vientre no tiene ms remedio que atenerse a l.

La crtica de Anfin forma parte de las muchas que en la Atenas clsica


se dirigieron contra los atletas por la especializacin de su ejercicio y por
su dieta rica en carnes, que los haca poco aptos para empuar las armas
en defensa de la ciudad41. Frente a l, es de suponer que Anfin comiese
con moderacin, al menos por lo que cabe deducir de la versin exagerada
del contraste entre los gemelos que ofreci decenios ms tarde Eubulo en
su Antope, donde presentaba a Zeto y Anfin, quiz como parodia del par
Calicles-Scrates del Gorgias platnico (cf. supra), como un atleta tragn y
un filsofo contemplativo que se alimenta de esperanzas42. As pues, este posible paralelo de Antope, de aceptarse, invitara a ampliar los trminos filosficos en que acostumbra a entenderse el contraste cercideo entre frugalidad
y alimentacin crnica43 para abarcar tambin la diferencia tradicional ya
est inspirada, directa o indirectamente, en la Antope de Eurpides. En ella vemos a Hermes
haciendo entrega a Anfin de la lira con su mano derecha, mientras que en su izquierda
VXMHWD SDUD HQWUHJiUVHORV D =HWR XQ  \ XQD HVWUHJDGHUD HV GHFLU HO LQVWUXPHQWDO
del atleta, perhaps to symbolise the difference between Amphions way of life and that of
Zethus (Trendall, ibd.).
41
 *DUFtD 5RPHUR  S  VV RIUHFH XQ HOHQFR GH ODV FUtWLFDV GH TXH IXHURQ REMHWR
los atletas por estos dos motivos.
42
Cf. Eub., fr. 9 K.-A.; Hunter 1983, p. 98: Zethus as a glutton is the comic counterpart
of Zethus as the man of action; Lpez Cruces 2003, pp. 24-27.
43
Haussleiter 1935, p. 181 y Livrea 1986, p. 105 s., postularon una ascendencia pitagrica
del contraste, que ha sido cuestionada por Lomiento 1988, p. 98 s. y 1993, p. 236 s. Esta
autora (tras Knox 1925, p. 50) ve aqu un ataque cnico ms contra la molicie; v. su anlisis
del alcance filosfico de la imagen de la caza y la pesca ibd., p. 239 s. Como ya hemos
avanzado (supra, nota 38), Williams 2002, p. 41, ha ofrecido otra interpretacin del contraste
FRPSOHPHQWDULDGHODILORVyILFD\FRKHUHQWHFRQHOOHQJXDMHFDQLQRTXHHOHVWXGLRVRKDGHtectado en la semblanza de la juventud del poeta; segn su propuesta, basada en numerosos
pasajes relativos a la alimentacin de los perros de caza, Crcidas se presenta a s mismo
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

288

JUAN LUIS LPEZ CRUCES

en la poca entre el filsofo, que se consagra al cultivo del intelecto y se


alimenta de lo preciso, y el atleta, que dedica su ejercitacin exclusivamente
al cuerpo y come carne grasienta de forma asidua. Por supuesto, este contraste Crcidas pudo conocerlo tambin a travs de otras fuentes anteriores
y posteriores a Eurpides; entre las anteriores destaca Jenfanes de Colofn
(fr. 2 West = Adrados) y, entre las posteriores, los filsofos cnicos, quienes
pudieron asimilar tanto las descalificaciones filosficas del atleta como las
teatrales. Por ejemplo, se cuenta que cuando le preguntaron a Digenes el
Cnico Por qu los atletas son lerdos?, respondi: Porque estn hechos
a base de carne de cerdo y de buey44, y tambin sabemos que el Cnico
asociaba la alimentacin crnica con la tirana, la corrupcin de la ciudad y
las guerras45.
En definitiva, los pasajes conservados del debate entre Anfin y Zeto en
el primer episodio de Antope no solucionan definitivamente el problema
textual cercideo: mientras que los frs. 187 y 198 Kn refuerzan el pleno dominio de la caza potica en el meliambo y, por tanto, la lectio 
el fr. 201 Kn constata un rechazo de la alimentacin excesiva y da peso a la
correccin 
IV. En la parte legible del meliambo III existen, pues, dos elementos que
pueden deberse, total o parcialmente, al influjo de la Antope de Eurpides: la

como un sabueso bien alimentado que lo caza todo, distinto de aquellos otros perros que, por
haber probado la carne, se vuelven perezosos.
44
Diog. CynIU*LDQQDQWRQL DS'/9, 

45
Porph., Abst. I 47, 15 ss.; Hieron., A. Iouin. ,, SDVDMHVQRUHFRJLGRVSRU*LDQQDQWRni), Iul., Or. IX (= VI) 16 p. 199a (= Diog. fr. 196); v. Haussleiter 1935, p. 171. Cf., adems,
RWUDVLQIRUPDFLRQHVVREUHHO&tQLFRHQIUV\*LDQQDQWRQL\VREUHWRGRTrGF 88
fr. dubium 6QHOO_
__(VWH
ltimo fragmento, as como el diognico dubium 7 Snell, han sido asignados conjeturalmente
por Lpez Cruces 2003 a una Antope cnica, donde se habran reelaborado episodios de la
tragedia homnima de Eurpides. En ella, para oponerse a la comparacin que en el Gorgias
platnico Calicles haba hecho de Scrates con Anfin (cf. supra), el autor cnico probablemente no se reconoca en el msico entregado a su placer particular (la msica), sino en su
hermano Zeto, en cuyos actos en parte de ellos, al menos pudo ver una prefiguracin
mtica de su propia filosofa y tambin del Scrates jenofonteo, sobre el cual cf. p. ej. X.,
Mem. ,\ORVGHPiVSDVDMHVHVWXGLDGRVSRU*RXOHW&D]p2, pp. 134-140.
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

289

caza potica (bastante seguro) y la defensa de la frugalidad y el rechazo de


la alimentacin excesiva (posible). De ser as, Crcidas habra integrado el
motivo alimenticio en un programa potico construido a partir de pasajes de
tres grandes poetas de la Antigedad: el pico Homero, que permite al poeta
presentarse como un perro al que nada bueno escapa; el lrico Pndaro, cuyo
poeta-labrador al servicio de las Musas se convierte en el poeta-cazadorpescador cercideo y, finalmente, el tragedigrafo Eurpides, con su msico
entregado a la caza de sus criaturas-creaciones poticas.
Y an existe un ltimo motivo que puede explicar el inters de Crcidas
por esta tragedia euripidea representada dos siglos antes. En ella Anfin, tras
la discusin con su hermano en el episodio I de la tragedia, demuestra que su
devocin por la msica no es obsesiva y que puede abandonarla en cualquier
momento para luchar por el bien comn46. Su actuacin acarrea la muerte de
la reina Dirce y est a punto de costarle la vida a Lico, el tirano, pero en tan
delicado momento interviene Hermes, quien desde los cielos impide el regicidio y proclama los mandatos de Zeus: los gemelos heredarn el trono de
Tebas, que legtimamente les corresponde. Mientras que Zeto recibe encomiendas de carcter militar, a Anfin se le ordena taer su lira para construir
las murallas de Tebas: las piedras y los rboles seguirn sus sones y se trabarn en una slida muralla47.
El Anfin euripideo es, por tanto, un msico que ejercer tareas de gobernante y erigir las murallas de su patria; pues bien, eso es prcticamente
lo mismo que puede decirse de Crcidas. Sabemos por Polibio que fue escogido por el estadista Arato de Sicione para actuar en 227 a. C. como
embajador de la liga aquea ante el rey macedonio Antgono Dosn (II 48) y
que en 222 a. C. fue general en la batalla de Selasia frente a las tropas del
espartano Clemenes III (II 65, 3). Tambin dio leyes a su patria: en el siglo I Ptolomeo Quenno lo presenta como legislador de los arcadios, en el
III Porfirio refiere una de sus leyes (orden que los nios en la escuela
aprendieran de memoria el Catlogo de las Naves de Homero) y en el VI

A partir del comentario de Hor., Epist. I 18, 41-44 (= fr. 182b, test. iii Kn), se acepta
que tras la discusin Anfin acceda a abandonar la msica y ceda a la peticin de su hermano
de marcharse a cazar.
47
 (XUIU.Q_>@  
_>@__
 
46

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

290

JUAN LUIS LPEZ CRUCES

Estfano de Bizancio informa de la excelencia de su labor legislativa48. No


podemos precisar con exactitud cundo tuvo lugar esta, pero de las fechas
que se han propuesto la ms razonable es el ao 217 a. C., tras los problemas
suscitados por la legislacin del peripattico Prtanis, datacin que ha sido
defendida por Donald R. Dudley con varios argumentos que le confieren una
gran plausibilidad49. Cuenta Polibio (V 93) que la legislacin encargada al
peripattico Prtanis no logr solucionar la divisin de la ciudadana en dos
bloques enfrentados durante los aos que siguieron a la batalla de Selasia.
Unos megalopolitas reclamaban la reduccin del permetro de la ciudad y la
cesin por parte de los terratenientes de un tercio de sus posesiones para
poder emprender la reconstruccin50; los otros, claro est, se negaban. Al
final Arato de Sicione, el dirigente de la liga aquea que haba empleado a
Crcidas como embajador aos antes, medi entre ambos bandos, y no sera
de extraar que para ello hubiese vuelto a confiar en su amigo megalopolita.
Seguramente la solucin hubo de ser la cesin de tierras, porque los datos
arqueolgicos evidencian y esto es lo importante que el contorno de las
murallas no se redujo, sino que se rehzo51. Si, como parece, esta datacin
Cf. Ptol. Chenn. ap. Phot., Bibl. FDS ,,,SV+HQU\ 
           3RUSK IU 
Smith (ap. Eust., in Hom., Il. ,,  >,   YDQ GHU9DON@     

 &XSHU  PVV prob. 6PLWK     6W %\] V X 
          6REUH HVWRV WHVWLPRnios v. Lpez Cruces 1995, pp. 10-15, 26-29, 35 s. y, en concreto sobre el pasaje de Porfirio,
Williams 1984, pp. 351-354.
49
Dudley 1937, p. 92 s. Los argumentos son: primero, Polibio nicamente habla de una
legislacin en Megalpolis a propsito de este momento; segundo, no parece imaginable la
elaboracin de una legislacin despus de que Lidadas pusiera fin a su tirana en 235 a. C.,
ya que este personaje sigui ejerciendo una notable influencia en los asuntos polticos de la
ciudad hasta su muerte; tercero, si, como sabemos por Estfano de Bizancio, la legislacin
de Crcidas fue exitosa, solo pudo tener lugar tras el fracaso de la legislacin de Prtanis;
\ FXDUWR$UDWR   GH &pUFLGDV GHELy GH SHQVDU HQ VX DPLJR SDUD DUUHJODU ODV
disensiones de los megalopolitas.
50
Cf. 3OE 9           


51
Cf. Loring 1892, p. 114 y tambin Petronotis 1973, p. 68 s., quien considera que para
proceder a la reconstruccin de las murallas hubo de existir una legislacin (que l atribuye
al peripattico Prtanis, quiz con la colaboracin de Crcidas).
48

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

291

es la correcta, puede que nuestro poeta haya influido en la conservacin y


reconstruccin de las murallas de su patria.
En resumen, Crcidas, autor de canciones52, legislador y probablemente impulsor de la reconstruccin de las murallas de Megalpolis, bien pudo
reconocer en el mtico Anfin la prefiguracin de su propia actividad poltica
y musical, lo que explicara por qu al componer el meliambo III, de marcado carcter autobiogrfico, tuvo presente la famosa tragedia euripidea que
dos siglos atrs haba supuesto la consagracin del msico, rey y constructor
mtico de las murallas de Tebas53.

BIBLIOGRAFA
$UULJKHWWL *  Poeti, eruditi e biografi. Momenti della reflessione dei Greci
sulla letteratura, Pisa.
Barber, E. A., 1921: Cercidas, en Powell, J. U. y Barber, E. A. (eds.), New Chapters in the History of Greek Literature, Oxford, pp. 1-12.

El gramtico Heladio (s. IV) lo llama  HQ VX Crestomata (ap. Phot., Bibl.
cap. 279, t. VIII p. 180 Henry). Entre los estudiosos de Crcidas, unos han concebido los
meliambos como un gnero destinado a la recitacin, incluso a la lectura, mientras que otros
lo entendemos mejor destinado al canto; cf. un estado de la cuestin en Lpez Cruces 1995,
pp. 195-199, de quien destaco los siguientes argumentos en favor de la destinacin de los
meliambos al canto: primero, en esta poca se cantan textos trgicos y cmicos destinados en
origen a la recitacin, lo que permite pensar que Crcidas ha adaptado la herencia ymbica de
sus poesas a la cancin; segundo, Polibio, contemporneo joven de Crcidas y compatriota
suyo, explica (IV 20.4 ss.) que para los arcadios Crcidas y Polibio lo eran la msica no
era una disciplina educativa ms, sino una verdadera obligacin.
53
Eurpides es el nico de los tres grandes tragedigrafos que seleccion un episodio
de la vida del msico con final feliz, pues tanto Esquilo como Sfocles haban llevado a la
escena sendas Nobes sobre el triste destino de Nobe tras la muerte de su esposo Anfin y de
los hijos de ambos. De acuerdo con nuestra documentacin, no fueron muchos los msicos
que tuvieron un papel principal en las tragedias de poca clsica; adems de Anfin, destacan
Orfeo (Esquilo haba tratado su muerte en Las Basrides y quiz el Orfeo de Aristias fue
una tragedia y no un drama satrico) y Tmiris (Sfocles haba dedicado su Tmiras al triste
destino del msico que os enfrentarse a las Musas y puede que Esquilo tambin lo tratara
en una tragedia perdida); cf. Lpez Cruces 2007 sobre el contraste entre Anfin y estos dos
msicos y Taplin 2007, pp. 248-250, sobre una pintura de posible inspiracin teatral en una
vasija de Apulia (ca 330 a. C.) que quiz representa a Anfin taendo la lira ante Tntalo,
rey de Lidia y padre de Nobe, su futura esposa.
52

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

292

JUAN LUIS LPEZ CRUCES

%iUEHUL6TXDURWWL*/DUHWHPRUWDOH&DFFLDHFDFFLDWRUHQHOOHWUDJHGLHGL
Euripide, Caltanisetta-Roma.
Campos Daroca, J. y Lpez Cruces, J. L. 1992: Crcidas sobre la creacin potica
(mel. III Livrea), Emerita LX 1, pp. 21-29.
&ROODUG& HG $QWLRSHHQ&ROODUG& &URSS 0 - \ *LEHUW- HGV 
Euripides. Selected Fragmentary Plays, vol. II, Oxford, pp. 259-329.
Croiset, M., 1911: Kerkidas de Mgalopolis, JS n.s. 9, pp. 481-493.
Cusset, Chr. 1997: La Muse dans la Bibliothque. Rcriture et intertextualit dans
la posie alexandrine, Pars.
Diehl, E. (ed.) 19523: Anthologia Lyrica Graeca, vol. III, Lipsia.
Dudley, D. R. 1937: A History of Cynicism from Diogenes to the 6th Century AD,
Londres (diversas reimpresiones).
)UDFFDUROL*UHFHQVLyQGHThe Oxyrhynchus Papyri, vol. VIII, en RFIC 40,
pp. 124-129.
*DUFtD5RPHUR)Los Juegos Olmpicos y el deporte en Grecia, Sabadell.
*LJDQWH0&HUFLGD)LORGHPRH2UD]LRRFIC 33, pp. 286-293 (reimpr. en
Ricerche filodemee, Npoles, 19832, pp. 235-243).
*RXOHW&D]p022 : /DVFqVHF\QLTXH8QFRPPHQWDLUHGH'LRJqQH/DsUFH
VI 70-71, Pars.
Haussleiter, J. 1935: Der Vegetarismus in der Antike, Berln.
Hunt, A. S. (ed.) 1911: POxy. 1082: Cercidas, Meliambi, The Oxyrhynchus Papyri,
vol. VIII, Londres, pp. 20-59.
Hunter, R. L. (ed.) 1983: Eubulus. The Fragments, Cambridge.
Joly, R. 1956: /HWKqPHSKLORVRSKLTXHGHVJHQUHVGHYLHGDQVO$QWLTXLWp&ODVVLTXH
Bruselas.
Kambitsis, J. (ed.) 1972: /$QWLRSH G(XULSLGH eGLWLRQ FRPPHQWpH GHV IUDJPHQWV
Atenas.
Kannicht, R. (ed.) 2004: Tragicorum Graecorum Fragmenta, vol. 5: Euripides,
*RWLQJD
Knox, A. D. (ed.) 1923: The First Greek Anthologist. With Notes on some Choliambic
Fragments, Cambridge.
Knox, A. D. 1925: The Kerkidas Papyrus II, CR 39, pp. 50-55.
Knox, A. D. 1930: recensin de F. Jung, Hipponax redivivus, en Gnomon 6, pp. 321-324.
Lens, J. 1990: Cercidas, fr. III Livrea, Flor. Ilib. 1, p. 211.
Livrea, E. (ed.) 1986: Studi Cercidei (P.Oxy. 1082), Bonn.
Livrea, E. 1997: Callimachus senex, Cercidas senex ed i loro critici, ZPE 119,
pp. 37-42.
Livrea, E. 2007: La vecchaia su papiro. Saffo, Simonide, Callimaco, Cercida, en
%DVWLDQLQL*\&DVDQRYD$ HGV I papiri di Saffo e di Alceo. Atti del convegno
internazionale di studi. Firenze 8-9 giugno 2006, Florencia, pp. 67-81.
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

CRCIDAS Y LA ANTOPE DE EURPIDES

293

Lomiento, L. 1988: Cercida, fr. 3 Livrea: problemi di interpretazione testuale e


metrica, 48&& n.s. 29, pp. 95-109.
Lomiento, L. (ed.) 1993: Cercidas. Testimonia et fragmenta, Roma.
Lomiento, L. 1996: Pindaro, Nem. 6, 32 e Cercida, Mel. 3, 7: itinerario di due
metafore, 48&& 54, pp. 67-71.
Lpez Cruces, J. L. 1995: Cercidas de Mgalopolis. Politique et tradition littraire,
msterdam.
Lpez Cruces, J. L. 1997: Procedimientos fnicos en el poeta ymbico Crcidas
de Megalpolis, en Adrados, F. R. y Martnez Dez, A. (eds.), Actas del IX
Congreso Espaol de Estudios Clsicos (Madrid, 27-30 de septiembre de 1995),
vol. I, Madrid, pp. 131-135.
Lpez Cruces, J. L. 2003: Une Antiope cynique?, Prometheus 29, pp. 17-36.
Lpez Cruces, J. L. 2007: Eurpides msico: Antope y la reescritura de los mitos
PXVLFDOHV HQ &DPSRV 'DURFD ) - *DUFtD *RQ]iOH] ) - /ySH] &UXFHV -
L. y Romero Mariscal, L. P. (eds.), Las personas de Eurpides, msterdam,
pp. 3-37.
Lpez Cruces, J. L. y Campos Daroca, J. 1994: The Metre of Cercidas, ZPE 102,
pp. 81-94.
/RULQJ:7RZQ+DOOVDQG,QWHUQDO7RSRJUDSK\HQ*DUGQHU($/RULQJ
:5LFKDUGV*&\:RRGKRXVH:-Excavations at Megalopolis, Londres,
pp. 106-121.
0DDV 3 D &HUFLGDH F\QLFL PHOLDPEL QXSHU LQYHQWL  LQVWUXFWL
BPhW 32, pp. 1011-1016.
Maas, P. 1911b: recensin de The Oxyrhynchus Papyri, vol. VIII, en BPhW 39,
1214-1217.
0F1DPHH .  *UHHN /LWHUDU\ 3DS\UL 5HYLVHG E\7ZR RU 0RUH +DQGV HQ
%DJQDOO56%URZQH*0+DQVRQ$(\.RHQHQ/ HGV Proceedings
of the 16th International Congress of Papyrology (New York, 24-31 July 1980),
Chico, pp. 79-91.
Meineke, A. 1863: Miscellanea (nr. 68): Ein Fragment des Kerkidas aus Megalopolis, JKlPh 87, p. 387.
0H\HU*Die stilistische Verwendung der Nominalkomposition im Griechischen, Leipzig.
Nachov, I. M. 1973: La poesa de la protesta y la clera (Stades, Fnix, Crcidas),
VKF 5, pp. 5-67 (en ruso).
Onians, R. B. 19862: The Origins of European Thought: About the Body, the Mind,
the Soul, the World, Time and Fate, Cambridge.
Paquet, L. (trad.) 19882 >1@ Les Cyniques Grecs. Fragments et Tmoignages,
Ottawa.
3DVTXDOL*Orazio Lirico, Florencia.
Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

294

JUAN LUIS LPEZ CRUCES

Pennacini, A. 1955-1956: Cercida e il secondo cinismo, AAT 90, pp. 257-283.


Petronotis, A. 1973: Atenas.
Roca Ferrer, J. 1974: Kyniks trpos. Cinismo y subversin literaria en la Antigedad, Barcelona.
5RVH*32G\VVHXV%DUNLQJ+HDUWTAPhA 109, pp. 215-230.
Russo, J. 1968: Homer Against his Tradition, Arion 7, pp. 275-295.
Schaal, H. 1914: De Euripidis Antiopa, Tesis Doctoral, Berln.
Schmidt, K. F. W. 1912: recensin de The Oxyrhynchus Papyri, vol. VIII, en GGA
11, pp. 634-641.
Snell, B. 1964: Vita Activa and Vita Contemplativa in Euripides Antiope, Scenes
from Greek Drama, Berkeley-Los ngeles, pp. 70-98 (versin alemana, Szenen
aus griechischen Drama, Berln, 1971, pp. 76-103).
Steinrck, M. 2009: Der neue Iambos. Studien zu den Formwegen eines griechischen
Diskurses im Hellenismus und der Kaiserzeit, Hildesheim-Zrich-Nueva York.
Taplin, O. 2007: Pots & Plays. Interactions between Tragedy and Greek VasePainting of the Fourth Century B.C., Los ngeles.
Trendall, A. D. 1986: Two Apulian Calyx-Kraters with Representations of Amphion
and Zethos, en Enthousiasmos. Essays of Greek and related Pottery presented
to Jaap M. Hemelrijk, msterdam, pp. 157-166.
Webster, T. B. L. 1964: Hellenistic Poetry and Art, Londres.
White, H. 1998: recensin de Lomiento, Cercidas (cit. supra), en Myrtia 13, pp. 247249.
Wilamowitz-Mllendorff, U. von, 1918: Kerkidas, SBBerl, pp. 1138-1164 (=
Kleine Schriften, tomo II, Berln, 1941, pp. 128-159).
Williams, F. 1984: Two Notes on Cercidas of Megalopolis, en Apophoreta Philologica Emmanueli Fernndez-Galiano a sodalibus oblata (= ECls XXVI 87),
Madrid, pp. 351-357.
Williams, F. 2002: Cercidas fr. 3 Liv.: Canine Language in a Cynic Poet?, ZPE
139, pp. 40-42.

Fecha de recepcin de la primera versin del artculo: 04/05/2011


Fecha de aceptacin: 09/07/2012
Fecha de recepcin de la versin definitiva: 10/07/2012

Emerita LXXX 2, 2012, pp. 275-294

ISSN 0013-6662

doi: 10.3989/emerita.2012.14.1111

EMERITA, Revista de Lingstica y Filologa Clsica


/;;; SS
,661 GRLHPHULWD

Heraclitus, DK 22 B44 (frg. 103, Marcovich)


Tom Vtek
The Institute of Philosophy, Prague
tomas.vitek7@gmail.com

Herclito, DK 22 B44 (frg. 103, Marcovich)


The authenticity of Heraclitus fragment B 44 can
be doubted on account of the following reasons:
1. stylistic and syntactic anomalies (problemaWLFDO DUWLFOHV D VWUDQJH ORRNLQJ LQVHUWLRQ RI 
 DVLPLODULW\EHWZHHQ%DQG
%  GXSOLFDWLRQ RI WKH VDPH PHWDSKRU   DQ
incongruity between the message of B 44 and HeUDFOLWXV YLHZV  DQDFKURQLVWLF PHDQLQJ RI WKH
WHUPZKLFKFRXOGQRWUHIHUWRDODZLQ+HUDFOLWXVOLIHWLPHDQDQDORJ\ZLWKWULYLDOJQRPLF
ZLVGRPDQDQDORJ\ZLWK+HUDFOLWHDQIDOVDLQD
PRUDOLVWLFVSLULWDFRQQHFWLRQRI%ZLWK%
that are not found anywhere else. These objections
do not exclude the authenticity of the fragment,
but its defenders should neutralize them with some
strong arguments.

La autenticidad del fragmento B 44 de Herclito


puede ser cuestionada por los siguientes motivos:
1. anomalas estilsticas y sintcticas (artculos
SUREOHPiWLFRVXQDH[WUDxDLQVHUFLyQGH
VHPHMDQ]DHQWUH%\% GXSOLFDFLyQGHODPLVPDPHWiIRUD LQFRQJUXHQFLD
entre el mensaje of B 44 y las posiciones de HerFOLWRVLJQLFDGRDQDFUyQLFRGHOWpUPLQR
que no poda hacer referencia a una ley en tiempos
GH+HUiFOLWRDQDORJtDFRQODVDELGXUtDJQyPLFD
WySLFDDQDORJtDFRQORVfalsa heracliteos de teQRUPRUDOL]DQWHH[LVWHQFLDGHXQDFRQH[LyQGH
%FRQ%TXHQRVHHQFXHQWUDHQQLQJ~QRWUR
lugar. Semejantes objeciones no excluyen la autenticidad del fragmento, pero sus defensores debieran contrarrestarlos con argumentaciones slidas.

Key words+HUDFOLWXV*UHHNSKLORVRSK\
JKWJQRPLFZLVGRP

Palabras clave+HUiFOLWRORVRItDJULHJD
OXFKDVDELGXUtDJQyPLFD

Almost all scholars accept the text referred to in Dielss edition of Heraclitus
fragments as B 44 as authentic. And yet, though the number of experts who
reject its authenticity is extremely small1, various pieces of evidence put this
text under a cloud of suspicion. This articles author will try to highlight and
further support the position of the sceptics. The aim, however, is not to relegate
this fragment among the falsa but rather to provide the advocates of its authenticity with an opportunity to refute the introduced objections. Many scholars
1
 6FKZDU]S'HLFKJUlEHUSS5RVpQSS9tWHN
S

 

72097(.

seem to support the authenticity of B 44 by default rather than on basis of a


thorough analysis of arguments for and against it. Another, in a way subsidiary
aim of this article is to point to certain inconsistencies in the treatment of fragments that are generally accepted as true or false.
These are the objections can be raised against the authenticity of B 44:
1.

Stylistic and syntactic anomalies

In most manuscripts, the text appears in the following form:


     1      

7KHSHRSOHPXVWJKWIRUWKHODZIRUWKDWZKLFKQRZH[LVWV " DVIRU
their city-wall.
PVV0DUFRYLFK  0DQVIHOG PHWULJUDWLD >@6FKOHLHUPDFKHU /DVVDOOH 0XOODFK =HOOHU  1HVWOH __     %31FD (teste Marcovich
 9ROOJUDII  %ROODFN  &RQFKH) WHVWH%\ZDWHU 
'LHOV FVSDSSFULW DK0RXUDYLHY  
*DUFtD&DOYR>@%ROODFN  RPLVHUXQW3Q et Frobeniana
 VHFOXVHUXQWXWGLWWRJUDSKLDP6FKOHLHUPDFKHU/DVVDOOH0XOODFK=HOOHU 1HVWOH6QHOO
3DWULFN S 'LHOV FVS %XUQHW:DO]HU-RQHV.DKQ0DUFRYLFK  5RELQVRQ0DQVIHOG'LDQR 6HUUD&ROOL0RQGROIR 7DUiQ 0DUFRYLFKHWDOLL__
%3)'6FKOHLHUPDFKHU/DVVDOOH0XOODFK=HOOHU 1HVWOH%\ZDWHU3DWULFN S 9ROOJUDII  /RQJ%ROODFN :LVVPDQ.DKQ&RQFKHHWDOLL:0HLQHNH WHVWH'LHOV
 'LHOV6QHOO.LUN 5DYHQ0DUFRYLFK5RELQVRQ0DQVIHOG&ROOL*DUFtD&DOYR0DUFRYLFK 0RQGROIR 7DUiQ0RXUDYLHY  HWDOLL

7KHUVWFRQVSLFXRXVIHDWXUHWKDWPD\FDWFKRXUH\HVDUHWKHDUWLFOHVIURQWLQJ DQGVWDQGLQJLQFRQWUDVWZLWKZKHUHWKHDUWLFOHLV
omitted. In anyone elses writing, such irregularity would not be problematic
but Heraclitus treated articles with parsimony and plenty of consideration.
2QO\DERXWRQHWKLUGRIH[WDQWIUDJPHQWV LHDSSUR[LPDWHO\RIWKHP FRQtain an article, and in most cases it plays some important grammatical or semantic function (such as expressing opposition, fronting participles, endowing
ZRUGVZLWKDGLIIHUHQWPHDQLQJRUHPSKDVLVLQJWKHPHDQLQJRIDZRUG . Most
scholars accept that articles in this fragment fall into this category. Those who
 )RUPRUHRQWKLVSRLQWVHH9tWHNSS
Cf. Bollack SDQGHVSHFLDOO\0RXUDYLHY ,,,%LL S WKHDUWLFOH
fronting should be understood in the sense of ce peuple, i.e., the people of Ephesus,
ZKLOHWKHDUWLFOHLQIURQWRILVLQGLYLGXDOLVLQJLQWKHVHQVHRIODORLGHODFLWp 



(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



are not content to believe that Heraclitus ascribed the same value to law
DQGSHRSOH VHHSRLQW PD\FKRVHWRH[SODLQWKHSUHVHQFHRIDUWLFOHVDVD
consequence of: a LQGLUHFWVSHHFKXVHGLQUHWHOOLQJWKHVWDWHPHQWb VW\OLVWLF
DQG PHWULF PRGLFDWLRQV c  ODWHU FKDQJHV E\ RWKHU DXWKRUV VRPH RI ZKRP
LQFOXGHWKHDUWLFOHZKLOHRWKHUVGRQRW FI%%%%DQGRWKHUV 
d LQDXWKHQWLFLW\RIWKHIUDJPHQWRUVRPHRILWVSDUWV FIIRUH[DPSOH%D 
,QWKHFDVHRI%WKHUVWRSWLRQPD\EHZRUWKIXUWKHUFRQVLGHUDWLRQEHFDXVHRIWKHLQWURGXFWRU\ VHHSRLQW $GYRFDWHVRIDXWKHQWLFLW\UHMHFW
WKLVRSWLRQXVXDOO\ZLWKUHIHUHQFHWRWKHSUHVHQFHRI7KHVHFRQGRSWLRQ
does not seem too plausible because stylistic reasons seem to be absent and it
is still doubtful whether the statement has a metric form at all: Diels and Marcovich claim to recognise a iambic trimeter in the text but only after making
changes to its wording, and even so they cannot support the assumed measurement with convincing reasons4. The third option cannot be assessed due to
lack of other sources but even so it has its proponents5. The fourth option also
remains open since Diogenes Laertius, who only quotes the B 44, belongs to
authors convicted of inserting inauthentic additions into Heraclitus texts. It
LVDOPRVWFHUWDLQWKDWKHLQVHUWHGWKHSKUDVH
LQWR%VLQFHQRRWKHUDXWKRULQFOXGHVLWDVDSDUWRIWKLVIUDJPHQW6LPLODUO\LQ%'LRJHQHVLQFOXGHVWKHZRUGV
which some scholars believe to be an inauthentic addition and a reason to
doubt the entire fragment.
,Q%ZHDOVRQGDVWUDQJHORRNLQJLQVHUWLRQRI
nowadays usually removed from the text even by most scholars who are conYLQFHGRIWKHIUDJPHQWVDXWKHQWLFLW\ VHHDSSFULW :KDWLVSUREOHPDWLFKHUH
is not the article itself but rather the meaning of the insertion within the statement as a whole. Though this predicament may be to some degree disguised by
a suitably interpretative translation, one may well ask: a ZK\VKRXOGSHRSOH
 %ROODFNSQLVFULWLFDORQWKLVSRLQW&I'LHOV )96 S DSSFULW
DGO 9HUPXWOLFKOHFWHPGLH%HDFKWXQJYHUGLHQW0DUFKRYLFK
S
5
 $UWLFOHLQIURQWRILVRPLWWHGE\6FKOHLHUPDFKHUSDQG0XOODFK
S

 6FKOHLHUPDFKHUS/DVVDOOHSQ*RPSHU]S=HOOHU
S'LHOVS&RUVVHQSS.UDQ]SS&ROOL
S9tWHNS

 %ROODFNS/RLSRXUFHOOHTXLVHIDLW%ROODFNSOHVFLWR\HQVVH
FUDPSRQQHQWDX[ORLVH[LVWDQWHV&RQFKHSSORLSRXUFHOOHTXLH[LVWH
4

(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

JKW RQO\ IRUDODZWKDWHPHUJHVRULVDQGQRWIRURQHWKDWLVDOUHDG\LQ


H[LVWHQFH"b ZK\VKRXOGDQHPHUJLQJODZRQHWKDWLVFHUWDLQO\QRW\HWYHU\
VROLGDQGZULWWHQLQVWRQHEHOLNHQHGWRDFLW\ZDOODV\PERORIUPQHVVDQG
VWDELOLW\"c ZK\ZRXOGDQDXWKRUNQRZQWREHH[WUHPHO\SLWK\LQKLVH[SUHVVLRQLQFOXGHDQLQVHUWLRQWKDWQHLWKHUFODULHVVSHFLHVRUDGGVGHSWKWRWKH
PHVVDJHRIKLVVWDWHPHQW"7KHVHGRXEWVFDQQRWEHIXOO\UHPRYHGE\YDULRXV
FRQMHFWXUHVVLQFHWKRVHHLWKHUUHGXSOLFDWHZKDWZDVDOUHDG\VDLG 0RXUDYLHY 
RUVD\WKHVDPHWKLQJLQDVOLJKWO\GLIIHUHQWZD\ %ROODFN*DUFtD&DOYR 
 Duplication of the main metaphor
$ VWURQJ DQDORJ\ ZLWK %  LV IRXQG LQ WKH UVW SDUW RI %  ZKHUH LW LV
demanded that those who speak with reason must lean on what is common
WRDOODVDFLW\OHDQVRQODZ 
 7KLVUHVHPEODQFHKRZHYHUGRHVQRWVXSSRUW
the authenticity of B 44 since comparison with B 114 reveals just how much
WKHPHWDSKRUZDVDWWHQHGDQGVLPSOLHG,QRQHWH[WWKHDELOLW\WRVSHDNZLWK
UHDVRQLVGHVFULEHGDVIRXQGHGRQDFRVPLFZKLFKLVVKDUHGE\DOOMXVW
OLNHWKHODZVRIDFRPPXQLW\WKLVDPRQJRWKHUWKLQJVOHQGVWRWKHD
GLPHQVLRQRIDODZDQGWRWKHODZVRIDFRPPXQLW\DGLPHQVLRQRI
ZKLOHLQWKHRWKHUWH[WZHQGEXWDUDWKHUWULWHDSSHDOWRJKWIRUWKHREVHUYance of laws, hardly implying some potential deeper meanings or connections.
Duplication of a metaphor is not rare in the corpus of Heraclitus sayings,
and for the most part, it is tacitly accepted as one of the peculiarities of his
style. Even so, it is noteworthy that many of the fragments that are often suspected of inauthenticity share this particular feature. For example B 4, where
KDSSLQHVVEDVHGRQERGLO\SOHDVXUHVLVFRPSDUHGWRWKHMR\RIR[HQQGLQJ
DYHWFKORRNVOLNHDDWWHUDQGVNHZHGYDULDWLRQRI% $VVHVSUHIHUVWUDZ
WRJROG DQGRI% 3LJV delight in the mire more WKDQLQFOHDQZDWHU .
ODORLTXLHVWVDORLDQGODORLWHOOHTXHOOHH[LVWH9ROOJUDIISSHYHQ
LQWHUSUHWHGLQWKHVHQVHRIRQHRXJKWWRLWEHKRYHV RSRUWHW  DQGDV
WKHVXPRIKXPDQDQGGLYLQHODZ SRSXOXPLXVDFIDVLQVWDUPXULWXHULRSRUWHW *DUFtD&DOYR
SSLQKLVH[SOLFDWLRQODOH\SRUODELHQRUGHQDGDDOPHQRVWDNHVDVLPLODU
OLQH'LDQR 6HUUDSDQG0RXUDYLHY ,,,%LLL SSRLQWRXWWKDWWKHWH[W
LQLWVXQPRGLHGIRUPLVDOPRVWXQWHQDEOHDQGYHU\GLIFXOWWRWUDQVODWH

B 4 is rejected or left out by Schleiermacher, Lassalle, Mullach, Schuster, Bywater,
:KHHOZULJKW0DUFRYLFKS%ROODFN :LVPDQQ SRLQWLQJRXWLWLVDSDUDSKUDVHRI
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



Albertus clearly violated the logic of the original saying, which demonstrated
the relativity of values using an example of a choice between gold and straw, in
order to somewhat obviously emphasise the similarity between a person seeking bodily pleasures and an ox coveting a vetch. Another metaphoric doublet,
% 6ZLQHZDVKLQWKHPLUHDQGEDUQ\DUGIRZOVLQGXVW WRRORRNVOLNH
DQLQIHULRUSHULSKUDVHRI%6LPLODUO\IUDJPHQW% 6RXOVVODLQLQ
EDWWOHVE\$UHVDUHSXUHUWKDQVRXOVVODLQE\LOOQHVV ZKLFKLVXVXDOO\UHMHFWHG
as inauthentic, seems to be a later rendition or a simplifying explanation of
WKHSURYRFDWLYHVWDWHPHQWRI%DFFRUGLQJWRZKLFKJRGVDQGPHQKRQRXU
those who are slain by Ares. Likewise, the claim that the wisest of men, in
FRQWUDVWWR*RGDSSHDUVDVDQDSHLQZLVGRPDQGEHDXW\DQGDOOWKLQJV % 
EHDUVDVWULNLQJUHVHPEODQFHWR%DFFRUGLQJWRZKLFKWKHPRVWKDQGVRPH
of apes is ugly in comparison with a human. In this case, too, syntactic amELJXLW\DQGWHUVHQHVVRIH[SUHVVLRQIDYRXU%DVDPRGHOEXWLWSRVVLEOHWKDW
ERWK%DQG%LPLWDWHDQRWKHUVLPLODUVWDWHPHQW11.
1RW DOO UHXVHG PHWDSKRUV GLVSOD\ VXFK FRQVSLFXRXV VLPSOLFDWLRQ RI RU
deviation from elaborate polysemy of a hypothetical original. Statements
ZH VWHS DQG GR QRW VWHS LQWR WKH VDPH ULYHUV % D  DQG LW LV QRW SRVVLEOHWRVWHSWZLFHLQWRWKHVDPHULYHU % ZHUHLQDOOSUREDELOLW\EDVHG
RQ%ZKHUHLWLVVDLGWKDWRQWKRVHZKRHQWHUWKHVDPHULYHUVHYHUGLIIHUHQW ZDWHUV RZ %  HPSKDVLVHV WKH FRQFXUUHQW LGHQWLW\ DQG ODFN RI
%DQGHVSHFLDOO\RI% .LUN&ROOLDQG3UDGHDX.DKQDQG5RELQVRQWUHDWLWZLWKVHULRXV
reservations.

 &IVHFRQGSDUWRI%ZKHUHRUGLQDU\SHRSOHDUHJOXWWHGOLNHEHDVWV 7KLVIUDJPHQW
LVVHHQDVDSRVVLEOHLQVSLUDWLRQRUVXSSRUWE\*LJRQS)UlQNHOSDQG
*XWKULHS %\ZDWHUSS.LUNSSDQG0DUFRYLFK
SSRLQWWRDIDXOW\ORJLFRIUHSURGXFWLRQDQGVWDWHPHQWVTXDVLWKHRORJLFDOVODQWEXWQRWDOO
RIWKHPVHHLWDVDVXIFLHQWUHDVRQIRUUHMHFWLQJWKHIUDJPHQWVDXWKHQWLFLW\DOWRJHWKHU %\ZDWHU 

Older scholars usually did not include the statement transmitted by Columella in their
HGLWLRQV 6FKOHLHUPDFKHU 0XOODFK 6FKXVWHU /DVVDOOH  DPRQJ WKH PRUH UHFHQW HGLWRUV LW LV
H[SOLFLWO\UHMHFWHGHJE\.LUNSS%ROODFN :LVPDQQSS
.DKQSDQG5RELQVRQS ZLWKKHVLWDWLRQ 
11
Scholars often reject the authenticity of the wording of both fragments (see already BerQD\VSS EXWXVXDOO\SUHVXSSRVHDFRPPRQVRXUFH PDLQO\%FI)UlQNHO
SS  0DUFRYLFK  SS  %ROODFN  :LVPDQQ  SS  .DKQ
S5RELQVRQS 2WKHUVHYHQWULHGWRUHFRQVWUXFWVXFKDVRXUFHIURPWKH
WZRVWDWHPHQWV 0RXUDYLHY,,,%LS 

 0XOODFK  ,  *LJRQ  SS  .LUN  SS  0DUFRYLFK
S.DKQSSQ'LOFKHUSSSDUWO\DOVR*XWKULH
(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

LGHQWLW\RIDULYHUDQGLWVZDWHUVZKLOH%DDQG%IRFXVRQWKHREVHUYHU
who steps into a river and cannot achieve identity. Yet it would be hard to
turn this into a convincing case against the authenticity of these statements
since they may be seen as presenting different views of the problem. Somewhat unclear is also the situation of the maxim that thought is common to
DOO % :KLOHDWUVWJODQFHLWUHVHPEOHVDVLPSOLHGH[FHUSWIURP%
ZKHUHDFRPPRQLVFRQWUDVWHGZLWKWKDWLVWKLQNLQJRI
>RQHV@RZQ RUGHSHQGLQJRQWUDQVODWLRQSULYDWHLQWHOOLJHQFH 14, it also
opens new avenues of interpretation, e.g., the question whether really everyone, including animals, plants, and things take some part in thinking15.
Accordingly, the existence of such semantic and metaphorical doublets
FRXOGEHH[SODLQHGLQYDULRXVZD\V6RPHWLPHV  WKH\PD\KDYHEHHQFUHDted unwittingly, for example, when an author intended to reproduce the origiQDOEXWGLGQRWUHFDOOWKHZRUGLQJFRUUHFWO\,QRWKHUFDVHV  RQHFDQDVVXPH
that some authors intentionally created a new variant which they saw as better
suited in a particular context. At other times, creation of a new version of Heraclitus saying may have resulted from doxographerss aim to think in Heraclitean spirit or to develop his claims further (this suspicion is relevant especially
WRWKH6WRLFV $QGQDOO\  LWLVSRVVLEOHWKDW+HUDFOLWXVKLPVHOIUHSHDWHG
and amended his own thoughts and images. In the case of some fragments,
this may well be defensible but if one of the two similar versions is notably
dull and inferior, it may be advisable to place such a statement in the previous
two groups rather than take recourse to constructing elaborate apologies and
suppose that Heraclitus was not always in top shape.
 Incongruity between the statement and Heraclitus views
5DWKHUVXVSLFLRXVIHDWXUHRI%LVWKHSRVLWLYHHPSKDVLVRQSHRSOH 
whom Heraclitus usually treated with disgusted loathing, speaking of them
 SS   %  LV D ODWHSDUDSKUDVHRI% DQGVDPHSUREDEO\KROGVRIWKH
VHFRQGSDUWRI%DWKRXJK+HUDFOLWXVPD\KDYHH[SUHVVHGWKHVDPHWKRXJKWVHYHUDOWLPHVLQ
GLIIHUHQWZD\V 

 &IHJ5HLQKDUGWSSRU6QHOOSS)RUDFULWLFDOYLHZVHH
'LOFKHUSS
14
 .LUNSS0DUFRYLFKSSDQG'LOFKHUSUHMHFWDXWKHQticity for these reasons.
15
 &I5HLQKDUGWS*LJRQSS*XWKULHSQ%ROODFN
:LVPDQQSS0RXUDYLHY ,,,%LLL S
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



DVWKHPDQ\WKHPDVVHV  7KLVDWWLWXGHLVDSWO\VXPPHGXSLQ
a categorical claim that the many are bad, regardless of whether this was
uttered by Bias, whom Heraclitus mentions, or Heraclitus himself. Ordinary
SHRSOH DOZD\VIDLOWRFRPSUHKHQGWKHFRPPRQ %% 
'HVSLWH WKH IDFW WKDW WKH LV VKDUHG WKH PDQ\   OLYH DV LI
WKH\ KDG D ZLVGRP RI WKHLU RZQ %   7KH PDQ\  DUH XQDZDUH
RI WKH UHDO IRUP RI WKLQJV DQG SUHIHU DSSHDUDQFHV WR NQRZOHGJH %   ,Q
numerous fragments, these ignorant fools who in their barbaric souls cannot
understand, differentiate, apprehend, hear, or speak, are referred to simply by
DSOXUDO %%%%%%% ,QRWKHUVWDWHPHQWVWKH
PDQ\UHSUHVHQWWKHQHJDWLYHRSSRVLWHRIDQLQGLYLGXDORURIUHQHGSHRSOH
WKHEHVW  FKRVHRQHZKLOHWKHPDQ\  JRUJHOLNH
FDWWOH % IRROVWUXVWIRONVLQJHUVDQGWKHLUWHDFKHULVWKHFURZG 
 EHFDXVHWKH\FDQQRWQRWWHOODSDUWJRRGDQGHYLO % 
ZKLOHRQHVRSKLVWLFDWHGLQGLYLGXDOLVZRUWKWKRXVDQGV %
 +HUDFOLWXVVDZWKLVODFNRIGLVFHUQPHQWLQSHRSOHDVDOVRDQ
ontological shortcoming since the many cannot even tell apart what is wise
IURPWKHUHVW %
 .
,Q WKLV FRQWH[W H[KRUWLQJ SHRSOH WR JKW IRU WKHLU ODZV OLNH WKH\ ZRXOG
JKW IRU FLW\ ZDOOV VHHPV UDWKHU RGG ,W IROORZV IURP WKH DERYHPHQWLRQHG
quotations and paraphrases that in Heraclitus view, the many are incapable
of establishing good laws since they cannot see things as they are, cannot disWLQJXLVKJRRGIURPEDGRULPSRUWDQWIURPLQVLJQLFDQWDQGWKH\GRQRWORRN
IRUODZZKHUHLWUHDOO\LV LHLQWKHGLYLQH 7KHSKLORVRSKHUKDGQR
UHDVRQWRH[KRUW(SKHVLDQVRUDQ\RWKHUSHRSOHWRJKWIRUWKHSUHVHUYDWLRQRI
or compliance with laws: he radically doubted the ability of ordinary people
to recognise when, how, and against whom such laws should be defended.
Miroslav Marcovich thought that B 44 may be a kind of a political slogan in a metric form which Heraclitus composed for Ephesians in times of
political crisis, indicating that as city walls protect from an external enemy,
laws represent a protection against an internal enemy, especially against those
 :KLFKLVPXFKPRUHOLNHO\VHH%
 &I.LQGVWUDQGSS

 +LJKO\SRVLWLYHDWWLWXGHRI+HUDFOLWXVWRWKHSHRSOH QRW LVSURSRVHGSHUKDSV
RQO\E\/OHGySSEXWXQIRUWXQDWHO\WKH%LVWKHVROHHYLGHQFHIRUKLVSURjective and emphatically pro-democratic interpretation (which is a classical circulus uitiosus 



(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

who may aspire to tyrannical rule. This hypothesis was certainly well meant,
and it may facilitate the defence of other, similarly simple appeals from the
Heraclitean corpus but Heraclitus style of thought and all available evidence
contradicts it.
4.

Anachronic meaning of the term

Before the second half of the 5thFHQWXU\WKHWHUP did not mean law
EXWUDWKHUFXVWRP,QOLWHUDWXUHWKHUVWXVHRIWKHWHUPLQWKHVHQVHRIODZ
LVDWWHVWHGRQO\LQ%&(LQWKHZULWLQJRI6RSKRFOHVZKRDSSOLHGLWWRWKH
edicts of the Mycenaean ruler Creon. Novelty of this meaning is further conUPHGE\WKHIDFWWKDWZULWHUVOLYLQJDWWKLVWLPHRUVKRUWO\DIWHURIWHQDGGHGWR
WKHZRUGWKHDGMHFWLYHZULWWHQ. In this way, they wanted to prevent
possible confusion with traditional customs because the new laws crucially
GLIIHUHG IURP ROG FXVWRPV E\ EHLQJ [HG LQ ZULWLQJ. In the older stratum
RIOHJLVODWLYHWH[WVWKHWHUPXVXDOO\GHQRWHGFXVWRP, and the new
meaning can be attested only around mid-5th century. This new meaning
quickly caught on and spread, and in the course of the Hellenistic period be
 0DUFRYLFK  SS  6LPLODU SRVLWLRQ LV DGRSWHG DOVR E\ .LQGVWUDQG 
SDQG&RQFKHSS

 %ROODFNS

Antig.

 &I *RUJLDV DK  % D   $ULVWRSKDQHV Acharn.  SHUIRUPHGLQ LQ0HJDULVDSSDUHQWO\KROGV(XULSLGHVSuppl. SHUIRUPHGDIWHU 

 7KLVLVIXUWKHUFRQUPHGE\QXPHURXVQHZWHUPVXVHGWRGHQRWHODZVWKDWZKLFKZDV
recorded in writing (IC ,9  ;,,  *RUW\QD th FHQWXU\ %&(   UHFRUGLQJ
(IOlympDQG2O\PSLDERWKIURPth%&( LQVFULSWLRQ SEG;;;
7LU\QVthFHQWXU\%&(IG,9$UJRVth-5thFHQWXU\%&( HWF)RU
PRUHUHIHUHQFHVVHH+|ONHVNDPSSRU*DJDULQS

See, e.g., SIG  IURP +DOLFDUQDVVXV  %&(    >@ 
>@RUSIGIURP/RFURL %&(  LQWKLVLQVFULSWLRQODZ
LVRQOLQHUHIHUUHGWRE\WKHWHUP 

Sometimes, edict IE  IURP (U\WKUDL LVVXHG DURXQG  %&( LV VHHQ DV WKH UVW H[DPSOH7KHSKUDVHDSSHDUVWKHUHWKUHHWLPHVLQDVHQVHWKDWFRXOGEHWUDQVODWHGDV
DFFRUGLQJWRWKHODZ:LWKIXOOFHUWDLQW\KRZHYHUWKHQHZPHDQLQJLVDWWHVWHGRQO\DWWKH
end of the 5thFHQWXU\VHHHJDUHYLVLRQRI'UDFRVODZRQPXUGHURI%&( IG I
IURP$WKHQV RUODZVRQEXULDOVIURP,RXOLVRQWKH
LVODQGRI.HRVIURPODWHth century BCE (IG;,, 
2VWZDOGSS7KRPDVS

(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



FDPHWKHPDLQH[SUHVVLRQIRUODZLQWKHHQWLUH*UHHNWHUULWRU\WKRXJKHYHQ
DWWKDWWLPHVRPHUHJLRQDOWHUPVSHUVLVWHG HJLQ6LFLO\ 
It follows then that at the end of the Archaic period, in Heraclitus lifetimeFRXOGQRWUHIHUWRDODZ1RQHWKHOHVVDVWUXJJOHIRUZDVLQ
IDFWJRLQJRQDWWKDWWLPHQRWRQO\LQ(SKHVXVEXWDOORYHU*UHHFH/DZVEHFDme the means of a struggle whereby various communities since approximately
PLGth century sought to limit the power of important aristocratic families
and introduce a measure of order and predictability into the decision-making
SURFHVV LQ FRXUWV DQG DVVHPEOLHV :ULWWHQ WKHUHIRUH YHULDEOH DQG SXEOLFO\
accessible laws were seen as a protection against arbitrary application and
interpretation of the old and often ambiguous customary law, whose implePHQWDWLRQXVHGWREHUPO\LQWKHKDQGVRIWKHPRVWLPSRUWDQWDULVWRFUDWV.
6KRXOG ZH WKHQ UHDG WKH VWDWHPHQW DV UHIHUULQJ WR within the conWHPSRUDU\ PHDQLQJ VSHFWUXP" 7KDW ZRXOG VHHP LOODGYLVHG WKRXJK VRPH
VFKRODUVVXJJHVWWKDWLQWKLVFRQWH[W could be translated as political
establishment, legal order or even normative conduct. True, according to legends Heraclitus was the scion of an old aristocratic family, which in
consequence of this struggle and with the rise of democrats lost real power.

 +HUDFOLWXVLVXVXDOO\WKRXJKWWRKDYHOLYHGLQDERXW%&(VLQFHKHZDVVXSSRVHGO\DWWKHKHLJKWRIKLVSRZHUVDURXQGWKH\HDUDQGOLYHGWREHDERXW\HDUVROG FI
)UHHPDQ  S  .LUN  5DYHQ  SS  *XWKULH  S  0DUFRYLFK
SS.LUNSS&RQFKHSS 9DULRXVVRXUFHVKRZHYHUSURYLGHRIWHQXQUHOLDEOHDQGVRPHWLPHVPXWXDOO\FRQWUDGLFWRU\LQIRUPDWLRQ .LUN 5DYHQ
SS*XWKULHS0RXUDYLHYS 6RPHVFKRODUVWKHUHIRUHSODFH
WKHSKLORVRSKHUVOLIHLQWRWKHHQWLUHUVWKDOIRIWKHthFHQWXU\ 5HLQKDUGWSKLV
PDQXVFULSWDSSHDUHGDIWHU&ROOLS0RXUDYLHYS 
ZKLOHRWKHUVSUHIHUPXFKHDUOLHUGDWLQJHVSHFLDOO\EHFDXVHRIWKHDVVXPHGLQXHQFH+HUDFOLWXV
SKLORVRSK\RQ3DUPHQLGHV %XUQHWS:HOOPDQQSS)UHHPDQ
S.LUN 5DYHQS*XWKULHS.LUNSS&RQFKH
S   0RVW GHWDLOHG DQDO\VLV RI FKURQRORJ\ RI +HUDFOLWXV OLIH LV IRXQG LQ 0RXUDYLHY 
SS 00 

 6HHHJ4XDVVSS

 -RQHVS

 &I +HLQLPDQQ  S  SROLWLVFKH 2UGQXQJ GLH9HUIDVVXQJ GHU 3ROLV 2VWZDOG
SSYDOLGDQGELQGLQJRUGHUZD\RIOLIHRUPRUHVRIDFLW\DVDZKROH
DQGODZDQGRUGHU4XDVVSSQRUPDWLYH9HUKDOWHQVZHLVH1RUPWUlJHUFI
DOVR'LOFKHUSS

DK$SDU$2QFHDJDLQKLVWRULFLW\RIDOORIWKLVLQIRUPDWLRQLVKLJKO\GRXEWIXO
since there are almost no extant sources pertaining to the political situation and demographics
RI(SKHVXVDWWKHHQGRIWKH$UFKDLFSHULRG FI9ODVWRVS.LUNSS.LUN 

(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

,WLVWKHUHIRUHWKHRUHWLFDOO\SRVVLEOHWKDWKHPD\KDYHVHHQWKHROG XQZULWWHQ 
customs as preferable to the new written laws. But such interpretation is
undermined by the demand that it be the people who defend the old customs
ZKLFKZHUHDFWXDOO\QRWWRWKHLUDGYDQWDJH7KHLGHDRIJKWLQJIRUWKHSUHVHUvation of a particular political regime also does not sound too plausible since
Heraclitus in various fragments and testimonies repeatedly condemns it.
The best reading of the statement is obtained by assuming it refers to a
law, and all interprets and extant variations of the same metaphor (see
SRLQW   FRQFXU RQ WKLV SRLQW ,Q VXSSRUWLQJ WKLV LQWHUSUHWDWLRQ VFKRODUV
usually rely on other Heraclitean fragments in which they interpret 
LQWKLVRUDURXJKO\VLPLODUVHQVH %% , and suppose both that
the philosopher meant the divine law, as was common in his time, and
that the difference between a custom and a law was almost negligible.
The problem with this explanation is that the examples they invoke either
GRQRWFRQUPWKHXVHRILQWKHVHQVHRIODZ or come from the
5DYHQSQ*XWKULHS:HOOPDQQSS0DUFRYLFK
S.DKQSQ.LQGVWUDQGS+|ONHVNDPSSS
0RXUDYLHYS 

 &I&RQFKHS0RQGROIR 7DUiQ 0DUFKRYLFKSS

 &I/DVVDOOHSS)UlQNHOSS6FKOHLHUPDFKHUS
even considers the possibility that B 44 was part of the text of B 114.

 =HOOHU 1HVWOHSS.LUN 5DYHQS:KHHOZULJKW
SS0DUFRYLFKS.DKQSS0RQGROIR 7DUiQ 0DUFKRYLFK
S&IDOVR9ODVWRVSSQ

 6HH:KHHOZULJKWS

 3LQGDUIUJD0DHKOHULVWKHNLQJRIDOOJRGVDQGKXPDQV 
 (YHQ+HURGRWXV,,,UHDGVLQWKLVYHUVH
DVDFXVWRP /DWWHS2VWZDOGSS4XDVVSDQGRWKHUVDJUHH
ZLWKKLPRQWKLVSRLQW ZKLOHDOOODWHUDXWKRUVLQWHUSUHWLWXQHTXLYRFDOO\DVDODZ6LPLODUO\
LQ(PSHGRFOHVH[SUHVVLRQV DQG DK%
% ZKLFKZHUHE\DQFLHQWZULWHUVXQGHUVWRRGDVHTXLYDOHQWVRIWKH
FRVPLFDQGKXPDQ 3RUSK\U\LQ6WREDHXVEcl,,)DWHLVVRPHVXFKWKLQJWKDWUHVHPEOHVWKHGHFUHHVRIODZVDQGLVDODZLQLWVHOI
+LSSRO\WXVRef.9,,(PSHGRFOHVFODLPVWKDW
WKLVODZRIWKHRUGHURIWKHZRUOGLVWKHVXSUHPHRQH
 HYHQWKRXJKLQWKHRQO\DWWHVWHGSODFHLQ(PSHGRFOHV means quite clearly and unequivocally custom (DK  %  7KH\ VXUHO\
VSHDNDVFXVWRPDU\DQG,P\VHOIVKDUHWKLVFXVWRP
 ,QJHQXLQHIUDJPHQWVRI'HPRFULWXV also refers to a custom (DK%
% ZKLOHLQGXELRVDDQGIDOVDLWPHDQVODZ VHH%LQPDQXVFULSWVWKHUHDSSHDUV
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



second half of the 5th century, when started being used to mean law
in various contexts.
$IWHUDOO%PDNHVJRRGVHQVHHYHQZKHQZHUHDGLWDVLWLVDOVRFXVWRPDU\WRREH\WKHZLOODGYLFHRIRQH  . Fragment B 114
is very problematic indeed but even here can be read in the traditional
sense of custom, practice, habit, order. Moreover, it is possible that Heraclitus also played with the meanings of a differently accented but otherwise
LGHQWLFDOZRUG SDVWXUHIRGGHUIRRG DVLQWKHFDVHRIDQG
%  7KH XVH RI WKH YHUE  ZKLFK LV RWKHUZLVH KDUG WR H[SODLQ
may support this hypothesis. And there are other reasons that speak against
reading DVODZLQIUDJPHQW% ZRUGVQHHG
(YHQ$HVFK\OXVVKRXOGQRWEHWUDQVODWHGDVE\WKHODZRIWKHFRPPXQLW\
(Suppl.WKHSOD\ZDVVWDJHGLQ WKRXJKVRPHLQWHUSUHWHUVWHQGWRGRVR VHHHJ
2VWZDOGS 

 7KXF\GLGHV,,, WUDQVO6/DWWLPRUH 7KH\VWUHQJWKHQHGWKHLUWUXVWLQRQHDQRWKHU
OHVV E\ UHOLJLRXV ODZ WKDQ E\ DVVRFLDWLRQ LQ FRPPLWWLQJ VRPH LOOHJDO DFW    
 *RUJLDV
DK%VD\VRI$WKHQLDQVZKRGLHGLQWKHZDUWKDWPDQ\WLPHVWKH\SUHIHUUHGWKHFRU
rectness of words to strict law, because they believed this to be the most divine and universal
ODZWRVD\DQGQRWVD\DQGGRDQGQRWGRWKHULJKWWKLQJDWWKHULJKWWLPH 

 &I3ODWRLeg.,9D
-XVWLFHDOZD\VDFFRPSDQLHVKLP>LH=HXV@DQGLVWKHSXQLVKHURIWKRVHZKRIDOOVKRUWRIWKH
GLYLQHODZ  

 7KLVRSWLRQZDVFRQVLGHUHGIRUH[DPSOHE\0DUFRYLFKS&RQIRUPDEOHWR
FXVWRPDQGWUDGLWLRQ5RELQVRQS/DZRUFXVWRPRU0RQGROIR 7DUiQ 0DUFRYLFKSFRQIRUPHDOOHFRQVXHWXGLQLHDOODWUDGL]LRQH

 6HHHJ5HLQKDUGWS)ROJOLFKPVVHQGLHYRQGHQVWDDWOLFKHQ *HVHW]HQ XQG 6LWWHQ ZHVHQWOLFK YHUVFKLHGHQ VHLQ HV VLQG GLH 6DW]XQJHQ GHU JDQ]HQ
0HQVFKKHLWLQGHPVHOEHQHUNHQQWQLVWKHRUHWLVFKHQ6LQQHGHQZLUEHL3DUPHQLGHVHQWGHFNHQXQGLKU*HJHQWHLOGHULVWGDV'LQJDQVLFKGLHGLHEHUDOOHVREVLHJW
und deren Macht sich selbst bis in die Menschensatzungen hinein erstreckt. Cf. also Reinhardt
SS*LJRQSS4XDVVS%DWWHJD]]RUHSS
RU'LOFKHUS WKHWRWDOLW\RIUXOHVFXVWRPVDQGIRUPVRIEHKDYLRXUWKDWDUHYDOLGDQG
IROORZHGLQRQHFLW\ +HLQLPDQQS.LUNSSDQG2VWZDOGS
RQWKHRWKHUKDQGUHMHFWVXFKDGLVWLQFWLRQHYHQWKRXJK+HLQLPDQQWHQGVWRXQGHUVWDQG
EURDGO\DVGDV*HOWHQGH DVLQJHOWHQGHQ6LWWHQXQGDOOJHPHLQDQHUNDQQWHQ0DVWlEHGHV
'HQNHQV ZKLOH2VWZDOGDGPLWVWKDW here must be taken in a wider sense as referring
WRWKHZD\RIOLIHRUPRUHVRIDFLW\DVDZKROH FIDOVRSDQG 

 %DWWHJD]]RUH  SS  )RU PRUH RQ GLIFXOWLHV RI WUDQVODWLQJ DQG LQWHUSUHWLQJ
VHHPDLQO\0RXUHODWRVSS&IDOVR2VWZDOGSQ
(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

QRWEHUHDGHOOLSWLFDOO\LQWKHVHQVHRIIHHGRQWKHGLYLQHRQH>ODZ@EXWFRXOG
ZHOOEHWUDQVODWHGDVDUHIHGE\WKHRQHZKLFKLVGLYLQH FI%  WKH
SULPDU\PHVVDJHRIWKHVWDWHPHQWLVQRWDERXWLGHQWLI\LQJ with the law
and asserting a superiority of divine law over human ones, but rather about
LGHQWLFDWLRQRIWKHFRPPRQ ZLWKRQHGHLW\DQGLWVVXSHULRULW\RYHU
 % 41 WKHLGHDRIWU\LQJWRQGDGLYLQHODZ
shared by the new laws of various communities would be unprecedented not
only among the pre-Socratic philosophers, who focused mainly on a divine
IRXQGDWLRQRIMXVWLFH HTXLOLEULXP , but quite unique also within Heraclitean
WKRXJKWZKHUHLQ and mutual balance play a key role LQ+HUDFOLWXV
view, human laws could hardly provide a community with a commendable
kind of underpinning since in his early life, they tended to focus on one particular problem, and tried to enforce the legalised solution in perpetuity, while
towards the end of his life, Heraclitus may well have encountered situations
where laws would be frequently and variously changed and altered to suit the
current interest of representatives of different power groups, which sometimes
resulted in laws contradicting each other44.
6XUHO\HYHUVLQFH+HVLRGVRPH*UHHNLQWHOOHFWXDOVGLVFHUQHGVRPHUHJXODrity and order in the course of affairs dictated by the customs of their forefathers, and placed the origin of this order in the divine sphere (especially in the
SRZHURI=HXV 45. It is also beyond doubt that even in Classical times and later,

 &I*XWKULHS&OHYHSDUHQRXULVKHGE\RQHWKHGLYLQH%DWWHJD]]RUH  SS  KDQQR YLJRUH GDOOXQR GLYLQR DQG SDUWO\ DOVR 2VWZDOG 
SSWKRXJKKHLQWKHHQGWHQGVWRDFFHSWWKHWUDGLWLRQDOUHDGLQJ$VLPLODUWUDQVODWLRQLV
DGYRFDWHGDOVRE\0RXUHODWRVSSDQG DUHXQGHUZDUGVKLSWRRQHWKHGLYLQH
>ODZ@ *DUFtD&DOYRS SXHVVHFUtDQWRGDVODVOH\HVKXPDQDVGHODGLYLQDXQD\
VROD DQG'LOFKHUSEXWDOOWKHVHDXWKRUVVHHDODZXQGHUO\LQJWKHRQH
41
 &I5HLQKDUGWS.LUNS0RXUHODWRVSS

 %XUQHW  SS 9ODVWRV  S  Q -RQHV  SS  /RQJ 
SS

 -RQHVS2VWZDOGS/RQJSS
44
 &IDOVR-RQHVSS2VWZDOGSS.LUNS4XDVV
SS+|ONHVNDPSISQ/RQJS([WDQWHYLGHQFHHQDEOHV
us to prove this only in the case of Athens DQGSDUWO\DOVR&UHWHof the last third of the
5th century but this process most likely started somewhat earlier and was not limited to Athens
and Crete.
45
Hesiod, Op.)RUWKHVRQRI&URQRVKDVRUGDLQHGWKLVIRUPHQ 
 /RQJS


(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



ODZVZHUHMXVWLHGLQWKLVZD\. And while it is conceivable that Heraclitus


FRXOGKDYHEHHQWKHUVWKDUELQJHURIVXFKDQDSSURDFKLIKHUHDOO\ZLVKHG
WRDGYLVHKLVFRQWHPSRUDULHVWKDWWKH\VKRXOGJKWIRUWKHGLYLQHRUGHUDVLILW
were the city walls, he would have to be a little more explicit because no one
is likely to look for this meaning in the extant words of B 44.
7KH LQWHUSUHWHU RI WKH IUDJPHQW 'LRJHQHV FOHDUO\ XQGHUVWRRG to
PHDQKXPDQODZ+HSXWWKHVWDWHPHQWDERXWFRPPXQLW\VQHHGWRJKWIRU
ODZVLQGLUHFWFRQQHFWLRQZLWKDFODLPTXRWHGDOLWWOHODWHUWKDWZKHQ
>(SKHVLDQV@DVNHG>+HUDFOLWXV@WRJLYHWKHPODZVKHUHIXVHGEHFDXVHWKHFRPmunity was already dominated by a bad constitution. This statement, too, is
ahistoric, though it seems that towards the end of the Archaic period Ephesians were busy issuing written laws left and right+RZHYHUQR*UHHNVWDWH
KDGDWWKDWWLPHDFRQVWLWXWLRQLQWKHVHQVHRIDFOHDUO\[HGVHWRISULQFLSOHV
which all existing and prospective laws would have to conform to. No such
circumstance could have therefore prevented Heraclitus from coming up with
VRPHODZVZKLFKDFFRUGLQJWROHJHQGVKHGLG51. The idea of asking Hera 3ODWRProtag.EG WUDQVO%-RZHWW EXWZKHQWKH\ZHUHJDWKHUHGWRJHWKHUKDYLQJQRDUWRIJRYHUQPHQWWKH\HYLOWUHDWHGRQHDQRWKHU=HXVIHDUHGWKDWWKHHQWLUH
UDFHZRXOGEHH[WHUPLQDWHGDQGVRKHVHQW+HUPHVWRWKHPEHDULQJUHYHUHQFHDQGMXVWLFH
Hermes asked Zeus how he should impart justice and reverence among men: Should he disWULEXWHWKHPDVWKHDUWVDUHGLVWULEXWHG6KDOOWKLVEHWKHPDQQHULQZKLFK,DPWRGLVWULEXWH
MXVWLFHDQGUHYHUHQFHDPRQJPHQRUVKDOO,JLYHWKHPWRDOO"7RDOOVDLG=HXV,VKRXOGOLNH
WKHPDOOWRKDYHDVKDUHIRUFLWLHVFDQQRWH[LVWLIDIHZRQO\VKDUHLQWKHYLUWXHVDVLQWKHDUWV
$QGIXUWKHUPDNHDODZE\P\RUGHU  'HPRVWKHQHVIn Aristogit.
I (Or.;;9 (DFKODZLVDQLQYHQWLRQDQGJLIWRIWKHJRGV 
 &OHDQWKHVHymn. Iov. IUJ3RZHOO WUDQVO7:5ROOHVWRQH =HXV
UXOHURI1DWXUHWKDWJRYHUQHVWDOOWKLQJVZLWKODZ 
3RKOHQ]S

 'LRJHQHV/DsUWLXV,;


 9ODVWRVSQ.LUNSS

 +|ONHVNDPS  S  6XUYLYLQJ VWRQH EORFNV ZLWK LQVFULSWLRQV RI ODZV SUREDEO\
originally belonged to the same wall even though the subjects of the decrees varied widely so
WKDWHJUXOHVIRUGLYLQDWLRQIURPWKHLJKWRIELUGV LSAM$ ZHUHLPPHGLDWHO\DGMDFHQW
with rules of taking an oath in front of a judge (LSAM% 

 +|ONHVNDPSSS
51
Iamblichus, VP ;;;  WUDQVO - 'LOORQ DQG - +HUVKEHOO  )RU XQOLNH +HUDFOLWXV
who declared he would legislate for the Ephesians, and then decreed that the citizens should be
KDQJHGDVHDFKDWWDLQHGPDQKRRG 
 $QRWKHUYDULDWLRQRIWKHVDPHOHJHQGLV


(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

clitus to propose laws also does not sound likely. During the Archaic period, an
exceptional individual could be in times of crisis asked to organise the political
affairs of a state (this was the case of, e.g., Solon in Athens or Demonax in
0DQWLQHLD (PHUJHQF\SRZHUVJUDQWHGWRWKLVSXUSRVHZHUHKRZHYHUOLPLWHG
to a particular problem, and despite later legends describing a far-reaching
legislative aspect of these enterprises, had little to do with laws.
The ahistoric nature of Diogenes story would be of little interest to us if it
werent for the fact that fragment B 44 makes best sense in precisely this context. In Archaic times when law-making was a great novelty and by no means
a commonplace achievement, people mainly aimed at creating and enforcing
the best possible laws whose validity they then wished to secure in perpetuity. In the Classical and Hellenistic period, however, when laws were often
reformulated, abolished, misinterpreted or simply not adhered to, few believed
that optimal laws on their own could ensure the wellbeing of a community.
,WZDVDOVRQHFHVVDU\WRQGVRPHZD\RIHQVXULQJWKDWSHRSOHZRXOGREH\
ODZVDQGWKLVEHFDPHDSURPLQHQWVXEMHFWLQWKHWKLQNLQJRIVRSKLVWVDQG
philosophers of the Classical period, and one of the main goals of Hellenistic
pedagogy. However, it is questionable whether such interests can be ascribed
already to Heraclitus.
5.

Analogy with trivial gnomic wisdom

Fragment B 44 bears little resemblance with the dark, precisely formulated,


and endlessly ambiguous maxims so characteristic of Heraclitus. It seems
much closer to the so-called gnomic wisdom, which was in the Archaic period
usually presented by poets, in Classical times by sophists, and during Hellenism by philosophers and pedagogues54:KLOH PD[LPV IURP WKH$UFKDLF
SHULRGYDU\LQWKHLUTXDOLW\ZKLFKZDVODUJHO\DGMXVWHGWRWKHSURVSHFWLYH
DXGLHQFHWKH\DUHEXWVHOGRPRXWULJKWGXPEEDQDORUVWROLGO\PRUDOLVWLF
Later on, however, such statements are far from rare because their main tarJHWJURXSFKDQJHG:KLOHLQ$UFKDLFWLPHVZHUHLQWHQGHGPDLQO\IRU
the advice the philosopher allegedly gave his citizens: following their wishes (DK$ELQ
3OXWDUFKVUHQGLWLRQ RUQRW DK$ELQ7KHPLVWLXVUHQGLWLRQ 

 -XVWOLNHLQWKHFDVHRI3\WKDJRUDVRU+HUPRGRUXV VHHEHORZ &IDOVR$GFRFN
-RQHVSS+|ONHVNDPSS*DJDULQSDQGFKDS,,,

 +|ONHVNDPSS
54
 &I%LHORKODZHN.LQGVWUDQG*lUWQHU
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



adult aristocrats who were the main agents and representatives of tradition,
since the end of Classical times these sayings were increasingly created for
FKLOGUHQ DQG DGROHVFHQWV ZKR ZHUH LQVWUXFWHG LQ VLPSOLHG EDVLFV RI HWKLFV
by the means of such straightforward, uncomplicated maxims. For example,
when in the 5th century Euryptolemus of Athens urged the assembly to observe
laws and act in accordance with them, he did so for a particular reason, and in
his speech he prepared the ground for his plea55. Statements about the need to
guard and observe laws which are found in various gnomic collections dated
after the last third of the 4th century are no more than simple, unsubstantiated
appeals, which students were simply supposed to memorise.
The similarity of B 44 with trivial gnomic wisdom is, moreover, not
limited to a resemblance in form: it concerns the content as well. Existence of
sayings involving city walls is hinted on already by the lyrical poet Alcaeus,
according to whom men are a citys warlike wall7KHGHFLVLRQRI3KRFDHDQVWROHDYHWKHLUFLW\UDWKHUWKDQDFFHSW3HUVLDQUXOHRQHWKHRWKHUKDQGVHHPV
to have been dictated by a desire to defend the customs and laws of their forefathers rather than city walls. An interesting, though not very close analogy
is found in a statement that best is democracy where all fear the law as they
IHDUWKHLUPDVWHUEHFDXVH3OXWDUFKDVFULEHGWKLVVWDWHPHQWWR%LDVZKRVKDUH
ZLWK+HUDFOLWXVWKHFRQYLFWLRQWKDWPRVWDUHEDG VHHSRLQW .
55
Xenophon, Hell.,*XDUG\RXUODZVWKDQNVWRZKLFK\RXEHFDPHJUHDWDQGGRQRW
DWWHPSWWRDFWLQDQ\PDWWHUZLWKRXWWKHP 
 

DKChil.2EH\WKHODZV  Per.8VHROGODZVEXWIUHVK
IRRG  6HHDOVR6RVLDGHVLQ6WREDHXV
Ecl.,,,1R2EH\WKHODZ  6LPLODUO\VWUDLJKWIRUZDUGH[KRUWDWLRQVDUH
DOVRIRXQGDPRQJWKH3\WKDJRUHDQVHH3RUSK\U\VP2EH\WKHODZV 
 DQGVP WUDQVO.6*XWKULH 3OXFNQRWDFURZQPHDQWQRWWRYLRODWHWKH
ODZV ZKLFK DUH WKH FURZQV RI FLWLHV         
FIDOVR-HURPH$GY5XQ,FRURQDPPLQLPH
FDUSHQGDPLGHVWOHJHVXUELXPFRQVHUYDQGDV &I9ROOJUDIIS

 )UJ/REHO 3DJH 'LHKO WKLVUHDGLQJLVEDVHGRQWKH6FKXEDUWVJHQHUDOO\
DFFHSWHG FRQMHFWXUH  >  @  >@ 6HH DOVR$HVFK\OXV Pers. 
WUDQVO'7KHRGRULGLV 6RORQJDVWKHLUPHQOLYHWKHFLW\VWRZHUVZLOOEHVHFXUH 
 &I'LDQR 6HUUDSDQG&RQFKHSS
ZKRDQDO\VHWKH,RQLDQVUHODWLRQWRWKHZDOOVRIWKHLUFRPPXQLWLHVDQGLWVSURYHUELDOVWDWXV

 +HURGRWXV,

Sept. sap. conv.(
       &I DOVR +HURGRWXV 9,,  WUDQVO ' 7UXP-

(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

7KHPHWDSKRURIJKWLQJIRUVRPHWKLQJLPSRUWDQWDQGDJKWLQJIRUFLW\
ZDOOVDSSHDUVDOVRLQVHYHUDO5RPDQDQGODWHUDXWKRUVERWKRI*UHHNDQG/DWLQ
origin, among whom Cicero stands out7KLVDXWKRUDOVRFDOOHGIRUDJKWIRU
ODZV ZLWKRXWDQ\PHQWLRQRIFLW\ZDOOV DQGLQRQHSDVVDJHRQHHYHQQG
a community, divine and human law, and city walls mentioned in close proximity, though not in the form of the metaphor known from Heraclitus. An
interesting parallel is found in the Septuagint: ... so they that forsake the law
SUDLVHXQJRGOLQHVVEXWWKH\WKDWORYHWKHODZIRUWLI\WKHPVHOYHVZLWKDZDOO.
The Hebrew original sounds a little differently but since the text is not very
grammatically complex, the most likely reason for the difference seems to be
the desire to use in translation a generally known proverb. That is what Clem-

EXOO DQG 3 0F1DPDUD   IRU RYHU WKHP >/DFHGHPRQLDQV@ LV VHW /DZ DV D PDVWHU ZKRP
WKH\ IHDU PXFK PRUH HYHQ WKDQ WK\ SHRSOH IHDU WKHH      
 9ODVWRVSQ

ND,,, WUDQVO&'<RQJH ,WFRQFHUQVRXUDOWDUVRXUKHDUWKVRXWWHPSOHVQD\
HYHQWKHZDOOVRIRXUFLW\ZKLFK\RXSULHVWVKROGVDFUHG\RXZKRE\UHOLJLRQGHIHQG5RPH
better than she is defended by her ramparts (est enim mihi tecum pro aris et focis certamen et
SURGHRUXPWHPSOLVDWTXHGHOXEULVSURTXHXUELVPXULVTXRVYRVSRQWLFHVVDQFWRVHVVHGLFLWLV
GLOLJHQWLXVTXHXUEHPUHOLJLRQHTXDPLSVLVPRHQLEXVFLQJLWLV Acad.,, WUDQVO+5DFNKDP <RX/XFXOOXVLI\RXKDYHDFFHSWHGWKHYLHZVRI\RXUDVVRFLDWH$QWLRFKXVDUHERXQG
to defend these doctrines as you would defend the walls (haec tibi, Luculle, si es adsensus
$QWLRFKRIDPLOLDULWXRWDPVXQWGHIHQGHQGDTXDPPRHQLD 

Tusc. disp.,9 WUDQVO&'<RQJH ,WEHFRPHVXVWRJKWIRURXUODZVRXUOLEHUWLHVRXUFRXQWU\ SURHOLXPUHFWXPHVWKRFHULFRQYHQLWGLPLFDUHSUROHJLEXVSUROLEHUWDWH
SURSDWULD 

Pro Sestio;/,, WUDQVO&'<RQJH WKHQPHQVXUURXQGHGZLWKZDOOVVHWVRI
houses joined together, which we now call cities, and divine and human laws began to be
recognised (tum domicilia coniuncta, quas urbis dicimus, invento et divino iure et humano
PRHQLEXV VDHSVHUXQW  *LJDQWH  S  EHOLHYHV WKLV SDVVDJH WR KDYH EHHQ LQVSLUHG E\
B 44 but in doing so, he strengthens the analogy by the insertion of ut in front of moeniebus (as
ZDVVXJJHVWHGDOUHDG\E\5DXS WKXVGRLQJERWKVRPHWKLQJ&LFHURVWH[WGRHVQRW
LQDQ\ZD\UHTXLUH 0DUFRYLFKSPRVWHGLWRUVOHDYHWKHWH[WZLWKRXWDQ\FKDQJHV
\HWYDULRXVLPSURYHPHQWVKDYHEHHQVXJJHVWHGFI0DVORZVNLS DQGUHDGLQJWKH
text with either quite extraordinary degree of empathy or, as may be, imagination, since that is
exactly what is needed to see Heraclitus behind it.

LXX Prov.


An ecumenical translation of this passage is: Those who abandon the law, praise a godless one, but those who obey the law, oppose them.
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



ent of Alexandria and others most likely had in mind. A similar saying is also
UHHFWHGLQYDULRXV%LEOLFDOFRPPHQWDULHV-RKQ&KU\VRVWRPDWYDULRXVSRLQWV
speaks of laws being stronger than a city wallDQGDFFRUGLQJWR*UHJRU\RI
Nazianzus, the only real certainty is in the command to not break the law,
ZLWKZKLFKZHIRUWLHGRXUVHOYHVDVLILWZHUHFLW\ZDOOV.
$OORIWKHDERYHPHQWLRQHGSDVVDJHVORRNPRUHOLNHYDULRXVPRGLFDWLRQV
RIDZHOONQRZQVD\LQJUDWKHUWKDQUHHFWLRQVRQ%, however close this
fragment may stand to the original form of the proverb. Thinking in this direction is certainly legitimate, because there are a few proverbs that, with high
SUREDELOLW\ KDYH EHHQ VXEVHTXHQWO\ GHULYHG IURP +HUHDFOLWXV VD\LQJV ZLthout beeing able to retain their original depth. On the other hand, there are


Strom.,, WUDQVO5REHUW'RQDOGVRQ ,WLVWKHUHIRUHSODLQO\VDLG%DGPHQ
GRQRWXQGHUVWDQGWKHODZEXWWKH\ZKRORYHWKHODZIRUWLI\WKHPVHOYHVZLWKDZDOO 

&IDOVR2ULJHQExp. in Prov.;9,,(YDJULXVSchol. in Prov.

 -RKQ&KU\VRVWRPin Isaiam9>7KHSURSKHW@FDOOVDQHQFORVXUHDZDOOODZRU+LV
3URYLGHQFH)RULWLVVRWKDWDODZSURWHFWVPRUHFHUWDLQO\WKDQDUDPSDUW,VXUURXQGHGP\VHOI ZLWK D UDPSDUW WKHQ PHDQV , PDGH D FHUWDLQW\ UP$QG VLQFH D UDPSDUW FDQ RIWHQ
EH HDVLO\ DWWDFNHG KH VD\V WKDW KH SURWHFWV DQRWKHU DOOLDQFH    



Fragm. in Jerem., PG/;,90LJQH7KDWKHZK\KHIRUEDGHPL[LQJZLWK
>RWKHU@QDWLRQVWKDWLVZK\KHHVWDEOLVKHGODZVPLJKWLHUWKDQFLW\ZDOOVZKLFKGRQRWDSSURYHRI
PL[LQJZLWKQHLJKERXUV 
 

In Mach. laud., PG;;;90LJQH7KHUHLVRQHFHUWDLQW\DQGREHGLHQFHRIDFRPPDQGWKDWWKDWLVQRWWREUHDNWKHODZZLWKZKLFKZHIRUWLHGRXUVHOYHVDVLILWZHUHFLW\ZDOOV
 

 6HHHJ0DUFRYLFKSDQG0RQGROIR 7DUiQ 0DUFRYLFKSWKDW
however, explicitly mention only Cicero.

&I*UHJRULXVRI1D]LDQ]Or.;;9PG;;;90LJQHTo purify mud with
mud  DK%
(XVWDWKLXVin Hom. Il. II ,YDQGHU9DON
... like a proverb says that the sea is a slave to the winds 
 DK$D Schol. in Nic. Alex.That the sea ... is a slave to
the winds ..., also Heraclitus and Menecrates say 
 'LRJHQLDQXV,,Paroem. Graec.,
FIDOVR*UHJRULXV,,,$SRVWROLXV;,,6XGDDQG)RWLXVVY Donkey to
chaff  3KLOHPRQIUJ.RFNDK

(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

statements of Heraclitus which probably are an adaptation of old proverbs and


sayings, but in comparison with them, they have much deeper meaning.
$QRWKHUSRVVLELOLW\LVWKDWWKHPRUDOVWDWHPHQWDERXWWKHQHFHVVLW\WRJKW
IRUWKHODZZDVDWWULEXWHGWR+HUDFOLWXVE\6F\WKLQXVRI7HRV %&( WKH
iambic poet who allegedly undertook to put the discourse of Heraclitus into
YHUVH WUDQVO 5 ' +LFNV  *LYHQ WKDW WKH %  FDUULHV WUDFHV RI LDPELF
meter, and that Scythinus produced verses similar to the gnomic wisdom of
WKH3UHVRFUDWLFVLWLVSRVVLEOHWKDWKHZDVDOVRWKHDXWKRURI%:KHWKHU
KHZDVLQVSLUHGE\DUHDOVWDWHPHQWRI+HUDFOLWXV % E\OHJHQGRUE\VRmething completely different, is hard to decide. As the fr. B 44 does not seem
to have undergone any philosophical or other changes, most likely none were
DFWXDOO\FDUULHGRXWDQG+HUDFOLWXVQDPHZDVDI[HGWRWKHVD\LQJex post, in
order to buttress its authority.
% FI% Donkeys prefer chaff to gold  
6WU|PEHUJSS0DUFRYLFKS

DK%
 FI$UFKLORFKXV IUJ  :HVW     (XULSLGHV IUJ 
1DXFN>/LQXV@DS6WREDHXVEcl.9
0DUFRYLFKSDK%
FI6HPRQLGHVIUJ:HVW
*UHJRULXV,,,
Paroem. Graec., FIIXUWKHU$SRVWROLXV;9,,
Athanasius, Epist. ad episc. Pers., PG;;9,,,0LJQH'LG\PXV&DHFXVin Zacchar.,9
HWF 0DUFRYLFKSS

 +LHURQ\PXVRI5KRGXVIUJ:HKUOL 'LRJHQHV/DHUWLXV,;
 scil. 


 6F\WKLQXVIUJ:HVW WUDQVO-0(GPRQGV 7LPHVUVWDQGODVWRIDOOWKLQJVXQWR
PHQKDWKDOOWKLQJVLQWLVRQHDQGQRWRQHHYHULVKHUHZKHQSDVWWLVSDVWZKHQLWLVKHUH
LQVLGHLWVHOILWLVDQGWKHQFHWRLWVHOIUXQVFRXQWHUDQGZKDWVHHPVWRGD\LQVRRWKLV\HVWHUGD\DQG\HVWHUGD\WRGD\ 


&I7KDOHVDK$ 'LRJHQHV/DsUWLXV, WUDQVO5'+LFNV 7KHZLVHVWLV
WLPHIRULWEULQJVHYHU\WKLQJWROLJKW  Rec. Par.
3LWWDFXV 7]LDW]L3DSDJLDQLS 7LPHFRQQHFWVWKHJUHDWHVWLQWKHVPDOOHVW
WKHWKRXJKWV FI6WREDHXVEcl.,,,
           
(XHQXVIUJD:HVW WUDQVO-0(GPRQGV 7LPHLVWKHZLVHVWDQGWKHIRROLVKHVWRIWKLQJV
 
(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



 Analogy with falsa in a moralistic spirit


Fragment B 44 bears a marked resemblance to several statements, most of
which are more or less generally seen as falsa. The great majority of these
maxims have the form of rather simple, straightforward moralistic exhortaWLRQVZKLFKPLJKWWSHUIHFWO\ZHOOLQDFXUULFXOXPRIDQDQFLHQWRUPRGHUQ
elementary school, but which look rather out of place among statements of a
brilliant intellectual. Most of them are found only in late collections of gnomic
statements of sundry provenance and mediocre quality.
%  $ULVWRFULWXV  >+HUDFOLWXV@ VDLG WR WKH (J\SWLDQV ,I WKH\ DUH JRGV
ZK\GR\RXJULHYH",I\RXJULHYH\RXQRORQJHUWKLQNWKHPJRGV
% *QRPRO0RQDF/DW ,WLVLQDSSURSULDWHWRMRNHLQVXFKDZD\WKDW
you become ridiculous.
% *QRPRO3DU6XSSO 2SLQLRQLVDQREVWDFOHWRSURJUHVV
% *QRPRO9DW +RQRXUVFRQTXHUJRGVDQGPHQ
% *QRPRO9DW %DGSHRSOHDUHDGYHUVDULHVRIWUXWKIXORQHV
% *QRPRO9DW 7RWKHHGXFDWHGHGXFDWLRQLVDVHFRQGVXQ
% *QRPRO9DW 7KHPRVWGLUHFWZD\WRIDPHLVWREHFRPHJRRG
% 6WREDHXV 7KHFRXUVHRIWKLQJVLVIXOO\GHWHUPLQHGE\IDWH

Trivial wisdoms of this kind were ascribed not only to Heraclitus but also
to other pre-Socratics and various famous philosophers )UDJPHQW % 
for example, is an anecdote, which circulated in various versions involving
Xenophanes, Lycurgus, and an anonymous sage. And yet, not all assertions
of this kind are excluded from the corpus of authentic Heraclitean statements:
% 3OXWDUFK 'RJVEDUNDWHYHU\RQHWKH\GRQRWNQRZ
% 3OXWDUFK ,WLVEHVWWRKLGHRQHVIROO\EXWLWLVKDUGZKHQUHOD[HGRYHU
the wine cups.
See e.g. Empedocles, DK$Gnom. Par.DQGDVFULEHVWZRUDWKHUVWXSLG
VWDWHPHQWVWR(PSHGRFOHVEXW'LRJHQHV/DsUWLXVDVVLJQVWKHIRUPHUWR=HQRRI(OHD ,; DQG
WKHODWWHUWR;HQRSKDQHV ,; 

Xenophanes: Aristotle, Rhet.,,E3OXWDUFKDe Is. et Os.%De superst.
(DQGAmat.&'Lycurgus>3OXWDUFK@Apopth. Lacon.(Anonymous:
Clement, Protr.,,0LQXFLXV)HOL[Oct.;;,,)LUPLFXV0DWHUQXVErr. prof. rel.9,,,
*UHDWPDMRULW\RIVFKRODUVWKHUHIRUHUHMHFWVWKHDXWKHQWLFLW\RI% 6FKOHLHUPDFKHU/DVVDOOH
0XOODFK%\ZDWHU'LHOVSD-KS,0DUFRYLFKS:DO]HU
%ROODFN :LVPDQQS.DKQ&RQFKHSS&ROOL5RELQVRQ3UDGHDX
DQGRWKHUV 


(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

% 3OXWDUFK ,IWKHUHZHUHQRVXQLWZRXOGEHQLJKW


% 'LRJHQHV/DsUWLXV /HWXVQRWFRQMHFWXUHDWUDQGRPDERXWWKHJUHDWHVW
things.
% 'LRJHQHV/DsUWLXV :DQWRQQHVVQHHGVSXWWLQJRXWHYHQPRUHWKDQD
KRXVHLQUH

%LVDQROGVD\LQJZLWKQRGHHSHUPHDQLQJ, and yet its authenticity is


seldom doubted%DQG%DOVRVHHPWREHLPEXHGZLWKJHQHUDOZLVdoms of doubtful brilliance but even in these cases, objections against their
genuineness are nowhere to be found. All in all, it seems that in illo puncto
scholars are not very consistent or else they take it for granted that Heraclitus
for some unknown reason occasionally used popular proverbs and transformed their meaning6RPHH[SHUWVQGIUDJPHQW%UDWKHUKDUGWRVZDOORZ
EXWWKHQDJDLQQRRQHREMHFWVWR%HYHQWKRXJKLWLVDERXWDVSURIRXQGDQG
WRWKHSRLQWDV%DQGVHYHUDOJHQHUDOO\UHMHFWHGIDOVD (but it contains the
SRSXODUPRWLIRIUHRIWHQVHHQDVFKDUDFWHULVWLFDOO\+HUDFOLWHDQ 
 Connection with %
1RQHWKHOHVVSUREOHPVZLWK%KDYHHYHQGHHSHUURRWV,WVRQO\VRXUFHLV
DVLQWKHFDVHRI%WKHELRJUDSKHUDQGGR[RJUDSKHU'LRJHQHV/DsUWLXV
 0DUFRYLFKS7KLVLVDSRSXODUDGDJH,WVLPSOLFDWLRQLVREVFXUH
 6HHSHUKDSVRQO\.LUNS

 %H[SHUWVGLVDJUHHRQO\RQZKLFKSDUWVRI3OXWDUFKVVHQWHQFHFDQEHDFFHSWHGDV
DQDXWKHQWLFVWDWHPHQW IRUPRUHRQWKLVVHH0RXUDYLHY,,,%LSS %
scholars usually try to get at a hidden Heraclitean meaning by combining both textual variDQWV2EYLRXVQHVVDQGEDQDOLW\RIWKHVWDWHPHQWLVDFFHSWHGE\RQO\DKDQGIXORIH[SHUWV *LJRQ
SS'HU6DW]LVWUHFKWEDQDO*XWKULHS0DUFRYLFKSS
 

 *LJRQS +HUDNOLWRIWSRSXOlUH*HGDQNHQDXIQLPPW>FIIUJ@ 
DQG +HUDNOLWOHKQWVLFKJHUQHDQYRONVWPOLFKH9RUVWHOOXQJHQDQ>FIIUJ@ .LUN
5DYHQS LH% VKRZVKRZFRQYHQWLRQDOWKHSUDFWLFDOVLGHRI+HUDFOLWXVVHWKLFVRIWHQZDV7KHLQVLVWHQFHRQUHVSHFWIRUODZLQ LH% >LV@DJDLQ
H[SUHVVHGLQFRQYHQWLRQDOWHUPV=HOOHU 1HVWOHSEHOLHYH%WREHDYHUVLRQRI
the popular maxim dulce est pro patria mori, thus also rejecting the interpretation of Schuster
SDFFRUGLQJWRZKRP%ZDVPHDQWLURQLFDOO\

 $XWKHQWLFLW\RI%LVGRXEWHGHJE\6FKOHLHUPDFKHU0XOODFK*LJRQS
0DUFRYLFKS5RELQVRQSDQG9tWHNS

 .LUNS:HNQRZRIFRXUVHWKDWLQWKHVSKHUHRISUDFWLFDOHWKLFVKLVUHPDUNV
ZHUHRFFDVLRQDOO\LQGLVWLQJXLVKDEOHIURPWKRVHRIRWKHUVDJHVRIKLVWLPHHJIU'



(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



who in the introductory part of Heraclitus biography quotes six fragments


%%DQG% )RXURIWKHVHDUHLQYDULRXVZD\VFRQUPHGE\RWKHU
VRXUFHVEXW%DQG%DUHQRWIRXQGDQ\ZKHUHHOVH0RUHRYHUWKHVHWZR
statements are closely related: they are inserted into the same indirect senWHQFH  DQGSHUWDLQWRWKHVDPHWRSLFEHFDXVHVXSSUHVVLRQ
SXWWLQJRXW RIDUURJDQFH %:DQWRQQHVVQHHGVSXWWLQJRXWHYHQPRUH
WKDQDKRXVHLQUH RSSRVHGWRDJKWIRUDQGDGKHUHQFHWRODZV % FUHates a type of contrast characteristic of authors of the Archaic period who often
SXWDUURJDQFHDQGODZOHVVQHVV  LQRSSRVLWLRQZLWKRUGHUDQG
ODZ  . It follows from the context as well as from the following
IUDJPHQW%ZKHUH+HUDFOLWXVFDVWLJDWHVKLVIHOORZFLWL]HQVIRUEDQLVKLQJ
+HUPRGRUXVWKHPRVWYDOXDEOHPDQDPRQJWKHPWKDWERWK%DQG%
pertain to the same subject: they both address the people of Ephesus and the
bad political system they established.
2QHFRXOGWKHUHIRUHVXSSRVHWKDWWKHLQGLUHFWVHQWHQFHIURQWLQJ%LV
not combining two independent and cleverly chosen quotations from Heraclitus but rather two maxims of vague origin which were supposed to illustrate
Heraclitus censorious disposition and his immediate concern with political
affairs of his native city. The sentence makes best sense as an introduction to
%EHFDXVH'LRJHQHVDQGPDQ\ODWHUDXWKRUVVDZ+HUPRGRUXVDVD
law-giver. This interpretation is further supported by Diogeness words after
WKHTXRWDWLRQRI%ZKHUHKHSXWVHYHQ+HUDFOLWXVLQVXFKDODZPDNLQJ
SRVLWLRQ VHHSRLQW 
7KHSKUDVHWRSXWRXWDUURJDQFH RUZDQWRQQHVV ZDVUHODWLYHO\FRPmon, and that is why it is possible it was later imputed to Heraclitus based

Cf. for example Od.;9,,6RORQIUJ(GPRQGV7KHRJQLV
HWDO2VWZDOGSS

 'HLFKJUlEHUSS6FKZDUW]S.LUNS5RVpQS
+HUDFOLWXVPD\EHFRQVLGHUHGWKHDXWKRURIWKHVLPLOHEXWQRWRIWKHZRUGLQJ 

Cicero, Tusc. disp.9'HLFKJUlJHUS0Q]HUVYHermodorus  LQ
RE9,,,SS0DUFRYLFKSQ.LUNSS+|ONHVNDPS
SS

 6LPRQLGHV IUJ  'LHKO  IG I   +HURGRWXV 9    
DQG9,,,3ODWR
Leg.9,,,G&I
also Euripides, Or. WUDQVO,-RKQVRQ )RUZKHQSHRSOHIDOOLQWRIUHQ]\LWVOLNH
D EOD]LQJ UH KDUG WR SXW RXW           
 0DUFRYLFKS

(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

RQWKHDVVRFLDWLRQZLWKUHDQGSXWWLQJWKDWRXWWKDWLVQRWLRQVWKDWGRKDYH
DSODFHLQKLVZRUN %%ZLWKWKHFRPPHQWVRIDXWKRUV 2QWKHRWKHU
hand, the construction of the fragment does look very Heraclitean, and one
can read into it various meanings. Question remains, though, whether scholars
would try so hard to do had they seriously doubted Heraclitus authorship. This
PXFKLVFHUWDLQDVORQJDV%LVQRWLQGRXEWLWLQGLUHFWO\VXSSRUWVWKHDXthenticity of B 44. Et vice versa: if someone concludes that there is a problem
ZLWK%WKHQ%ZLOODOVRKDYHWREHPRUHFORVHO\LQYHVWLJDWHG.
Conclusion
Do the above-mentioned problems and suspicions require an unconditional reMHFWLRQRIIUDJPHQW%IURPWKHFRUSXVRIDXWKHQWLF+HUDFOLWHDQVWDWHPHQWV"
Not quite. The aforementioned objections can be, at least to some degree,
FRXQWHUHG,VKDOOQRZRQO\EULH\RXWOLQHWKHZD\VLQZKLFKWKLVFRXOGEH
done.
The language of the Ephesian philosopher is uncommonly idiosyncratic,
PDQ\OD\HUHG DQG KDUG WR SHQHWUDWH DOO RI ZKLFK PDNHV LW GLIFXOW WR WHOO
DSDUWWKHW\SLFDOIURPWKHDQRPDORXV VHHVHFWLRQ ,QFOXVLRQRIRQHVWDWHment or its part into another occurs in other fragment pairs without necessarLO\FDVWLQJGRXEWRQWKHLUDXWKHQWLFLW\ VHHVHFWLRQ +HUDFOLWHDQYLHZVDQG
theories which span over several fragments can be clearly summarised only
ZLWK XWPRVW GLIFXOW\ ,W LV WKHUHIRUH YHU\ WULFN\ WR FODLP WKDW VRPH +HUDFOLWHDQVWDWHPHQWFRQWUDGLFWVDQRWKHUHVSHFLDOO\DVWKLVDXWKRUZDVVRIRQG
RIFUHDWLQJUHDODQGDSSDUHQWFRQWUDGLFWLRQV VHHVHFWLRQ 6RPHDXWKRUPD\
have replaced the original word for law by its later equivalent and it is also
SRVVLEOHWRUHDG in the fragment according to its contemporary meaning.
One may even consider shifting the timing of Heraclitus life deeper into the
5thFHQWXU\ VHHVHFWLRQ 6LPLODULW\EHWZHHQGRXEWIXO+HUDFOLWHDQVWDWHPHQWV
and gnomic banalities could have arisen from being taken out of context or
from an inaccurate reproduction of the original meaning. It could even be a
consequence of intentional and systematic shifts in meaning, which the phiORVRSKHUHQJDJHGLQ VHHVHFWLRQ $IWHUDOOFHQVRULRXVPRRGDQGPRUDOLVWLF
overtones are found even in some Heraclitean statements whose authenticity

 &IDOUHDG\'HLFKJUlEHUS'LH*QRPHQ>LH%DQG%@GLHDOVVROFKH
LP *HJHQVDW] ]X GHQ NULWLVFKHQ =LWDWHQ VWHKHQ JHK|UHQ LQKDOWOLFK GRFK DXFK ZLHGHU LQ GHQ
=XVDPPHQKDQJKLQHLQGLH(UNOlUXQJPXVVEHLGHVEHDFKWHQ

(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



is beyond any doubt. One can thus imagine that Heraclitus for some reason occasionally resorted to simpler appellative exclamations and general moralisms
VHHVHFWLRQ 7KHLQVHUWLRQRIWZR+HUDFOLWHDQIUDJPHQWVLQWRRQHVLQGLUHFW
VHQWHQFHKDVLWVFRXQWHUSDUWVDOVRLQFDVHVRIJHQXLQHVWDWHPHQWV %% 
ZKLFKLVZK\DFRQQHFWLRQEHWZHHQ%DQGWKHXQSUREOHPDWLFIUDJPHQW%
UDWKHUVXSSRUWVWKDQZHDNHQVLWVDXWKHQWLFLW\ VHHVHFWLRQ 
Yet, though the authenticity of B 44 may be supportable, anyone who wishes to uphold it should deal with the seven above-mentioned kinds of objections
and offer well-grounded answers. Until such time, it seems warranted and
reasonable to treat this fragment at least dubious. It is also clear that even after
dealing with most of the controversial points, B 44 cannot be considered in all
respects a fully trustworthy testimony. For example, even though the atypically placed articles may be explained as infelicitous insertions by other authors,
B 44 can hardly be used as fully valid evidence in an analysis of how Heraclitus treated this phenomenon. And it would be similarly misleading to include
B 44 in an investigation of the use of in the sense of law because at
the end of the Archaic period, the word did not yet acquire this meaning.
BIBLIOGRAPHY
$GFRFN)(/LWHUDU\7UDGLWLRQDQG(DUO\*UHHN&RGH0DNHUVCambridge
Historical JournalSS
%DWWHJD]]RUH$0Gestualit e oracolarit in Eraclito, Milano.
%HUQD\V,Heraclitea. Particula I, Bonn.
%LHORKODZHN.Hypotheke und Gnome, Leipzig.
%ROODFN-7KH5HYLHZRI00DUFRYLFK+HUDFOLWXVGnomonSS
%ROODFN-DQG:LVPDQQ+Hraclite ou sparation3DULV
%XUQHW-Early Greek Philosophy, London.
%\ZDWHU ,  +HUDFOLWXV DQG $OEHUWXV 0DJQXV Journal of Philology 
SS
&OHYH)The Giants of Pre-Sophistic Greek Philosophy I-II, The Hague.
&ROOL*La sapienza greca III: Eraclito, Milano.
&RQFKH0Hraclite, Fragments3DULV
&RUVVHQ 3  'LH 6FKULIW GHV $UW]HV $QGURN\GHV  
RhMSS
'HLFKJUlEHU.%HPHUNXQJHQ]X'LRJHQHV%HULFKWEHU+HUDNOLWPhilologusSS
'LDQR&DQG6HUUD*Eraclito. I frammenti e le testimonianze, Milano.
(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

'LHOV+Herakleitos von Ephesos, Berlin.


'LHOV+Die Fragmente der Vorsokratiker%HUOLQ 4 
'LHOV+DQG.UDQ]:>@Die Fragmente der Vorsokratiker I, Berlin.
'LOFKHU5Studies in Heraclitus, Hildesheim.
'LOFKHU5,P)OXVVVHLQ +HUDNOLW% LQ5HFKHQDXHU* HG Frhgriechisches Denken*|WWLQJHQSS
)UlQNHO+$7KRXJKW3DWWHUQLQ+HUDFOLWXVAJPhSS
)UHHPDQ.The Pre-Socratic Philosophers, Oxford.
*DJDULQ07KH8QLW\RI*UHHN/DZLQ*DJDULQ0DQG&RKHQ' HGV 
Ancient Greek Law. The Cambridge Companion to Ancient Greek Law, CamEULGJH1HZ<RUNSS
*DJDULQ0Writing Greek Law, Cambridge.
*DUFtD&DOYR$Razn comn. Edicin crtica, ordenacin, traduccin y comentario de los restos del libro de Heraclito, Madrid.
*lUWQHU+$VY*QRPHLQDer Neue Pauly,96WXWWJDUWSS
*LJDQWH0$G&LF3UR36HVWLRPPS
*LJRQ2Untersuchungen zu Heraklit, Leipzig.
*RPSHU]7K  =X +HUDNOLWV /HKUH XQG GHQ hEHUUHVWHQ VHLQHV:HUNHV Sitzungsberichte Wiener AkademieSS
*XWKULH:.&A History of Greek Philosophy,&DPEULGJHSS
+HLQLPDQQ)Nomos und Physis, Basel.
+|ONHVNDPS.-Schiedsrichter, Gesetzgeber und Gesetzgebung im archaischen Griechenland, Stuttgart.
-RQHV:-The Law and Legal Theory of the Greeks: An Introduction, Oxford.
.DKQ&K+The Art and Thought of Heraclitus, Cambridge.
.LQGVWUDQG-)Anacharsis. The Legend and the Apopthegmata, Stockholm.
.LQGVWUDQG-)7KH&\QLFVDQG+HUDFOLWXVEranosSS
.LUN*6+HUDFOLWXVDQG'HDWKLQ%DWWOH )U' AJPhSS
.LUN * 6  >1  UHY HG@Heraclitus, the Cosmic Fragments, Cambridge.
.LUN*65DYHQ-(The Presocratic Philosophers, Cambridge.
.UDQ]:9RUVRNUDWLVFKHV,HermesSS
/DVVDOOH)Die Philosophie Herakleitos des Dunklen von Ephesos I-II, Berlin.
/DWWH.'HU5HFKWVJHGDQNHLPDUFKDLVFKHQ*ULHFKHQWXPA & ASS

/OHGy(/DOXFKDIRUODOH\ +HUiFOLWRIUDJPHQWR% LQ/OHGy(Memoria de la tica0DGULGSS
/RQJ$$ /DZDQG1DWXUHLQ*UHHN7KRXJKWLQ*DJDULQ0&RKHQ'
HGV The Cambridge Companion to Ancient Greek Law&DPEULGJHSS

(PHULWD/;;;SS

,661 GRLHPHULWD

+(5$&/,786'.% )5*0$5&29,&+ 



0DUFRYLFK0>6DQNW$XJXVWLQ@Heraclitus0pULGD
0DUFRYLFK0>1@Diogenis Laertii Vitae philosophorum I, Berolini.
0RQGROIR57DUiQ/DQG0DUFRYLFK0Eraclito. Testimonianze, imitazioni
e frammenti. Introduzione di G. Reale, Milano.
0DVORZVNL7Oratio pro Sestio, Stuttgart.
0RXUDYLHY6Heraclitea,,$Traditio $ 6DQNW$XJXVWLQ
0RXUDYLHY6Heraclitea,,,$Recensio. Fragmenta, Sankt Augustin.
0RXUDYLHY6Heraclitea III 1: Recensio. Memoria, Sankt Augustin.
0RXUDYLHY6Heraclitea,,,%LLLLRecensio. Fragmenta, Sankt Augustin.
0RXUHODWRV$3'+HUDFOLWXV)UAJPhSS
0XOODFK)*$Fragmenta philosophorum Graecorum,3DULVSS
0Q]HU)VYHermodorus  LQRE9,,,SS
2VWZDOG0Nomos and the Beginnings of the Athenian Democracy, Oxford.
3DWULFN*7:The Fragments of the Work of Heraclitus of Ephesos On Nature, Baltimore .
3RKOHQ]01RPRVPhilologusSS
3UDGHDX-)Hraclite, Fragments. Citations et tmoignages3DULV
4XDVV)Nomos und Psephisma. Untersuchung zum griechischen Staatsrecht,
Mnchen.
5DX6,(Variarum lectionum lib. ad Ciceronis orationes pertinens II, Lyon.
5HLQKDUGW .  Parmenides und die Geschichte der griechischen Philosophie,
Bonn.
5RELQVRQ70Heraclitus: Fragments8QLYHUVLW\RI7RURQWR3UHVV
5RVpQ+%(DUO\*UHHN*UDPPDUDQG7KRXJKWLQ+HUDFOLWXVProceedings
of the Israel Academy of Sciences and Humanities SS
6FKOHLHUPDFKHU)Herakleitos der Dunkle von Ephesos, in Schleirmacher, F.,
Smtliche Werke ,,,%HUOLQSS
6FKXVWHU3 +HUDNOLWYRQ(SKHVXV(LQ9HUVXFKGHVVHQ)UDJPHQWHQLQLKUHU
ursprnglichen Ordnung wiederherzustellen, Acta Societatis philologae LipsiensisSS
6FKZDUW](VY'LRJHQHV  /DHUWLXVRE9SS
6QHOO%'LH6SUDFKH+HUDNOLWVHermesSS
6WU|EHUJ5Greek Proverbs. A Collection of Proverbs and Proverbial Phrases
which are not Listed by the Ancient and Byzantine Paroemiographers*|WHERUJ
7KRPDV 5  :ULWLQJ /DZ DQG :ULWWHQ /DZ LQ *DJDULQ 0 &RKHQ '
HGV  Ancient Greek Law. The Cambridge Companion to Ancient Greek Law,
&DPEULGJH1HZ<RUNSS
7]LDW]L3DSDJLDQL 0  Die Sprche der sieben Weisen: Zwei byzantinische
Sammlungen, Stuttgart-Leipzig.
9tWHN7+HUDFOLWXVIU%'.PPSS
(PHULWD/;;;SS

,661 GRLHPHULWD

 

72097(.

9ODVWRV *  (TXDOLW\ DQG -XVWLFH LQ (DUO\ *UHHN &RVPRORJLHV CPh 
SS
9ROOJUDII:'HGXREXV+HUDFOLWLIUDJPHQWLVMnemosyneSS
9ROOJUDII:'HGXREXV+HUDFOLWLIUDJPHQWLVMnemosyneSS
:DO]HU5Eraclito. Raccolta dei frammenti e traduzione italiana, Firenze.
:KHHOZULJKW3KHeraclitus3ULQFHWRQ
:HOOPDQQ(VY+HUDFOLWXV  LQRE;9SS
=HOOHU(hEHUGLHlOWHVWHQ=HXJQLVVH]XU*HVFKLFKWHGHV3\WKDJRUDVSitzungsberichte der Bayerischen Akademie der Wissenschaften zu BerlinSS

=HOOHU(DQG1HVWOH:Die Philosophie der Griechen ,/HLS]LJ

)HFKDGHUHFHSFLyQGHODSULPHUDYHUVLyQGHODUWtFXOR
)HFKDGHDFHSWDFLyQ
)HFKDGHUHFHSFLyQGHODYHUVLyQGHQLWLYD

(PHULWD/;;;SS

,661 GRLHPHULWD

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 321-339
ISSN 0013-6662 doi: 10.3989/emerita.2012.16.1116

Y busqu su alma como a mi otro yo:


comentarios a Himerio 10.86-90*
Virginia Muoz Llamosas
Universidad de Oviedo
munozvirginia@uniovi.es

And I searched for his soul as my alter ego:


On Himerius 10.86-90
En su discurso 10, un discurso propmptico de intencionada inspiracin platnica, Himerio describe
su reaccin al conocer al alumno que ahora despide
y afirma que, vindose reflejado en l como en un
espejo, busc su alma como a su otro yo. A partir de ah analizamos las diferentes expresiones del
griego para esta idea, que pasar a la tradicin posterior bajo el latinismo alter ego, y que aparece
fundamentalmente vinculada al tema de la amistad.
Por su contenido el otro yo enlaza con el motivo
literario del doble, que puede ser aprovechado negativa o positivamente (que es donde se situara el
amigo como otro yo). Teniendo en cuenta las
diferentes expresiones para este concepto y las distintas reflexiones sobre la amistad, encontramos en
este pasaje de Himerio, junto a la influencia de
Platn, que l mismo pretenda, un eco, hasta ahora
inadvertido, de Aristteles y los proverbios acerca
del amigo.

In his OrationDRIPHDQingful platonic inspiration, Himerius describes his


reaction on having known the pupil who now dismisses and affirms that, meeting reflected in him as
in a mirror, he looked for his soul as to his other
myself. From there we analyze the different Greek
expressions for this idea, which will go on to the
later tradition under the Latinism alter ego, and that
turns out to be fundamentally linked to the topic of
friendship. The meaning of other myself connects with the literary motive of the double, which
can be developed negatively or positively (where
it would be placed the friend as other myself).
Considering the different expressions for this concept and the different reflections on friendship, we
find in this Himeriuss passage, close to Plato's influence, which he himself was seeking, an echo,
till now unnoticed, of Aristotle and the proverbs
concerning friendship.

Palabras clave: Himerio; alter ego; otro yo; doble;


amistad.

Key words: Himerius; alter ego; other self; double;


friendship.

*
Este trabajo forma parte del proyecto de investigacin La tradicin literaria griega en
los siglos III-IV d. C. Gramticos, rtores y sofistas como fuentes de la literatura greco-latina
(Ref. [MICINN] FFI2011-30203-C02-01).

322

VIRGINIA MUOZ LLAMOSAS

I. INTRODUCCIN
De los setenta y un discursos conservados1 del rtor del siglo IV d. C. Himerio de Prusa2, un nmero importante, diecisiete, son pronunciados con
motivo de la llegada o despedida de uno o varios estudiantes o del propio
+LPHULR &RQFUHWDPHQWH HO Q~PHUR  HV XQ   HVWR HV
un discurso de despedida y buenos deseos para un alumno que se va. No nos
ha llegado completo, sino que de l conservamos el extracto de Focio, fragmentos de los Excerpta Neapolitana3 \XQFRPHQWDULRSUHOLPLQDU
en el que se dan detalles importantes acerca de su composicin. Este tipo de
declamaciones era, a decir del propio Himerio4, reciente, y en ellos, segn
apunta Menandro el Rtor5 podemos encontrar consejos y recomendaciones
para el que se va, especialmente si uno de mayor rango despide a otro infeULRUDVtFRPRHQFRPLRV\UHODWRVDPRURVRV  FRQ
ODSRVLELOLGDGGHPRVWUDUXQDDFWLWXGFDULxRVD\DSDVLRQDGD 
 SRUHOGHVSHGLGRVLQLQFOXLU
consejos cuando quien despide y el despedido tienen una dignidad similar,
SHURVLHPSUHFRQHVRVVHQWLPLHQWRVTXH0HQDQGURGHQRPLQD
(395.28). Himerio decide dar una apariencia ms antigua al discurso que nos
ocupa remontndose a Platn, de quien toma la forma de dilogo y el uso del
mito para exponer ciertas ideas. Y, efectivamente, con un mito de indudables
reminiscencias platnicas, recuerda Himerio que cuando Zeus cre la raza
humana Eros no intervena en los asuntos de los hombres, sino que nicamente disparaba sus flechas entre los dioses. Despus, Zeus, preocupado por
la posibilidad de que los hombres se extinguieran, hizo a Eros el guardin
GHODUD]D  (URVDFHSWyVXQXHYR
papel, pero consider que no deba ocuparse de todas las almas, sino que
1
De los setenta y uno que conoci Focio, tan slo veinticuatro nos han llegado completos,
de treinta y seis tenemos extractos, y de los once restantes, fragmentos.
2
Una primera aproximacin a este autor puede verse en Der Neue Pauly, 5, pp. 561-563,
s. u. +LPHULRVRHQODLQWURGXFFLyQDODUHFLHQWHWUDGXFFLyQGH3HQHOOD
3
Adems de los manuscritos, en el caso de la transmisin textual de Himerio contamos
con los extractos de Focio, los llamados Excerpta Neapolitana, que aparecen en un manuscrito
del siglo XIV de Npoles y los del Lxico de Andreas Lopadiota. Para el texto de Himerio
seguiremos la edicin de Colonna 1951. Para el resto de autores, de no indicarse lo contrario,
seguimos las mismas ediciones que el TLG.
4
10.3-4.
5
Men. Rh. 395.

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

323

DVLJQy HO FXLGDGR GH ODV DOPDV RUGLQDULDV D XQRV (URV YXOJDUHV 
 KLMRVGHODV1LQIDVPLHQWUDVTXHpOVHRFXSDUtDGHODVDOPDV
FDOLILFDGDV FRPR GLYLQDV \ FHOHVWHV      D ODV
TXHOOHYDUtDDXQDORFXUDHUyWLFD 
56). Slo quienes han sido tocados por este Eros alcanzan con facilidad una
DPLVWDGGHQRPLQDGD<WRGDDOPDTXHKDVLGRUHFLHQWHPHQWHDSDUtada de la esfera superior y de la contemplacin de la belleza, cuando la ve
escondida en otra alma divina, desea unirse a ella, sintiendo el consuelo que
le proporcionan el conocimiento y opinin verdaderos. Y eso es exactamente
lo que Himerio sinti con este joven al que ahora despide, como vemos en
sus palabras:
            


 
un sentimiento semejante experiment tambin yo acerca de este joven.
Pues, viendo aparecer en su alma, como en un espejo, una imagen de mi
propia manera de ser, me alegr y por esto dese y busqu su alma como a
mi otro yo.

La terminologa empleada en todo el pasaje, as como la idea de que existen dos tipos de Eros, nos lleva inmediatamente a Platn y a las dos Afroditas6
de las que habla Pausanias en el Banquete. Pero no es la influencia platnica8, sobre la que luego volveremos, el objeto de nuestro comentario, sino la
H[SUHVLyQPLRWUR\RFX\DIRUPD\FRQWHQLGRSDVDPRVD
analizar a continuacin.

 7DPELpQ+LPHULRKDEODHQGHGRV$IURGLWDVXQDFHOHVWH\RWUDYXOJDUTXHHQJHQdran a su vez muchos Eros celestes y vulgares; en cambio, en el pasaje que comentamos slo
existe un Eros celeste.

Pl., Smp. 180c ss.
8
No es nuestro propsito tratar el tema de la amistad y Eros en Platn, para el que remitimos, por ejemplo, a Reeve 2011, con abundante bibliografa.
6

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

324

VIRGINIA MUOZ LLAMOSAS

II. LA

FORMA: LA EXPRESIN

Estamos ante una expresin poco frecuente en griego, tan poco frecuente que
slo la utilizan, hasta donde sabemos por las bsquedas realizadas en el TLG,
Himerio y dos autores del siglo XIV. El primero de ellos es Manuel Ral9,
que la usa en una carta en la que tambin se menciona esta idea en conexin
con la ms profunda amistad10, diciendo:
          

sabiendo que, precisamente desde que nos unimos y fuimos atados por los
lazos ineludibles de la amistad, yo te considero mi otro yo.

De forma semejante usa la expresin Constantino Acropolita11, de nuevo


en una carta, que comienza con estas palabras:
          
 Ep. 50.1-2)
Sabes, mi querida y tres veces deseada cabeza, que desde el principio te he
considerado mi otro yo.

/D HOHFFLyQ GHO WpUPLQR  VH FRUUHVSRQGH FRQ OR TXH FRQRFHPRV
sobre la evolucin de los pronombres reflexivos, y constituye una expresin
muy precisa, que no deja dudas acerca del referente, que se identifica con
el hablante, dado que los tres pasajes tienen los verbos en primera persona.
Estas tres ocurrencias, que tambin coinciden en el caso acusativo, como se
puede ver, estn lejos del griego clsico. No obstante, y a pesar de lo tardo
de su aparicin, en la literatura anterior encontramos otras expresiones para
HVWDPLVPDLGHDFRPR
12. Las cuatro primeras, que son las ms tempranas, aparecen mayoritariamente en nominativo, siempre en masculino y con
V. )DVVRXODNLV
Ep. 
11
Sobre este autor, v. Nicol 1965.
12
Rastreamos los precedentes de la expresin sobre todo all donde se la utiliza hablando
de la amistad, tema a propsito del cual la emplea Himerio. En cambio, pasaremos por alto
9

10

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

325

HOGHWHUPLQDQWHRGHODQWHGH\PLHQWUDVTXHHOXVR
en otros casos (acusativo) es ms tardo, como tambin es posterior la aparicin de formas reflexivas.
1.

En el libro VIII de su tica a Nicmaco13 Aristteles trata el tema de la amistad y afirma que, en el caso de la ms perfecta y equilibrada, el amigo es otro
\R  5HSLWHODH[SUHVLyQHQODtica Eudemia
1245a29-30, donde dice:


el amigo quiere ser, como dice el proverbio, otro Heracles, otro yo.

Este es un conocido proverbio, trasmitido, entre otros, por Plutarco14,


Diogeniano15, Zenobio16, Eliano, Eustacio18 o Hesiquio19
otro Heracles, que se aplicaba a los atletas y a los forzudos en general20. En
pOVHDSUHFLDHOXVRGHFRPRXQQXHYRXQVHJXQGRSRURSRVLFLyQ
a una persona determinada, acepcin21 que aparece recogida en el DGE s .u.
Volviendo a Aristteles, sigue diciendo el filsofo que, sin embargo, existe una separacin y es difcil que surja la unidad, y que a pesar de los posibles
su aparicin en otros contextos, como, por ejemplo, en los autores cristianos, al tratar de la
relacin entre el Padre y el Hijo o las naturalezas de Cristo.
13
EN 1166a33.
14
Thes. 29.3.8.
15
CPG I 1.63.1.
16
CPG I 5.48.1.

VH 12.22.19.
18
Commentarii ad Homeri Iliadem, p. 589, 41-45.
19
S. u. 
20
Sobre el uso cmico y pardico que Tecrito hace de este proverbio, v. Montes Cala
2006.
21
 (VWHXVRGHWDPELpQWLHQHSDUDOHORVHQODWtQHQIRUPDVFRPRalter y nouus. Por
ejemplo, Cicern se refiere a Metrodoro como paene alter Epicurus (fin. 2.92), y a Antonio
como noue Hannibal (Phil. 13.25). En griego podemos ver cmo Epicteto (Diss,,, 
llama a Hiparquia RWUR&UDWHV
Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

326

VIRGINIA MUOZ LLAMOSAS

puntos en comn entre los amigos, un amigo desea existir como un yo seSDUDGR 
EE 1245a34-35).
(QXQR\RWURSDVDMHSRGHPRVREVHUYDUTXHTXHVHGHILQHVHJ~Q
Adrados22, como un pronombre nominal-adjetival, est funcionando como un
sustantivo, y que es indiferente a las oposiciones personales: ya desde Homero en su uso nominal puede equivaler a cualquiera de las tres personas, aunTXHHVFLHUWRTXHORPiVIUHFXHQWHHVTXHHTXLYDOJDDODWHUFHUD$TXt
insistiendo en la identidad, en el ser mismo23 realizado en su plenitud de la
persona o cosa a la que se refiere, alude a otro l, a que el amigo es otro
que se puede identificar plenamente con uno mismo, pero de la expresin
griega no se deduce automticamente la primera persona, por lo que la traGXFFLyQRWUR\RQRHVODPiVH[DFWD(OPLVPRXVRGHSXHGHREVHUYDUVHHQODIRUPDTXHVHDPDDVtPLVPRRHQRWURVFRPSXHVWRV
GRQGHDSDUHFHFRPRSULPHUWpUPLQRTXHREUDSRUSURSLD
voluntad24  TXH VH LQYLWD D Vt PLVPR TXH DFXGH SRU SURSLD
iniciativa, intruso25  GXHxR GH Vt PLVPR26  TXH
acta por s mismo (Q WRGRV HOORV  HV FODUDPHQWH LQGLIHUHQWH D OD
persona y, si bien estos compuestos, cuando aparecen en nominativo, suelen
referirse a una tercera persona identificable con el sujeto gramatical, no faltan
ejemplos con verbos en primera o segunda persona. S hace explcita la referencia a la primera persona la palabra egosta, con la que a menudo se
WUDGXFHXQDSDODEUDTXHFXULRVDPHQWHOOHJDDODVOHQJXDVURPDQFHV
muy tarde28, en el siglo XVIII, con un neologismo cuyo primer trmino es
ego. De todos modos, hay que decir que en egosta el pronombre personal
ego del que deriva sufre un desplazamiento semntico, perdiendo su signifi-

Adrados 1992, p. 303.


 9DORU TXH VHJ~Q %LUDXG  \  WDPELpQDSDUHFHFXDQGRVH XVD FRPRGHWHUPLnante, y que engloba los valores de encarecimiento y exclusividad.
24
A., Th. 1054.
25
Pl., Ep. (dub.) 331b 6.
26
Th. 4. 63.

Ar., Pl. 1190.
28
 (Q FDVWHOODQR HJRtVPR VH WHVWLPRQLD SRU SULPHUD YH] HQ  OD IRUPD ODWLQD GH
OD TXH SURFHGH HV XQ QHRORJLVPR TXH DSDUHFH HQ  3IDII   (Q IUDQFpV OD SULPHUD
PHQFLyQ HV GH  \ HQ LWDOLDQR GH  (Q IUDQFpV SRU RWUR ODGR WHQHPRV GHVGH 
la forma gotiste.
22
23

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0



cado gramatical para adquirir un significado lxico, de manera que ya no se


refiere al hablante y decimos t eres egosta, l es egosta y no *tusta
ni *susta29. En cambio, otras lenguas modernas, como el ingls selfish o
el alemn selbstschtig30 presentan una situacin similar a la del griego, al
utilizar un reflexivo como primer trmino del compuesto.
/DIRUPDSRUORWDQWRSUHVHQWDDTXtXQXVRQRPLQDOLQGLIHUHQWHD
la persona, con un valor enftico31 del que pueden derivar los sentidos de
HQFDUHFLPLHQWR \ H[FOXVLYLGDG 6X GHWHUPLQDQWH  HV VHJ~Q %LUDXG
(1991), un adjetivo de alteridad que permite expresar la no identidad entre
los objetos denotados por los nombres a los que determina y, como hemos
GLFKRDQWHULRUPHQWHSXHGHGHVLJQDUXQQXHYRXQVHJXQGRSRURSRVLFLyQ
a una persona determinada.
Como paralelos latinos y, siguiendo, sin duda, a Aristteles32, encontramos
el testimonio de Cicern, quien afirma en De amicitia 21.80: est [amicus]
enim is quidem tamquam alter idem, con una expresin que podramos
traducir como otro el mismo, un segundo l y donde, como en el caso de
  QR KD\ QLQJXQD DOXVLyQ D OD SULPHUD SHUVRQD7HQGUHPRV TXH
esperar a san Ambrosio, en el siglo IV d. C (De Spiritu sancto II 13.154, unde
quidem interrogatus, quid amicus esset: alter, inquit, ego), para encontrar las
palabras alter ego, que conservamos actualmente como latinismo33.

29
Algo similar sucede con palabras como suidicio, donde la tercera persona puede ser
primera o segunda.
30
Tambin tiene el alemn el cultismo egoistisch, al igual que el ingls tiene egoistical
y egoist.
31
Punto ya sealado por A. D., Pron. 2.1.1.
32
 5RGUtJXH] 'RQtV  SS  DILUPD TXH ODV UHIOH[LRQHV GH &LFHUyQ VREUH OD
amistad se inspiran en los peripatticos, pero que no sabemos exactamente cunto conoci
de la obra de Aristteles. En concreto, en p. 152 n. 26, pone en relacin el ciceroniano alter
idem FRQ HO   GH$ULVWyWHOHV EN IX 1169b), sin citar ninguna de las otras expresiones que comentamos aqu, y limitndose a decir que el origen de la frmula es muy
anterior a ambos.
33
Tambin usa san Ambrosio la expresin alteri tibi en referencia al amigo en De Off.
III 133, aadiendo adems el tpico de que los dos amigos pueden convertirse de dos seres
en uno solo (unum ex duobus). Aparte de las fuentes clsicas que citamos aqu, Culbertson
1996, p. 153, ofrece pasajes bblicos, de la patrstica y autores rabes, donde tambin aparece
la idea del amigo como otro yo.

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

328

2.

VIRGINIA MUOZ LLAMOSAS

Esta expresin aparece vinculada principalmente al tema de la amistad, e


incluso exista un proverbio al respecto, que se remonta a la ancdota protagonizada por Pitgoras o, segn otros testimonios, simplemente por los
SLWDJyULFRV TXH DQWH OD SUHJXQWD    KDEUtDQ FRQWHVWDGR 
34. Tambin la usa Aristteles inmediatamente despus de haber usado la
H[SUHVLyQ
!

 $ULVW00
Ahora bien, si uno, mirando a su amigo viera qu es el amigo y cul es su
carcter y que es tal cual otro yo al menos si imaginas un amigo muy ntimo, segn el dicho este es otro Heracles, el amigo (ser) otro yo.

(Q HVWH SDVDMH HQFRQWUDPRV MXQWDV ODV H[SUHVLRQHV   \ 


DSOLFDGDVDODPLJRFRQXQXVRGHHQHOTXHGHPDQHUDVLPLODUDOR
que suceda con la forma egosta, se pierde la referencialidad al hablante,
por lo que, segn el contexto, puede referirse a cualquier persona. Destaca,
adems, la alusin al proverbio antes comentado.
3.

/DFRPELQDFLyQDSDUHFHWDPELpQHQ$ULVWyWHOHVSDUDGHILQLUDO
amigo, como podemos ver en EN 1169b      
\ b       \ DVt PLVPR VH HQFXHQWUD HQ
comentarios al filsofo35, o en la Suda (s. u. (OXVRGHVHUtDHO
PLVPRTXHKHPRVH[SOLFDGRDQWHULRUPHQWHPLHQWUDVTXHODIRUPDD
juzgar por el empleo que Aristteles hace de ambos trminos en pasajes muy
FHUFDQRVHVWRWDOPHQWHLQWHUFDPELDEOHFRQXQDYH]TXHPiV

As lo transmiten Plu., Vit. Hom. 2.1904, Stob. II 33.13.2, Simp., in Epict.  FI
tambin Olymp., in Alc. 31.19, 36.8. Una ligera variante es proporcionada por la sentencia
296 recogida en el Gnomologium VaticanumTXHDWULEX\HODUHVSXHVWDD=HQyQ\GLFH
 
35
Mich., in EN 516.31.
34

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

329

PDUFDGR SLHUGH HO VHQWLGR GH RWUR GH GRV H[DFWDPHQWH LJXDO TXH VXFHGH
con las formas latinas alter y alius.
4.

De nuevo en Aristteles y en conexin con el tema de la amistad encontramos


HQXQSDVDMHHQHOTXHDSDUHFHODLGHDGHOHVSHMR MM ,,
15.8.1) que posteriormente utilizar Himerio. Afirma el filsofo:


 .
As pues, igual que cuando queremos ver nuestro propio rostro, lo vemos
mirando al espejo, del mismo modo tambin cuando queramos conocernos a
nosotros mismos, podramos llegar a conocernos mirando al amigo; pues el
amigo es, segn decimos, otro yo.

Claramente se deduce de este pasaje que se llega a la propia identidad


a travs de lo otro, de la percepcin del otro, que en el caso del amigo es
identificable con uno mismo, mientras que la contemplacin directa de uno
mismo es, segn el filsofo, imposible36.
Clemente de Alejandra se aparta ligeramente de Aristteles al dar la deILQLFLyQQRSDUDODSDODEUDVLQRSDUD. Por su parte,
Jmblico38 recupera la ancdota ya comentada sobre Pitgoras con esta modificacin, al igual que Filn39, que con anterioridad haca referencia al preFHSWRSLWDJyULFR   

36
MM ,,. Quiz ello se deba a que, como sostiene Lan Entralgo 1983, los
griegos no llegaron a sentir la peculiar realidad del otro yo, slo conocen el yo visto desde
fuera, por los dems, y ni Platn ni Aristteles conocieron lo que hoy se llama el problema del
otro, porque, sencillamente, no reflexionaron sobre lo que los filsofos postcartesianos llaman
el yo personal, sino sobre el alma, lo que para el hombre moderno es la cosificacin del yo.

Clem. Al., Strom. II 9.41.2.4.
38
Iambl., In Nic. 35.6.
39
Fr., GenE

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

330

5.

VIRGINIA MUOZ LLAMOSAS

Tras las cuatro primeras variantes, todas ellas testimoniadas en Aristteles


y con mayor o menor continuidad en la literatura posterior, encontramos un
nuevo testimonio en Plutarco40, que presenta la novedad de incorporar el reIOH[LYREDMRODIRUPDSUREDEOHPHQWHGHELGRDODHYROXFLyQGH
hacia mero pronombre de tercera persona.
             



y el considerar al amigo otro l mismo y llamarle compaero en el sentido de el otro no es sino servirse de la dualidad como medida de la amistad.

6.

Porfirio41, en la Vida de Pitgoras afirma que este filsofo, a quien se le


DWULEXtDQPi[LPDVUHODFLRQDGDVFRQODDPLVWDGFRPR\
IXHWDPELpQHOSULPHURHQIRUPXODUHOFRQFHSWRGHODPLJR
como alter ego.



Y quiso a los amigos sobremanera, y fue el primero que mostr que son comunes las cosas de los amigos y que el amigo es otro l.

Al margen de si realmente fue o no Pitgoras quien defini al amigo como


l mismo, lo que nos interesa es la nueva variante en la expresin,
que est en consonancia con lo que vamos a encontrar a continuacin. Al
testimonio de Porfirio se suma el de Sinesio42, que sigue la lnea iniciada por
Plutarco con el uso del reflexivo, recordando la ancdota sobre Pitgoras;
otro

40
41
42

Plu. 2.93e9.
VP 33.1-3.
Ep

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

331



Y nadie se opondr a los que alabaron a Pitgoras, que defini al amigo como
otro l.

Muy similar es el testimonio de su contemporneo Basilio de Cesarea43:





Y no te asombres si llamo propias las cosas de mis amigos, pues junto a
las otras virtudes tambin he sido instruido en la amistad, y recuerdo al sabio
diciendo: el amigo es otro l mismo.

Y, ya en el siglo XIV, reencontramos la expresin en Manuel Calecas44,


que en una de sus cartas dice:

pues deca que el amigo es otro l mismo.

Todos los testimonios son, como puede verse, muy similares: incorporan
el reflexivo sin determinacin expresa de la persona a la que se refieren, y
tienen en comn el caso acusativo.
Por otro lado, remontndonos al comienzo de la literatura griega, podemos
hallar un precedente de estas expresiones en Homero. Como es sabido, en ese
momento no existe un concepto unitario del yo, sino que el hombre es
entendido como la suma de distintas partes que lo integran45, y la referencia
a la totalidad de la persona a travs de la mencin de una de sus partes es una
Ep
Sobre este autor, v. Kazhdan 1991 s. u. Kalekas.
45
Se trata de una creencia comn entre los pueblos primitivos, para quienes la imagen
no es una reproduccin del original distinta de este, sino el mismo original; de ah el temor
a la manipulacin de la sombra/imagen/reflejo/retrato. En la literatura fantstica aparecen
frecuentemente sombras o imgenes reflejadas que cobran vida y se rebelan, Esto nos habla
de un pavor a la fragmentacin, al mismo tiempo que demuestra que los temores primitivos
no son ajenos al hombre moderno.
43
44

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

332

VIRGINIA MUOZ LLAMOSAS

metonimia muy comn46. En el canto 18 de la Ilada (Il. XVIII 80-82) Aquiles le dice a su madre que la delicada situacin que atraviesan los aqueos, que
l mismo haba deseado, no le importa ya, una vez muerto Patroclo a manos
de Hctor:




Mas, qu placer obtengo yo de esto, despus de que muri mi compaero
Patroclo, al que estimaba por encima de todos los dems,
igual que a mi propia cabeza?

/DV SDODEUDV    SXHGHQ LQWHUSUHWDUVH GH GRV IRUPDV /D


primera, tal como hace, por ejemplo, Lpez Eire, establece una comparacin entre el modo en que Aquiles estima a Patroclo y estima a su cabeza
HVWRHVDVtPLVPR 3HURWDPELpQSRGUtDPRVHQWHQGHUTXHVHUHILHUH
DODIRUPDyFX\RDQWHFHGHQWHHV3DWURFORFRQORTXH$TXLOHVHVWDUtDGLFLHQGRTXHVXDPLJRHVLJXDODPLFDEH]DLGHQWLILFiQGRVHFRQpOGHPDQHUD
semejante a como veremos despus en la ancdota protagonizada por los
pitagricos, que precisamente mencionan tanto los escolios como Eustacio48
en sus comentarios a estos versos. As lo entiende tambin Pizzolato49, para
quien hay entre ambos hroes unos lazos que configuran ya una relacin de
recproca pertenencia (de alter ego, dice concretamente) que se refleja en
OD XQLyQ GH ODV IRUPDV  \  XQLyQ HQ OD TXH HO DGMHWLYR 
UHIXHU]DDOVXVWDQWLYR\FRQILHUHSRUHOORDXQOD]RVRFLROyJLFRLQV-

46
Cf. por ejemplo, Il. XVII 242 o XVIII 114. Pueden verse otros usos similares de
HQ2QLDQVSVV/DPHWRQLPLDVLJXHYLYDPiVGHGRVPLODxRVGHVSXpVHQ
las palabras de Constantino Acropolita que hemos comentado supra.

Lpez Eire 1989.
48
En el escolio a estos versos (Scholia in Homerum, Scholia in Iliadem [scholia uetera])
se recuerda precisamente la ancdota protagonizada por los pitagricos respecto a la definicin
de amigo, y tambin Eustacio (Commentarii ad Homeri Iliadem S   S   
VHxDODTXHHODPLJRHVDXQTXHVLQPHQFLRQDUD$ULVWyWHOHVQLDORVSLWDJyULFRV
s que alude al proverbio en Commentarii ad Homeri Iliadem p. 1359, 61 y tambin en Commentarii ad Homeri Odysseam, p. 1812, 53-54, refirindose a la amistad entre Odiseo y Nstor.
49
Pizzolato 1996, p. 32.

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

333

titucionalizado una carga de amor que personaliza el pacto genrico de la


KriegskameradschaftFDPDUDGHUtDJXHUUHUD
Se observa, por lo tanto, que en griego hay diferentes expresiones, ms o
menos marcadas, para la idea de otro l/otro yo. Dada la indiferenciaFLyQGHUHVSHFWRDODSHUVRQDDVtFRPRODFRQFXUUHQFLDGH
\FRQ\UHVSHFWLYDPHQWHQRHVGHH[WUDxDUTXHVHHQWLHQGDFRPRRWUR\RSHURHVWRHVLUPiVDOOiGH
lo que los propios textos dicen. Entre todos los testimonios recogidos pueden
KDFHUVHFODUDPHQWHGRVJUXSRVSRUXQODGRDTXHOORVHQTXHDSDUHFHQ
R\SRURWURDTXHOORVHQTXHDSDUHFHHOUHIOH[LYR(QHVWHVHJXQGRJUXpo tenemos, a su vez, dos posibilidades, los que mantienen la indiferenciacin sobre la persona (aunque en la prctica sea una tercera) y los que marcan
positivamente la primera, quizs arrastrados por aparecer con verbos tambin
en primera persona, si bien destaca el hecho de que esa primera persona se
ha desgramaticalizado y ya no coincide con el hablante. El hecho de que
GHVGHODNRLQpVHFRQYLHUWDHQXQVLPSOHSURQRPEUHGHWHUFHUDSHUVRQD
no correferencial con el sujeto hace necesario el empleo del reflexivo, que
puede aparecer de una forma ms o menos marcada: en el caso concreto de
+LPHULR FRQ HO UHIOH[LYR FRPSXHVWR  QR ROYLGHPRV TXH WDQWR HO
pasaje de Himerio como los dos posteriores tienen el verbo en primera persona), que prcticamente elimina el uso reflexivo que en origen podan tener
WDQWRORVSURQRPEUHVSHUVRQDOHVFRPR
III.

EL CONTENIDO: LA IDEA DE

OTRO YO

En todos estos pasajes se ha tratado de la idea de otro l/otro yo, de


un alter ego, expresin que, segn Herrero Llorente50VLJQLILFDSHUVRQDGH
confianza que representa a otra, amigo ntimo. En psicologa, alter ego suele
entenderse como la segunda personalidad de alguien, que puede dar lugar a
distintas alteraciones y patologas, mientras que en literatura hablar de un
alter ego, de otro yo, nos lleva al motivo del doble51, tambin conocido
como sosias, el otro, mi segundo yo o Doppelgnger. El tema del
V. Herrero Llorente 1980, s. u.
Sobre las denominaciones tema, motivo, etc., v. la introduccin a la tesis doctoral
GH0DUWtQ/ySH]8QHVWXGLRFOiVLFRVREUHHOWHPDGHOGREOHHOGH5DQNGHVWDFD
especialmente el mito de Narciso, pero en l no hay interaccin entre la imagen de Narciso,
50
51

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

334

VIRGINIA MUOZ LLAMOSAS

doble conoce un gran desarrollo a partir del Romanticismo, momento en el


que las interpretaciones psicoanalticas vern en el doble una materializacin
del lado oscuro del hombre, de su sombra, segn la terminologa junguiana.
Pero, lejos de esa conexin con el lado oscuro tan propia de la poca, encontramos el tema ya en la Antigedad, en relacin con dos personajes iguales
cuya aparente identidad puede dar lugar a enredos y equvocos, razn por la
que es explotado sobre todo en la comedia, como sucede, por ejemplo, en el
Anfitrin de Plauto52, donde Jpiter suplanta al marido de Alcmena y Mercurio, a su criado Sosias, o en los Menaechmi, donde dos gemelos, que han
vivido separados durante mucho tiempo, se reencuentran. En el primer caso,
la usurpacin de la identidad de otro individuo es consciente y deliberada,
pues Jpiter y Mercurio suplantan a Anfitrin y Sosias para que Jpiter pueda
tener a Alcmena. En cambio, en el segundo caso el engao es involuntario, y
los gemelos se reencuentran despus de que uno de ellos hubiera desaparecido siendo nio. Precisamente el tema de los gemelos es considerado como
una de las races antropolgicas del motivo del doble53, junto al simbolismo
en torno al alma y sus posibles manifestaciones en la sombra, el reflejo, el
retrato o la estatua, as como la creencia de que, en determinadas circunstancias, el alma pueda abandonar el cuerpo.
En un estudio que aplica los principios del estructuralismo, Dolezel54 habla
de tres variantes posibles de este motivo: el llamado tema de Anfitrin, donde
dos individuos homomorfos coexisten en un nico mundo ficticio y presentan
similitudes fsicas o de comportamiento, que dan lugar a equvoco; en segundo lugar, el tema de Orlando, donde un solo individuo existe en mundos ficticios alternativos; y, por ltimo, el tema del doble propiamente dicho, donde
encontramos dos encarnaciones diferentes, habitualmente antagonistas, de un
nico individuo en un solo mundo ficticio, con las posibilidades de que los
dobles sean simultneos o exclusivos, y de que haya o no autentificacin. La
idea de otro yo en relacin con la amistad, que no es contemplada por este
autor, estara prxima al tema de Anfitrin, en el sentido de que hay dos individuos diferentes que coexisten en un mismo mundo, pero no hay tensin ni

su doble, y los dems: la imagen tan slo es otro para l. Para una aproximacin general,
v. Fernndez Bravo 1996.
52
V. Garca Hernndez 2001.
53
 90DUWtQ/ySH]SVV
54
Dolezel 1985.
Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

335

se vive en este caso el doble como algo ajeno y problemtico. Ciertamente, la


percepcin de un desdoblamiento, de la existencia de un individuo cuya identidad parece repetir la propia, no provoca ninguna angustia cuando el otro yo
es el amigo. Aqu el doble es complementario y no rival, y estamos lejos del
aprovechamiento, que podramos calificar de negativo55, del motivo literario
del doble hacia la parte oscura, la animalidad e irracionalidad que subyace
dentro de nosotros y acecha y fascina a la conciencia56. Esto es algo ajeno a
las literaturas griega y latina, donde los escasos usos del doble sirven para
suplantar la personalidad, con una explotacin cmica del motivo en el Anfitrin de Plauto, o con una vertiente trgica y que nos lleva a la desesperanza
PiVDEVROXWDHQHOFDVRGHOGH+HOHQDHQODWUDJHGLDGH(XUtSLGHV
Muy al contrario, estaramos ante otra posibilidad totalmente distinta, la
que se orienta hacia el yo ideal, el alma gemela, la identidad soada de
la plena armona con el cosmos o de la identificacin y fusin de dos individuos originariamente independientes en uno solo, en lugar de la escisin de
un solo yo en dos. Resulta, por lo menos, curioso, el hecho de que el tema
del doble, del alter ego, no se haya puesto en relacin con el tema del amigo,
que es el que, como hemos podido ver, da lugar en la literatura griega a las
expresiones que hemos repasado anteriormente. Lo que sucede es que el
doble, que en principio era el yo idntico, se ha convertido en el yo opuesto,
perdiendo as toda posible vinculacin con el amigo.
La amistad ms perfecta que se puede concebir sera aquella en la que los
dos amigos parecen en realidad un solo hombre, y hay la mayor semejanza
posible entre ellos, lo que genera las expresiones antes comentadas, y tambin otras de uso comn que son recogidas por Aristteles58 FRPR 
En la literatura clsica no encontramos apenas ejemplos del tema del doble en su
YHUWLHQWH QHJDWLYD VL H[FHSWXDPRV HO FDVR GH +HOHQD \ VX  FX\R DQiOLVLV H[FHGH HO
propsito de este trabajo, y que curiosamente no es mencionado por los autores que hacen
un estudio estructural del tema, mientras que en la abundante bibliografa que existe sobre el
mito de Helena, sus versiones y las obras de Estescoro y Eurpides, no se profundiza en la
relacin entre esta versin del mito y el motivo literario del doble.
56
Son palabras de Herrero Cecilia 2006, p. 68.

Pero tal vez no sea ajeno al pensamiento griego, concretamente a las ideas que Platn
expone en el Fedro sobre la existencia de una duplicidad de las cosas, un lado siniestro percibido como negativo, v. vila Crespo 2000.
58
EN 9.8.1168b, aunque en realidad Aristteles no reflexiona sobre ello en este pasaje,
pues lo que est cuestionando es si uno debe amarse ante todo a s mismo, y si es o no vergonzoso el ser egosta. Plutarco nos habla tambin de ello en Moralia 96 d-f.
55

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

336

VIRGINIA MUOZ LLAMOSAS

XQDVRODDOPD59, que utiliza Eurpides60, referida a Electra y Orestes,


y que tanto recuerda al animae dimidium meae con que Horacio se dirige a
Virgilio61. Pero hablar de una sola alma no es exactamente lo mismo que
afirmar la existencia de dos almas independientes que se identifican entre s:
lo primero podra habernos llevado a una unin con el amigo similar a la que
propone Platn en el Banquete con el andrgino y la aorada unidad perdida,
que es deseada por cada mitad62, de igual modo que en Himerio su alma
desea el alma del amigo. Sin embargo, Himerio no utiliza la idea del andrJLQR DXQTXH Vt UHSLWH SDODEUDV FRPR HO YHUER  R HO FRPSXHVWR
HQOXJDUGHODIRUPDVLPSOHHPSOHDGDSRU3ODWyQVLQRTXHPiV
bien parece inspirarse en otro pasaje platnico, concretamente del Fedro,
donde Scrates tambin habla acerca del amor. Tras afirmar que toda alma es
inmortal y que slo las que han visto la verdad pueden tomar forma humana
E   6yFUDWHV OH H[SOLFD D )HGUR XQD FXDUWD IRUPD GH ORFXUD 
que se produce cuando alguien contempla la belleza de este mundo y, recordando la verdadera, le salen alas y quiere volar, pero como no puede, mira
hacia arriba y se olvida de las cosas de aqu, por lo que se lo toma por loco.
Recordar los seres verdaderos que hemos contemplado no es algo fcil, pero
puede conseguirse a travs de la visin de la belleza, cuyos efectos son descritos en un largo pasaje que comienza de la siguiente manera:

            

            
D
aquel cuya iniciacin es todava reciente, el que contempl mucho de las
de entonces, cuando ve un rostro de forma divina, o entrev, en el cuerpo, una
idea que imita bien a la belleza, se estremece primero, y le sobreviene algo de
los temores de antao y, despus, lo venera, al mirarlo, como a un dios, y si no

En EE 1240b3 Aristteles repite que es un tpico afirmar que los verdaderos amigos
WLHQHQ XQD VROD DOPD \ TXH OD DPLVWDG HV LJXDOGDG       
>@ 
60
Or. 1045.
61
C. I 3.8.
62
Pl., Smp. D
59

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0



tuviera miedo de parecer muy enloquecido, ofrecera a su amado sacrificios


como si fuera la imagen de un dios.

Este es el efecto que el amado tiene sobre el amante, una pasin a la que
los hombres llaman amor y en la que los amantes tratan de llevar al amado
D XQD WRWDO VHPHMDQ]D FRQ HOORV PLVPRV \ FRQ ORV GLRVHV TXH YHQHUDQ 
EF (ODPDGRDVXYH]YHFyPRVHOOHQDGH
amor su alma, aunque, en palabras de Scrates, no acierta a qu atribuirlo y
se olvida de que, como en un espejo, se est mirando a s mismo en el amanWH 
G \VLHQWHDOJRTXH6yFUDWHVGHILQHFRPRDQWLDPRU
como un reflejo del amor, aunque est convencido de que es amistad y as la
llama. Hay que recordar que para Platn la diferencia entre amistad y amor,
entre el amigo y el amado, es una cuestin de intensidad, mientras que Aristteles s hace una separacin entre ambos sentimientos y reflexiona sobre la
amistad sin ponerla en relacin con el amor63, y entendindola no como un
VHQWLPLHQWRRSDVLyQ SDVLYR\UHSHQWLQRVLQRFRPRSURGXFWRGHXQD
HOHFFLyQ DFWLYD\FRQVFLHQWH64.
IV.

CONCLUSIN

Para expresar sus sentimientos hacia el discpulo que se va, recurre Himerio,
por lo tanto, a la idea platnica de un alma que ve en otra (la del amado en
Platn o la del amigo en Himerio) una belleza que le hace recordar la visin
de la verdadera realidad que un da tuvo. Y, muy probablemente, tambin est
tomada de Platn la comparacin con la contemplacin en el espejo65, que hemos reencontrado en Aristteles. Himerio ha cumplido lo que anunciaba en la
GHOGLVFXUVRUHPRQWiQGRVHD3ODWyQQRVyORHQODIRUPDGLDORJDGD
(que apenas apreciamos, dado el estado fragmentario del discurso), sino
WDPELpQHQODVLGHDVDFHUFDGHODOPD\ORVVHQWLPLHQWRVDPRURVRV 
63
V. un tratamiento ms amplio del concepto de amistad en ambos filsofos en Pizzolato
1996, pp. 66-106, Vallejo Campos 2009, Vallejo Campos 2002, Calvo Martnez 2002 o Smith
Pangle 2008, especialmente el captulo Friends as other selves.
64
V. Pizzolato 1996, pp. 83-84 y, de forma muy similar, Vallejo Campos 2009, sobre la
UDFLRQDOLGDGGHODHOHFFLyQTXHLPSOLFDODDPLVWDGHQ$ULVWyWHOHVIUHQWHDOGH3ODWyQ
65
Himerio retoma el tema del espejo en 48.12, donde repite la idea de que las almas
divinas y recin iniciadas tienden a lo mejor.

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

338

VIRGINIA MUOZ LLAMOSAS

 TXH 0HQDQGUR HO 5pWRU YHtD FRPR WtSLFRV GH ORV GLVFXUVRV GH GHVpedida. A esta deseada y expresa inspiracin platnica se suma, en nuestra
opinin, un eco, hasta ahora inadvertido, bien de Aristteles, bien de los tradicionales proverbios acerca del amigo, que nos llega a travs de las palabras
TXHIRUPDQSDUWHGHXQDVHULHGHH[SUHVLRQHVPX\VLPLODUHV
entre s, que encontramos en griego para referirnos al concepto de otro yo.
Estas frmulas aparecen, como hemos visto, fundamentalmente en relacin
con el tema de la amistad y son origen del conocido latinismo alter ego.
BIBLIOGRAFA
Adrados, F. R. 1992: Nueva sintaxis del griego antiguo, Madrid.
vila Crespo, R. 2000: Identidad y alteridad. Una aproximacin filosfica al proEOHPDGHOGREOHRevista de Filosofa 20, pp. 5-23.
%LUDXG 0  eWXGH VHPDQWLTXH GX GHWHUPLQDQW G
 LSVHLWp  Lalies 9,
pp. 95-98.
Biraud, M. 1991: La determination du nom en grec classique, Niza.
Calvo Martnez, T. 2002: La concepcin aristotlica de la amistad, IX Jornadas
sobre la amistad. La amistad en la antigua Greciahttp://antiqua.gipuzkoakultura.net/amistad_eu.php!  
Colonna, A. 1951: Himerii. Declamationes et orationes cum deperditarum fragmentis, Roma.
Culbertson, P. L. 1996: Men and Christian friendship, en Krondorfer, B. (ed.),
Mens bodies, mens gods, Nueva York, pp. 149-180.
Dolezel, L. 1985: Le triangle du double; un champ thmatique, Revue Potique
SS
)DVVRXODNLV6The Byzantine family of Raoul-Ral(l)es, Atenas.
Fernndez Bravo, N. 1996: Doubles and Counterparts, en Brunel, P. (ed.), Companion to literary myths, heroes and archetypes, Londres, pp. 342-382.
Garca Hernndez, B. 2001: Gemelos y sosias. La comedia del doble en Plauto,
Shakespeare y Molire, Madrid.
Herrero Cecilia, J. 2006: El mito como intertexto: la reescritura de los mitos en las
obras literarias, edille. Revista de estudios francesesSS
Herrero Llorente, V. J. 1980: Diccionario de expresiones y frases latinas, Madrid.
Kazhdan, A. P. (ed.) 1991: The Oxford Dictionary of Byzantium, Nueva York.
Lan Entralgo, P. 1983: Teora y realidad del otro, Madrid.
Lpez Eire, A. 1989: Homero. Ilada, Madrid.
Martn Lpez, R. 2006: Las manifestaciones del doble en la narrativa breve espaola
contempornea, Universidad Autnoma de Barcelona.
Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

C O M E N TA R I O S A H I M E R I O 1 0 . 8 6 - 9 0

339

Montes Cala, J. G. 2006: Heracles en el Idilio IV de Tecrito, en Caldern, E.,


Morales, A. y Valverde, M. (eds.), Koins lgos. Homenaje al profesor Jos
Garca Lpez0XUFLDSS
Nicol, D. M. 1965: Constantine Akropolites. A prosopographical note, Dumbarton
Oaks Papers 19, pp. 249-256.
Onians, R. B. 1989: The origins of European thought, Cambridge.
3HQHOOD 5 -  Man and the Word. The orations of Himerius, Berkeley-Los
ngeles.
3IDII&0Oratio de egoismo, nova philosophia haeresi, Tubinga.
Pizzolato, L. 1996: La idea de la amistad en la Antigedad clsica y cristiana,
Barcelona.
5DQN2El doble, Buenos Aires.
Reeve, C. D. C. 2011: Plato on friendship and Eros, en Zalta, E. N. (ed.), The
Stanford Encyclopedia of Philosophy 6SULQJ  (GLWLRQ  KWWSSODWRVWDQIRUGHGX!  
Rodrguez Dons, M. 2009: La amistad en Cicern: crtica del utilitarismo, en Zamora Calvo, J. M. (ed.), La amistad en la filosofa antigua0DGULGSS
Smith Pangle L., 2008: Aristotle and the philosophy of friendship, Cambridge-Nueva
York.
Vallejo Campos, A. P. 2002: Elogio de la locura: amistad y amor en Platn y
Aristteles, en IX Jornadas sobre la amistad. La amistad en la antigua Grecia,
http://antiqua.gipuzkoakultura.net/amistad_eu.php! 
9DOOHMR &DPSRV $ 3  eURV \ 3KLOtD HQ 3ODWyQ \ $ULVWyWHOHV HQ =DPRUD
Calvo, J. M. (ed.), La amistad en la filosofa antigua0DGULGSS

)HFKDGHUHFHSFLyQGHODSULPHUDYHUVLyQGHODUWtFXOR
Fecha de aceptacin: 06/09/2012
Fecha de recepcin de la versin definitiva: 14/09/2012

Emerita LXXX 2, 2012, pp. 321-339

ISSN 0013-6662

doi: 10.3989/emerita.2012.16.1116

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 341-353
ISSN 0013-6662 doi: 10.3989/emerita.2012.17.1123

Isidore of Seville and comici ueteres. Ad Isid., Orig. VIII 7.7


Krzysztof Rzepkowski
Institute of Classical Studies. University of Warsaw
rzepkowski@uw.edu.pl

Isidoro de Sevilla y los comici ueteres. Ad Isid., Orig. VIII 7.7


Abstract: In chapter 7 of book VIII of Etymologies dedicated to Roman poets (De poetis), Isidore
draws a dividing line between the so-called ueteres
and noui comici. Among ueteres he counts Plautus, Accius, Terentius, although Accius, according
to our knowledge, composed only tragedies and
can hardly be considered a comic playwright. In
this paper I try to prove that all the palaeographic,
phonetic, historical, and literary arguments speak
in favour of emending in the discussed passage
the peculiar Accius to the expected Caecilius
(i.e. Caecilius Statius).

Resumen: En el captulo 7 del libro VIII de Las


Etimologas, dedicado a los poetas romanos (De
poetis), Isidoro de Sevilla separa ueteres de noui
comici. Son Plauto, Luccio Accio y Terencio los
que integran la nmina de los ueteres, aunque Accio, segn nuestro conocimiento, compuso slo
tragedias, as que resulta difcil considerarlo un
comedigrafo. En este artculo intento probar que
todos los argumentos paleogrficos, fonticos, histricos y literarios estn a favor de la enmienda del
peculiar Accius por el esperado Caecilius
(i.e. Cecilio Estacio).

Key words: Accius; Caecilius Statius; Isidore of


Seville; comic playwright; comici ueteres; comici
noui.

Palabras clave: Accius; Caecilius Statius; Isidoro


de Sevilla; comedigrafo; comici ueteres; comici
noui.

In chapter 7 of book VIII of Etymologies dedicated to Roman poets (De


poetis), Isidore draws a dividing line between the so-called ueteres and noui
comici, a line that became so important in medieval genre theory. In the editions of both Arvalo (Rome 1797), reprinted in Patrologia Latina 81-83
(1850), and Lindsay (Oxford 1911) this passage reads as follows:
Duo sunt autem genera comicorum, id est, ueteres et noui. Veteres, qui et ioco
ridiculares extiterunt, ut Plautus, Accius, Terentius. Noui, qui et Satirici, a
quibus generaliter uitia carpuntur, ut Flaccus, Persius, Iuuenalis uel alii (Isid.,
Orig. VIII 7.7).

342

KRZYSZTOF RZEPKOWSKI

There are two types of writers of comedies, that is the Old and the New. The
Old, who would amuse by means of a joke, such as Plautus, Accius, Terence.
The New, who are also called satirists, by whom vices are generally flayed,
such as Flaccus (i.e. Horace), Persius, Juvenal, and others1.

Regardless of theoretical and literary aspects of Isidores division of literary genres, it seems worthwhile to take a closer look at Accius, whom Isidore
counts among comici ueteres together with Plautus and Terence. According to
our knowledge, Accius composed only tragedies and can hardly be considered
a comic playwright, even in Isidores interpretation of this expression. This
fact had already been observed by Juan de Grial in his edition of Etymologies published in 1599 in Madrid and commonly used until the nineteenth
century. He emphasized that this place, with the reading Accius or Attius, is most probably corrupt: neque mihi dubium, quin aut haec aliena, aut
ualde deprauata sint2. On the other hand, Faustino Arvalo, publishing his
edition two centuries later but basing his commentary on De Grials remarks,
only suggested an error and limited himself to stating that Accius had been
a tragic playwright: Accius tragoediarum scriptor fuit3. Lindsay did not take
those suggestions into account; he just noticed that manuscript C from Leiden
transmitted a different reading for this place, namely: Accius et Terentius4.
Although Lindsay emphasizes in the preface that his edition is far from
being perfect (editionem inchoatam potius quam omnibus numeris absolutam, p. v), the Oxford edition of Etymologies is regarded as canonical until
today and is still almost uncritically used as a basis for translating Isidores
work into modern languages. Among the latest translations, two are especially worth of mentioning: the English one published in Cambridge in 2006
(second edition in 2010) and the Italian one from 20045. In both of them,

1
2

Barney, Lewis, Beach, Berghof 2006, p. 180b.


Arevalo 1797, p. 366 (Arvalo cites more important remarks of De Grial in commen-

tary).
Arevalo 1797, p. 367.
Because this codex, as Lindsay 1911, p. vii, notes, contains a text collated from manuscripts belonging to two different families, it is of little value for reconstructing the archetype.
5
The Etymologies of Isidore of Seville, translated, with introduction and notes, by S. A.
Barney, W. J. Lewis, J. A. Beach, O. Berghof, Cambridge: Cambridge University Press, 2006
and 2010; Etimologie o Origini, a cura di A. Valastro Canale, Torino, UTET, 2004.
3
4

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

343

however, just as in many others that I had chance to read6, the discussed passage is lacking any appropriate commentary. As has already been noticed, the
division made by Isidore influenced the later classification of literary genres,
based on stylistic and objective criteria, which is why the discussed fragment
is frequently quoted not only in publications on medieval Latin poetry, including the so-called elegiac comedy of the twelfth century, but also in more
general works dealing with the medieval genre theory. In most cases, the
presence of Accius among Plautus and Terence is commented on in a way
similar to that of Arvalo, but sometimes it is even explained in terms of
medieval ignorance. Such is, for example, the explanation proposed by the
author of a recent treatise on Fulgentius, a mythographer from the turn of the
fifth to the seventh century; the scholar, quoting the passage from Isidore,
added the following footnote: En ralit, Accius est un auteur tragique. Mais
le Moyen Age ne connat plus rien de thtre antique, depuis la fermeture des
thtres a Rome en 5467.
It is worth noticing that two later medieval texts classifying comic playwrights according to Isidores principles, namely Elementarium doctrinae
erudimentum by Papias (11th cent.) and Comentum super Dantis Aldigherii
Comediam by Benvenuto da Imola (14th cent.), do not count Accius among
comici ueteres, although they quote Isidores passage almost literally. In Papias encyclopaedia, antique comici are represented solely by Terence, who
gained the simple designation of Comicus already in Late Antiquity8:
Comici res laetas, tragici argumenta ex rebus luctuosis describunt. Duo sunt
genera comicorum, ueteres qui ioculares9 extiterunt, ut Terentius, noui qui
satyrici quibus generaliter uitia carpuntur, ut Persius, Iuuenalis, et nudi pinguntur eo quod uitia denudent (Elementarium doctrinae erudimentum, s.v.
comici).

6
E.g. Las Etimologas de San Isidoro romanceadas, ed. J. G. Cuenca, Salamanca, Ediciones Universidad de Salamanca, 1983.
7
Wolff 2009, p. 178, n. 11.
8
Cf. Hier., Ep. 54 (PL 22, 554).
9
It is worth considering whether the word ioculares is a corrupt form of the phrase
ioco ridiculares, present in Isidores text, or, the other way around, the original ioculares,
still read by Papias in his copy of Etymologies, corrupted into the peculiar expression ioco
ridiculares in an early phase of the transmission of the text.

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

344

KRZYSZTOF RZEPKOWSKI

On the other hand, in his commentary to The Divine Comedy, Benvenuto


added Ovid to Plautus and Terence, classifying him as a comic playwright on
account of stylus bassus:
Satyra est stylus medius et temperatus, tractat enim de uirtutibus et uiciis; et
talia describentes uocantur Satyri, siue Satyrici; sunt enim satyri uitia reprehendentes, sicut Horatius, Iuuenalis, et Persius. Comoedia est stylus bassus et
humilis, tractat enim uulgaria et uilia facta ruralium, plebeiorum, et humilium
personarum; et talia describentes uocantur comoedi, siue comici, sicut Plautus, Terentius, Ouidius10.

It is hard to arrive at any unambiguous conclusions concerning the omitting of Horace, Plautus, and Accius by Papias on the one hand and the replacing of Accius with Ovid by Benvenuto on the other. The absence of Accius in
both works seems not to be completely accidental, nevertheless.
In attempts at emending the discussed passage of Etymologies, a suggestion was made that the word Accius could be a corrupt form of Maccius,
alleged11 Plautus nomen gentile. Although Usener 2010 (19141), p. 39, n. 53,
recommended renouncing this conjecture already a century ago, it has recently been recalled in a new edition of Etymologies in the Collection ALMA
series12. For this reason, I think that this conjecture should be re-examined.
Indeed, at first sight it seems attractive, all the more so since a similar error
can be found in codices transmitting Gellius work. In chapter 3 of book III
of Noctes Atticae, Gellius cites, after Varro, the opinion of Accius about the
authenticity of some plays ascribed to Plautus, perhaps presented in Didascalia. The comic playwright appears twice in this fragment, once as Plautus
and again as Macc[i?]us Titus, a form that Plautus himself used in the comedy Mercator13:
M. tamen Varro in libro de comoediis Plautinis primo Accii uerba haec ponit:
Nam nec Geminei lenones nec Condalium nec Anus Plauti nec Bis compressa nec Boeotia unquam fuit neque adeo Agroecus neque Commorientes
Macci Titi (Gell., Noct. Att. III 3.9).
Lacaita 1887, p. 18.
Cf. Gratwick 1973, pp. 78-84.
12
Cf. Pocia Prez 1991, p. 246.
13
Cf. Pl., Merc. 10-11: Graece haec uocatur Emporos Philemonis, / eadem Latine Mercator Macci Titi.
10
11

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

345

Manuscripts give the reading m. (with tilde) accii or m. (with tilde)


actii instead of Macci14, presumably under the influence of the form Accii appearing earlier in the text. It cannot be excluded either that the copyist
assumed that Gellius had in mind an author other than Plautus, who appears
one line above, hence he interpreted the form Macci as the initial of the
praenomen (M.) and the nomen gentile (Accii). To acknowledge a similar mistake also in Isidores work would require that at least three additional assumptions should be fulfilled: Firstly, that in this place Isidore called
the Roman playwright by his nomen gentile, while in the remaining seventeen cases he called him simply Plautus; secondly, that he did not precede the
nomen and cognomen with T., that is the initial of Plautus name; and
thirdly, that the form Maccius Plautus transformed into Plautus Maccius
and then into Plautus Accius, losing on the way the M in the onset, differently than in manuscripts with Gellius work. It is also hard to suppose that
the word Maccius was a gloss, inserted in the text by a subsequent copyist,
because the name of Plautus did not require additional explanations, and
certainly not with the use of the doubtful and unused (except sporadically)15
nomen gentile. The corruption of the form Maccius in Gellius text could,
by the way, be considered a proof that Plautus nomen gentile was unknown
in the Middle Ages.
From the historical and literary perspectives, a person expected in this
place should be Caecilius Statius. Just as Cratinus, Eupolis, and Aristophanes
constitute the trinity of the Old Attic tragic playwrights, and Philemon, Diphilus, and Menander the trinity of the New Comedy16, so Plautus, Caecilius,
and Terence are the trinity of palliata, among whom Caecilius was awarded
the first place by Volcacius Sedigitus17. They are listed together in Varros
Saturarum Menippearum:
For a complete critical apparatus concerning this place, see Hertz 1883, p. 202.
Cf. Gell., Noct. Att. III 3.9.
16
Cf. Vell. I 16.3; Diomedes, Artis grammaticae libri III, GL 1.489; Rufinus, De metris
comicis, GL 6.564 7.
17
Cf. Gell., Noct. Att. XV 24.1. It is worth noticing that in Republican Rome this playwright was most often called Caecilius (e.g. Ter., Hec. 14; Cic., Att. VII 3.10), sometimes
Caecilius Statius (cited Volcacius Sedigitus), and only rarely Statius (cf. Cic., Sen. 25). From
the time of the poet Statius (died AD 96), this name was used exclusively for this latter writer,
and the comic playwright Caecilius Statius was almost invariably called by his nomen gentile,
namely Caecilius (Hor., Ars 54, Quint. passim, Suet. passim, Fest. passim, Gell. passim, with
14
15

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

346

KRZYSZTOF RZEPKOWSKI

in argumentis Caecilius poscit palmam, in ethesin Terentius, in sermonibus


Plautus (Var., Menip. frg 399),

and, subsequently, in one of Horaces letters as the only authors of the palliata:
Plautus ad exemplar Siculi properare Epicharmi,
uincere Caecilius grauitate, Terentius arte (Hor., Ep. II 1.58-59).

Already Usener 2010 (19141), p. 39, n. 53, pointed to Caecilius as the


author required in the discussed Isidores passage, yet he did not venture to
propose such a conjecture. He considered it probable that Isidore himself
wrote Accius in his text, and that the error was on the part of Isidores
source manuscript. A similar mistake, as observed by Usener, can be found
in the Evantius preface to a lost commentary to Terences plays, published
as De fabula hoc est de comedia, where Accius is also mentioned, although
the whole passage pertains to palliata:
Haec cum artificiosissima Terentius fecerit: tum illud est admirandum, quod
et morem retinuit, ut comoediam scriberet, et temperauit affectum, ne in tragoediam transiliret. Quod cum aliis rebus minime obtentum et a Plauto et ab
Afranio et Accio et multis fere magnis comicis inuenimus (Euanth. 3).

In the nineteenth century the phrase et Accio was emended to et Atta


or et Atilio. However, already Usener noticed that both these conjectures
disregard the preposition a, which per analogiam to a Plauto and ab
Afranio is stylistically prerequisite in this place. Hence, according to Useners reasoning, the process of corruption could have assumed the following
pattern:
a caecilio > a cecilio > acccilio > accilio > accio

the exclusion of IV 20.12, where Gellius explains that the name Statius belonged to slaves
and that this was the original name of Caecilius, who only later started to be called Caecilius
Statius). In the second century, the only exception to the rule is Apuleius, who consequently
calls the playwright Caecilius Statius (Apul., Ap. 5); apart from encyclopaedic works, which
sometimes give both his nomen gentile and cognomen (e.g. Hier., Chron. Abr. 1838), all the
remaining authors, both ancient and medieval, call him simply Caecilius.
Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

347

In this way Accius replaced Caecilius and could as well have been regarded as a comic playwright by later readers of Evantius together with
Plautus, Afranius, and Terence.
The conjecture put forward by Usener seems very likely and I accept it
without question. The hypothesis that the mistake had already been present
in the source manuscript used by the bishop of Seville is convincing as well;
in fact, so convincing that, to the best of my knowledge, no one has ever tried
to reexamine this passage of Etymologies since Usener. However, since Evantius belongs to the same group of commentators as Donatus, whom Isidore
cites several times, it seems worthwhile to examine the possibility that the
source text with the erroneous reading Accio was Evantius treatise De
fabula. The answer to this question is, in my opinion, negative: even if Isidore knew this text, no trace of this knowledge can be found in Etymologies;
in contrast to Donatus, Evantius is neither mentioned nor cited nor referred
to by Isidore. Moreover, Evantius presented a different classification of the
old and new comedy, a division that cannot be found in Isidore. He regarded
Eupolis, Cratinus, and Aristophanes as the representatives of the comoedia
uetus, Lucilius as the inventor of a new kind of satire (quod primus Lucilius
nouo conscripsit modo), and Menander and Terence as the main representatives of the noua comoedia, to whom he added Plautus, Afranius, and the
author transmitted as Accio and plausibly interpreted by Usener as Caecilius. To replace this classification (valid until present, by the way), Isidore
proposed his own in which Plautus and Terence were comici ueteres and
Horace, Persius, and Juvenal comici noui, also called satirists (satirici). It is
obvious that one should not expect the semantic fields of these terms (comoedia uetus vs. comici ueteres oraz comoedia noua vs. comici noui) to correlate:
classical authors used the phrase comici ueteres to denote both authors of
the Old Comedy18 and ancient/earlier comic playwrights, clearly in the
meaning authors of the palliate19. Similarly, the term uetus comoedia apCf. Cic., de Orat. III 138; Quint., Inst. XII 2.22.
Cf. Quint., Inst. I 7.22, where Quintilian, citing Terence (Ter., Ph. 36), gives an example
of the use of the form heri next to here: Here nunc e littera terminamus: at ueterum
comicorum adhuc libris inuenio heri ad me uenit; cf. also Gell., Noct. Att. XIII 23.16,
where Gellius mentions Licinius Imbrex, an otherwise unknown author of the palliata from
the second century BC, whom he describes with the epithet vetus comoediarum scriptor, and
Rufinus, De metris comicis, GL 6.564 7, where Latin comic playwrights are called nostri
veteres comoediae scriptores.
18
19

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

348

KRZYSZTOF RZEPKOWSKI

pears to mean both the Old Comedy20 and the ancient/early comedy21.
In view of the above facts, in order to consider Evantius the source of Isidores mistake, we would have to assume that the bishop of Seville, having
Evantius corrupted text at his disposal, disagreed with the genre theory described there, but he derived from there the information about the authors of
the New Comedy, whom, in contrast to Evantius, he called ancient/early
(ueteres).
Therefore, I believe that Isidores mistake originated independently of
Evantius De fabula, which could by no means be the source of the part of
Isidores work dedicated to the poets (De poetis). Where then did Isidores
inspiration to divide the comic playwrights into ueteres and noui (satirici)
come from? Among many authors from which Isidore derived while writing
Etymologies, St Jerome was certainly the most important. Isidore mentions
him by name ten times, which places him after Aristotle (mentioned fifteen
times), but before Cato (nine times), Plato (eight times), Pliny (seven times),
Donatus (six times), and St Augustine (five times)22. He is the only author
whom Isidore explicitly cited as his source23:
Beatissimus Hieronymus, uir eruditissimus et multarum linguarum peritus,
Hebraeorum nominum interpretationem primus in Latinam linguam conuertit.
Ex quibus pro breuitate praetermissis multis quaedam huic operi adiectis interpretationibus interponenda studui (Isid., Orig. VII 1.1).

The study of Isidores text has proven that the bishop of Seville made
use of not only Liber interpretationis Hebraicorum nominum but also other
Jeromes works, most importantly Chronicle, as an indispensable tool in
establishing chronological sequence24. In this work Isidore found a remark
about Accius, which could prevent him from counting the writer among the
comic playwrights:

Cf. Cic., Leg. II 37, Brut. 224; Hor., Ars 281; V. Max. VIII 9ext.2.
Cf. Plin., Ep. 6.21.2, where Vergilius Romanus is mentioned, an author who wrote
comedies ad exemplar ueteris comoediae, imitating plays of Menander and his contemporaries; cf. also Suet. Aug. 89.1, where the term uetus comoedia almost certainly designates the
New Comedy (see Goldberg 2005, p. 163, n. 49).
22
Ibidem.
23
Cf. Barney, Lewis, Beach, Berghof 2006, p. 13.
24
Ibidem.
20
21

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

349

Lucius Accius tragoediarum scriptor clarus habetur (Hier., Chron.


Olymp. CLX).

Moreover, he learned from Chronicle about the distinction between


scriptores comoediarum (Caecilius and Terence) and satirici (Horace and
Persius)25:
Statius Caecilius comoediarum scriptor clarus habetur (Hier., Chron.
Olymp. CL).
Publius Terentius Carthaginensis comoediarum scriptor (Hier., Chron.
Olymp. CLV).
Horatius Flaccus, satiricus et lyricus poeta (Hier., Chron. Olymp. CLXXVIII).
Persius Flaccus, satiricus poeta (Hier., Chron. Olymp. CCIII)-

However, it is other Jeromes works that appear to be crucial in the interpretation of the discussed passage from Etymologies, namely his letters and
commentaries, where he presented his views on the best translation method.
As a proof of the validity of his concept, put forward in the famous postulate
non uerbum e uerbo, sed sensum exprimere de sensu, Jerome always cites the
same set of model translations whose authors did not render original works
word for word, but rather attempted at expressing their sense. These examples are Ciceros translations of, most importantly, Platos Protagoras and
Xenophons Economics, and the comedies of Plautus, Caecilius, and Terence.
The three comic playwrights are referred to in such a context in the letter Ad
Sunniam et Fratelam:
'XPLQWHUSUHWDWLRQLVVHTXLPXURPQHPGHFRUHPWUDQVODWLRQLVDPLWWLPXV HW KDQF HVVH UHJXODP ERQL LQWHUSUHWLV XW  OLQJXDH DOWHULXV
suae linguae exprimat proprietate. Quod et Tullium in Protagora Platonis, et
LQ;HQRSKRQWLVHWLQ'HPRVWKHQLVFRQWUD$HVFKLQHQRUDWLRQHIHcisse conuincimus; et Plautum, Terentium, Caeciliumque eruditissimos uiros,
in Graecis comoediis transferendis (Hier., Ep. IV 106.4),

25

Plautus is not attributed to any category, and Juvenal is not even mentioned in Chroni-

cle.
Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

350

KRZYSZTOF RZEPKOWSKI

in Commentary on the Book of Prophet Micheas:


Si enim criminis est Graecorum benedicta transferre, accusentur Ennius et
Maro, Plautus, Caecilius et Terentius, Tullius quoque et ceteri eloquentes
uiri, qui non solum uersus, sed multa capita et longissimos libros ac fabulas
integras transtulerunt (Hier., Commentariorum in Michaeam Prophetam 2,
Prologus 230-234)

and in the famous letter to Pammachius of AD 395 (Ep. 57), known more
widely as the treatise On the best kind of translating (De optimo genere interpretandi):
Sed et Horatius, uir acutus et doctus, hoc idem in Arte poetica erudito interpreti praecipit:
nec uerbum uerbo curabis reddere fidus
interpres
Terentius Menandrum, Plautus et Caecilius ueteres comicos interpretati sunt:
Numquid haerent in uerbis: ac non decorem magis et elegantiam in translatioQHFRQVHUXDQW"4XDPXRVXHULWDWHPLQWHUSUHWDWLRQLVKDQFHUXGLWL
nuncupant (Hier., Ep. LV 5.5).

The term ueteres comici used here undoubtedly designates the authors
of the New Comedy, Philemon and Diphilus, and not the Old Comedy, as is
maintained by Bartelink 1980, p. 55, one of the most prominent commentators of Jeromes treatise. Indeed, Jerome used the term uetus comoedia in
the meaning the Old Comedy in letter CXXV to Rusticus26, but in this
fragment he wrote about the ueteres comici in the same sense as Quintilian
quoted above (Inst. I 7.22), namely as other comic playwrights as ancient
as Menander. It is worth noticing that for a reader of this letter living at the
end of the sixth century, like Isidore, Terence, Plautus, and Caecilius must
have been as ancient as Philemon and Diphilus, thus they all were considered
ueteres comici.
Putting together the pieces of information about the comic playwrights
and satirists found in Chronicle and the three mentions about Plautus, Ter26
Cf. Hier., Ep. CXXV 5: Scio me offensurum esse quam plurimos, qui generalem de
uitiis disputationem in suam referant contumeliam et, dum mihi irascuntur, suam indicant
conscientiam multoque peius de se quam de me iudicant. Ego enim neminem nominabo nec
ueteris comoediae licentia certas personas eligam atque perstringam.

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

351

ence, and Caecilius, including most of all the one in the letter to Pammachius, I think that it was Jerome who influenced Isidores concept expressed in
the passage under scrutiny. Isidore listed the comic playwrights in the chronological order: Plautus (died 184 BC), Caecilius (died c. 168 BC), and Terence (died after 160 BC). He was equally scrupulous in the case of the three
comici noui: Horace (died 8 BC), Persius (died AD 62), Juvenal (died AD
130). It is worthwhile to note that Isidore did not mention or cite Accius at
all, but he very well knew Caecilius by his own name27. He even quoted fragments of Caecilius plays unknown from other sources:
(1) Si confidentiam adhibes, confide omnia. (fr. 246; Orig. X C.40)
(2) Venerio cursu ueni, prolato pede
usque ad scaphonem. (fr. 243; Orig. XIX 4.5)

Therefore, I conclude that the discussed fragment originally read as follows:


Duo sunt autem genera comicorum, id est, ueteres et noui. Veteres, qui est
ioco ridiculares extiterunt, ut Plautus, Caecilius, Terentius.

The corruption of caecilius into accius resulted from the coincidence


of two factors, palaeographic and phonetic. In new Roman cursive as well as
in book semicursive scripts deriving from it, the letter a is open and resembles a u or a double c (cc). Many instances of mistaking a and u in codices
with Isidores text prove that the archtype was written in such a script:
Orig. VIII 3.6: colant : colunt K
Orig. VIII 7.10: transducant : transducunt B
Orig. XIV 6.32: siculo : sicalo B
Orig. XVII 9.61: Symphytos : semputus K : simpatus DTU

27
It should be noted, however, that in the remaining two places where Caecilius is unquestionably meant, his name is corrupt:
Orig. XIX 4.5: De quo Caecilius (cecilius N : cicilius codd.)
Orig. X C.40: Unde et Caecilius (cicilius codd. : ciuilius A : cilicius M).

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

352

KRZYSZTOF RZEPKOWSKI

The letter c together with the ligature ae can easily be misread for ac,
which is why, as is shown on the drawing below28, the name caecilius can
be misread for accilius:

The phonetic factor added to the problem together with the late Latin
tendency to palatalize the li-group, a tendency that finds confirmation in
epigraphy (fia < filia, CIL 1.1347), diachronic linguistics of the Romance
languages (e.g. Spanish ajo < alium; paja < palia < paleam; foja, foia (later
hoja) < folia; mejor < meliorem)29, and similar corruptions in codices transmitting Isidores text. For example, codex T originating from Spain (Toletanus from the eighth or ninth century)30 gives the reading lucius for lucilius in two places:
Orig. I 33.5: Lucilius centum genera soloecismorum dixit (lucius T)
Orig. XIX 12: Principaliter autem lacus dicitur, ut Lucilius (lucius B [Bernensis from 9th-10th cent.] and T)
28
 ,ZRXOGOLNHWRWKDQN7RPDV]3yFLHQQLN ,QVWLWXWHRI$UFKDHRORJ\8QLYHUVLW\RI:DUsaw) for helping with palaeographic problems and writing both words in new Roman cursive.
29
Cf. Penny 2002, p. 64.
30
Cf. Lindsay 1911, p. xi.

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

ISIDORE OF SEVILLE AND COMICI UETERES

353

Thus, the palatalization caused the word accilius to be written accius.


To conclude, I would like to state that all the palaeographic, phonetic, historical, and literary arguments speak in favour of emending in the discussed
passage the peculiar Accius to the expected Caecilius.
BIBLIOGRAPHY
Arevalo F. (ed.) 1797: S. Isidori Opera omnia, vol. III, Rome.
Barney, S. A., Lewis, W. J. , Beach, J. A., Berghof, O. (eds.) 2006: The Etymologies
of Isidore of Seville, Cambridge.
Bartelink, G. J. M. 1980: Hieronymus, Liber de optimo genere interpretandi (epistula 57), ein Kommentar von G.J.M. Bartelink, Leiden
Goldberg, S. M. 2005: Constructing Literature in the Roman Republic: Poetry and
Its Reception, Cambridge.
Gratwick, A. S. 1973: Titus Maccius Plautus, Classical Quarterly 23, pp. 78-84.
Hertz, M. (ed.) 1983: A. Gellii Noctium Atticarum libri XX, vol. I, Berlin.
Lacaita, J. F. (ed.) 1887: Benvenuto da Imola, Comentum super Dantis Aldigherii
Comoediam, vol. I, Florence.
Lindsay, W. M. (ed.) 1911: Isidori Hispalensis Episcopi Etymologiarum siue Originum libri XX, Oxford.
Penny, R. 2002: A History of Spanish Language, Cambridge.
Pocia Prez, A. 1991: El teatro latino en Las Etimologias de Isidoro de Sevilla,
en Ramos Guerreira, A. (ed.), Mnemosynum. C. Codoer a discipulis oblatum,
Salamanca, pp. 245-257.
Usener, H. 2010: Kleine Schriften, vol. 3, Cambridge (first edition 1914).
Wolff, . 2009: Fulgence, Virgile dvoil, Villeneuve dAscq.

Fecha de recepcin de la primera versin del artculo: 19/10/2011


Fecha de aceptacin: 01/08/2012
Fecha de recepcin de la versin definitiva: 05/09/2012

Emerita LXXX 2, 2012, pp. 341-353

ISSN 0013-6662

doi: 10.3989/emerita.2012.17.1123

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 355-370
ISSN 0013-6662 doi: 10.3989/emerita.2012.18.1118

Ille quidem totam gemebundus obambulat Aetnen:


el Cclope ovidiano como inspiracin pardica en Petronio,
Sat. 100.3-5
Marcos Carmignani
CIECS-CONICET. Universidad Nacional de Crdoba
marcoscarmignani@gmail.com

Ille quidem totam gemebundus obambulat Aetnen:


Parodic allusions to Ovidian Cyclops in Petronius, Sat. 100.3-5

Este trabajo analiza la funcin de las alusiones al


lamento del Cclope ovidiano en las palabras de
Trifena y en la reaccin de Encolpio (Sat. 100.3-5).
Estas alusiones parodian la actitud del Cclope homrico y, en general, el tema de la aventura por
mar, ineludible en la novela sentimental griega. Si
bien el episodio homrico es el modelo ms ilustre
de toda alusin al Cclope, Petronio busca enriquecer el texto con otras connotaciones que median y
complican las relaciones entre el Satyricon y Homero: esas connotaciones son las alusiones a Ovidio que permiten, mediante el cambio de tono, la
parodia. Ese cambio de tono del que el Satyricon se
sirve est dado por el uso de tremebundus, que
alude a Ovidio, Met. XIV 188 (gemebundus). La
alusin implica una degradacin, es la marca intertextual que nos deja Petronio para comprender que
la reaccin de Encolpio carece absolutamente de
decorum.

This paper analyzes the function of the allusions


to the lamentation of the Ovidian Cyclops in the
words of Tryphena and in Encolpius reaction (Sat.
100.3-5). These allusions parody the attitude of the
Homeric Cyclops and the topic of the adventure by
the sea, which is a recurrent theme in the Greek
idealistic novel. Although the Homeric episode is
the most renowned model of any allusion to the
Cyclops, Petronius enriches the text with other connotations that mediate and complicate the
relationship between the Satyricon and Homer:
these connotations are the allusions to Ovid that,
by means of a change in tone, allow the parody
to take place. This change of tone is realized by
the use of tremebundus, which alludes to Ovid,
Met. XIV 188 (gemebundus). The allusion implies
a form of degradation, which is the intertextual
mark that Petronius leaves to make us understand
that Encolpius reaction absolutely lacks decorum.

Palabras clave: Satyricon; Metamorphoses; Odisea; intertextualidad; tono pattico; parodia; tremebundus-gemebundus.

Keywords: Satyricon: Metamorphoses; Odissey; intertextuality; pathetic tone; parody; tremebundusgemebundus.

356

MARCOS CARMIGNANI

El proceso de imitacin en el Satyricon implica siempre la inversin de la


forma asumida como modelo: la novela se configura como una degradacin
de los gneros literarios puestos en juego. La primera degradacin que el
lector culto de la poca debe haber notado es la inversin de la pica, sobre
todo de los esquemas narrativos de la Odisea. El primero que propuso que
el Satyricon es una parodia de la Odisea fue Klebs 1889, que justific su hiptesis mediante el buen nmero de temas odiseicos que reaparecen en la
obra, principalmente la ira de Prapo (Sat. 139.2) como inversin de la ira de
Poseidn, es decir, si este persegua a Odiseo porque el hroe haba cegado
a su hijo Polifemo, Prapo persigue a Encolpio para vengar alguna ofensa
sufrida1. Algunos temas que se repiten, entre otros, son: la indagacin acerca
del origen y condicin del hroe realizada por Penlope (Od. XIX 105) en
el Satyricon tiene su correlato en la introduccin del episodio crotoniata,
cuando los protagonistas caen in turbam heredipetarum sciscitantium quod
genus hominum aut unde ueniremus2 (Sat. 124.2); la pelea de Odiseo con su
corazn (Od. XX 13-22) reaparece bajo otro formato cuando Encolpio litiga
con su miembro viril (Sat. 132.13); la presencia de una divinidad salvadora,
la Atenea homrica, encuentra su reflejo en Mercurio, salvador y protector
de Encolpio (Sat. 140.12); y, finalmente, la secuencia narrativa fundamental
es la transformacin de Encolpio en Polieno y su encuentro con Circe (Sat.
127 ss.). No se trata de un mero divertissement pardico (como ocurre con
la Apocolocyntosis de Sneca): la transformacin del modelo comporta finalmente la del protagonista, degradado en un impotente Polieno.
Despus de la Cena Trimalchionis es cuando la Odisea asume un valor de
marco intertextual general de la obra3. Dejando de lado el episodio de CircePolieno, las alusiones al Cclope son el primer paso para la configuracin del
1
Sin embargo, no hay un consenso definitivo acerca de si la figura de Prapo puede
llegar a ser (o no) un elemento estructural y clave de interpretacin de la obra. Vanse las
diferentes posturas de Walsh 1970, p. 76; Kragelund 1989, p. 439; Connors 1998, p. 27; Ernout
1958, p. XIV; Callebat 1998, p. 43, n. 31; Slater 1990, p. 41, n. 10. Quizs los dos extremos
opuestos estn representados por Sullivan y Baldwin. Sullivan 1968, pp. 21-71, reconstruye
el texto a partir de la ira Priapi, mientras que Baldwin 1973, pp. 294-296, asegura que, ms
que elemento estructural del Satyricon, la ira Priapi es una obviedad que no tiene nada que
ver con la parodia de la pica.
2
El texto latino del Satyricon corresponde al de Mller 1995.
3
La bibliografa sobre el tema es abundante. Cf. Collignon 1892, p. 316 ss.; Ciaffi 1955,
p. 130, passim; McDermott 1983; Fedeli 1988; Ferri 1988; Danese 1989, p. 213 ss.; Connors
1998, p. 37 ss.; Courtney 2001, p. 152 ss.; Cugusi 2001.

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

357

episodio odiseico del Satyricon, que tiene su inicio en el stabulum. All,


nuevamente encontramos a los personajes enredados en su tringulo amoroso: Encolpio se sorprende con la llegada de Ascilto, que busca a su amante
Gitn; desesperado, el narrador le ordena al frater que se esconda bajo el
camastro y que se sujete de pies y manos con las cinchas para que no lo
encuentren:
ac sic ut olim Vlixes pro arieti adhaesisset, extentus infra grabatum scrutantium eluderet manus. non est moratus Giton imperium momentoque temporis
inseruit uinculo manus et Vlixem astu simillimo uicit. (Sat. 97.4-5)

El pasaje alude claramente a la Odisea IX 425 ss. cuando Odiseo elige


como medio de escape el vientre lanudo de un carnero. Luego de que Ascilto
comprueba que Gitn no est en la habitacin (por medio del seruus publicus
que revis el catre y no encontr nada), Eumolpo ingresa en el cuarto. Encolpio le pide, fingiendo no saber nada de Gitn, que encuentre al muchacho,
pero este estornuda y su escondite queda al descubierto (remota etiam culcita
uidet Vlixem, cui uel esuriens Cyclops potuisset parcere, Sat. 98.5).
El segundo episodio donde la figura del Cclope tiene un valor intertextual
clave es el de la nave (Sat. 100-115)4. Eumolpo define a Licas, dueo de la
nave, como hic est Cyclops ille et archipirata, cui uecturam debemus (101.5)
y luego de enterarse de que Encolpio y Gitn son fugitivos dice fingite ... nos
antrum Cyclopis intrasse (101.7), es decir, la nave como antrum. El episodio
contina con ciertas estratagemas para ocultar a los fugitivos de sus perseguidores, pero finalmente Encolpio y Gitn son descubiertos y condenados a
cuarenta azotes cada uno. Lo que importa es cmo se produce el reconocimiento de Encolpio:
Lichas ... accurrit et nec manus nec faciem meam considerauit, sed continuo
ad inguina mea luminibus deflexis mouit officiosam manum et salue inquit
Encolpi. miretur nunc aliquis Vlixis nutricem post uicesimum annum cicatricem inuenisse originis indicem (Sat. 105.9-10)

Indudablemente, la alusin es al reconocimiento de Odiseo por parte de


Euriclea en la Odisea XIX 386 ss., en lo que puede interpretarse dentro de
Fedeli 1981 concluye que todo el episodio de la nave de Licas hace referencia al encuentro del Cclope y Odiseo en la Odisea.
4

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

358

MARCOS CARMIGNANI

la categora de exempla escolsticos constituida por las famosas escenas de


reconocimiento, ya sean dramticas (Electra con Orestes) o picas (Odiseo y
Euriclea). El reconocimiento de Licas, extremadamente burlesco, sirve para
comprender el modo como funciona el peso de la tradicin literaria en Encolpio, que, aun en una situacin comprometedora, recuerda el famoso episodio
de Euriclea: incluso en peligro no puede librarse de las grandes obras de la
literatura. Pero, como seala Conte 2007, p. 55, el Satyricon nuevamente
va ms all al hacer que Encolpio evoque no slo los textos cannicos, sino
tambin sus anotaciones: Encolpio nota que Licas no est siguiendo el cdigo heroico de la etiqueta, puesto que ignora las seales nobles, es decir, las
manos y los rasgos del rostro. La parodia es, por otra parte, increblemente
explcita y, por cierto, de gran comicidad.
Pero el pasaje que nos interesa ocurre un poco antes, en el mismo comienzo del episodio de la nave: Eumolpo, para escapar de la persecucin de Ascilto, hace subir a los personajes del Satyricon a una embarcacin, donde
Encolpio trata de calmarse mediante generalizaciones filosficas, ya que la
nueva amenaza que se cierne sobre su frater es el poetastro (algo ya anticipado en Sat. 92.4). Pero estas reflexiones se ven interrumpidas bruscamente
por dos voces muy familiares (Sat. 100.3-5)5: las de Licas de Taranto, dueo
de la nave, y la exiliada cortesana Trifena, dos personajes con los que Encolpio y Gitn han tenido algn tipo de relacin amorosa (y problemas) en algn
pasaje perdido de la obra6:

Para los pasajes inmediatamente contextuales, vanse Ferri 1988 y Mazzilli 2000 y 2003.
Lo ms probable es que Encolpio haya tenido un vnculo con Licas (e incluso con la
mujer de Licas), y Trifena con Gitn, en el tradicional esquema triangular que involucra a
Encolpio, Gitn y otro personaje. Por otra parte, la relacin entre Licas y Trifena no parece
de tipo sentimental, sino que se basa en la mutua solidaridad de las vctimas de la traicin
de Encolpio y Gitn. Para el significado del nombre Licas, cf. Barchiesi 1984. Por su parte,
7ULIHQD HVWi YLQFXODGD D  OLEHUWLQDMH  HVWUHFKDPHQWH UHODFLRQDGR FRQ HO UDVJR PiV
sobresaliente de su personalidad, i.e. su uoluptas, cf. 101.5 et praeter hunc Tryphaena, omnium
feminarum formosissima, quae uoluptatis causa huc atque illuc uectatur y 113.7 omnia me
oscula uulnerabant, omnes blanditiae, quascumque mulier libidinosa fingebat. Para Panayotakis 1995, p. 143, Trifena exhibits characteristics attributed to female roles in theatre:
meretrix de la comedia romana, mima en la troupe del mimo, etc. Y agrega algo muy cierto:
as in the case with most of the characters of this novel, Tryphaenas personality is a mixture
of the literary and the real, a combination of life and literature, filtered through Petronius
exuberant imagination.
5
6

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

359

sed repente quasi destruente fortuna constantiam meam eiusmodi uox super
constratum puppis congemuit: ergo me derisit? et haec quidem uirilis et
paene auribus meis familiaris animum palpitantem percussit. ceterum eadem indignatione mulier lacerata ulterius excanduit et si quis deus manibus
meis inquit Gitona imponeret, quam bene exul exciperet7. uterque nostrum
tam inexpectato ictus sono amiserat sanguinem. ego praecipue quasi somnio
quodam turbulento circumactus diu uocem collegi tremebundisque manibus
Eumolpi iam in soporem labentis laciniam duxi (Sat. 100.3-5)
exul exciperet Vannini : exulem exciperem tm, Mller 1995 : exulem exciperet
L : exul eum exciperet Strelitz | tremebundisque l, Mller 1995 : tremulisque
tp

Vannini 2005, p. 213, ya ha notado las reminiscencias ovidianas de este


pasaje; en efecto, en Met. XIV 192 ss., Aquemnides le narra a Macareo el
lamento amenazador de Polifemo, una vez cegado por Ulises, y su propia
reaccin ante tal amenaza:
atque ait: o si quis referat mihi casus Vlixem,
aut aliquem e sociis, in quem mea saeuiat ira,

haec et plura ferox, me luridus occupat horror

[mors erat ante oculos, minimum tamen ipsa doloris],


...
me tremor inuasit: stabam sine sanguine maestus,
....
talia fingebam misero mihi fata parari
perque dies multos latitans omnemque tremescens
ad strepitum mortemque timens cupidusque moriri (Ou., Met. XIV 192-215)

7
Adoptamos el texto segn Vannini 2005, p. 215, quien se pregunta cmo Trifena llama
exulem a Gitn cuando ella tambin lo es, cf. 100.7 (en contra de eliminar este exul, como
Mller 1961, que lo cree repetido del punto 100.4): la corruttela sar in questo primo passo,
perch cos com tramandato dovrebbe essere messo fra cruces. Su propuesta, exul exciperet
(come bene laccoglierebbe unesiliata!), supone una interpolacin de la desinencia de exul
y mantiene el texto de la tradicin manuscrita exciperet, que adems da una buena clusula de
crtico+troqueo. El cambio de persona ex abrupto es uno stilema del parlato y corra gran
riesgo de ser oscurecido por la tradicin textual. Cf. Labate 1990, p. 182 ss.

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

360

MARCOS CARMIGNANI

Pero el macro-hipotexto siempre es la Odisea, a la que Petronio alude con


una tcnica intertextual particular, la de utilizar a Ovidio como filtro. Los
versos homricos son los siguientes:






...





>@ +RPOd. IX 395-400, 526-531)

Si bien es innegable que el episodio homrico es el modelo ms ilustre de


toda alusin al Cclope, el texto del Satyricon, en su dinmica y en sus referencias culturales, se enriquece con otras connotaciones que median y complican las
relaciones entre Petronio y Homero: es muy comn que el autor del Satyricon
tenga en mente las fuentes latinas ms que las griegas para la alusin lingstica.
As, el modelo homrico ser el referente del contenido de base presupuesto
por el Satyricon, pero entre el relato odiseico y el texto petroniano se interpone
como filtro otra presencia literaria que reacciona cambiando la forma del relato
homrico: el texto de Ovidio. Esto se puede comprobar porque el lamento del
Cclope ovidiano se encuentra insertado de manera orgnica en un episodio que
presupone el del Cclope homrico. Por lo tanto, es necesario estudiar los efectos
que ese filtro provoca en el Satyricon, porque tal como seala Barchiesi
il rapporto che lega un testo a un modello coinvolge linterpretazione di due
testi, non di uno solo Il nuovo testo rilegge il suo modello. Il modello a
sua volta influenza la lettura del nuovo testo (se viene riconosciuto, spesso
ha abbastanza forza da farlo)8. Sappiamo tutti che una procedura diffusa
8
Aunque Barchiesi no lo afirme explcitamente, esta idea indudablemente deriva del
ensayo de Borges Kafka y sus precursores, que, a su vez, tiene varios puntos de contacto
con el no menos famoso de T. S. Eliot, Tradition and the Individual Talent.

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

361

consiste nel considerare il senso della citazione come aperto, problematico,


negoziabile, e il senso del modello come ragionevolmente univoco e sicuro
(Barchiesi 1997, p. 211).

El problema radica en que Ovidio no slo conoca a la perfeccin el


episodio del Cclope homrico, sino que claramente tambin juega intertextualmente con la interpretacin que del pasaje odiseico hace Virgilio (Aen. III
588-683). Y llegados a este punto es conveniente hacer una salvedad: no
creemos que haya que forzar aqu una relacin intertextual entre la Eneida
y Sat. 100; ms bien, como seal convincentemente Mazzilli 2000, la relacin se presenta entre la Kyklopeia virgiliana y Sat. 102.1-29. Lo que nos
importa tiene que ver con la funcin que cumplen las palabras ovidianas en
este pasaje petroniano, ya que el lamento del Cclope se puede sentir en las
palabras de Trifena y en la posterior reaccin de Encolpio: es decir, el pasaje
petroniano no slo se encuentra dentro de un marco general de alusiones odiseicas (el episodio del Cclope particularmente), sino que adems presenta un
juego intertextual con el tratamiento que Ovidio le da a dicho episodio en sus
Metamorfosis (XIV 154-222). Es significativo, entonces, recuperar algunas
caractersticas del relato virgiliano para compararlo con el ovidiano, de modo
que podamos apreciar en perspectiva la versin de las Metamorfosis.
En los libros II y III de la Eneida, Eneas le cuenta a Dido las vicisitudes
del viaje desde Troya en busca de la nueva patria; se recuerdan de esta manera varios de los ms famosos episodios del periplo realizado por el hroe,
hasta que finalmente en el libro III Virgilio deja que Aquemnides, un compaero de Odiseo que fue abandonado en la tierra de los Cclopes, narre el
episodio ms clebre de los viajes del hroe homrico. Aquemnides, que se
presenta en un estado de deplorable decrepitud, mientras les suplica a Eneas
y Anquises que lo saquen de esa tierra de monstruos, les cuenta cmo el
Cclope devor a dos de sus compaeros y cmo se vengaron luego Odiseo
y sus socii. En ese momento, descubren que el propio Polifemo se dirige
9
Los paralelos de los que hablamos se refieren en general al temor que sienten Aquemnides y luego Eneas ante los gritos y amenazas de Polifemo. Cf. Aen. III 627 tepidi tremerent
sub dentibus artus, 648 sonitumque pedum uocemque tremesco, 664 dentibus infrendens gemitu, 672-674 clamorem immensum tollit, quo pontus et omnes / intremuere undae, penitusque
exterrita tellus / Italiae y 682 praecipitis metus acer agit quocumque rudentis. El gran grito
del Cclope en Od. IX 395 se repite tambin en Ou. Met. XIII 876-877 tantaque uox, quantam
Cyclops iratus habere / debuit, illa fuit; clamore perhorruit Aetne.

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

362

MARCOS CARMIGNANI

hacia ellos: el Cclope virgiliano es un monstruo infans, su lenguaje se reduce a terribles gemidos. Llenos de terror, y despus de recoger a Aquemnides,
los troyanos deciden huir.
Las diferencias con el relato de Ovidio son notables. En las Metamorfosis,
Macareo, compaero de Odiseo, le pregunta a un Aquemnides ya recompuesto en la nave de Eneas cmo ha sobrevivido. Ovidio se encarga de destacar (XIV 165-166) que Aquemnides ya no estaba vestido con andrajos,
para marcar las diferencias con la Eneida. El compaero de Odiseo, tras resaltar su eterna gratitud hacia Eneas, narra cmo vio todo lo que se cuenta
en la Odisea10, cmo el Cclope ensangrentado deambula por el Etna. Entonces recuerda las propias palabras que el Cclope iracundo lanza contra la raza
aquea. En los vv. 198-217 la narracin describe imgenes donde la carne, la
sangre, el terror y la muerte se combinan con una truculencia ausente en la
Eneida.
Este brevsimo resumen de ambas reformulaciones del texto homrico
basta para ver que Ovidio quera diferenciarse de Virgilio, aunque evidentemente tuvo presente tanto la Odisea como la Eneida para su discurso de
Aquemnides: su recreacin es sin dudas original. El problema es cmo definir esta diferencia: la bibliografa sobre la relacin entre estos dos pasajes
es vastsima y abarca un amplio abanico de interpretaciones11, pero creemos
que quiz sera demasiado arriesgado pensar que Ovidio parodia a Virgilio,
como supone Otis; ms bien podemos notar claramente que hay un cambio
de tono en las Metamorfosis. El Cclope de Ovidio es una figura casi
hiperblicamente grotesca y cruel, en la que el canibalismo asume un papel
fundamental. No es muy errado, en cambio, afirmar que ese cambio de tono
ovidiano se ve enriquecido con nuevas motivaciones en el Satyricon: el episodio de la nave es un marco propicio para la inclusin de ciertos esquemas
narrativos que resultan ser inversiones pardicas de las escenas ms tpicas
de la novela griega idealizante; el tema de la aventura por mar es la quintaesencia de la novela sentimental griega, con piratas, tempestad, proceso
judicial y naufragio. Naturalmente, la vctima inconsciente siempre es Encol-

Es un claro juego entre el sentido de la vista y la ceguera de Polifemo: uidi, cum monte
reuulsum / inmanem scopulum medias permisit in undas; / uidi iterum ueluti tormenti uiribus
acta / uasta Giganteo iaculantem saxa lacerto (Met. XIV 181-184).
11
Algunos ejemplos representativos son los textos de Otis 1970, p. 73 ss., Galinsky 1975,
p. 230 ss., Baldo 1995, p. 128 ss., Hinds 1998, p. 112 y Papaioannou 2005, pp. 75-112.
10

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

363

pio. Si uno presta la debida atencin a estas inversiones, coincidir con Conte 2007, p. 77, en que la parodia del romanzo greco ... il presupposto
strutturale da cui generata la forma stessa del racconto petroniano. Para
que la parodia tenga su fruto, el auctor absconditus sigue el camino de la
exageracin o de la inversin. Por ejemplo, en el pasaje objeto de nuestro
anlisis, quasi destruente fortuna constantiam meam retoma la funcin desWUXFWLYDGHODHQODQRYHODJULHJD FISRUHMHPSOR&KDULW, HQ
paene auribus meis familiaris se evoca el reconocimiento a travs de la voz,
un topos de la novela griega (cf. Ach. Tat. VI 15.4 ss.; Heliod. V 2.5 ss.);
quasi somno quodam turbulentu es una imagen similar a la del sueo angustiante de Habrocomes (cf. X. Eph. I 12.4)12. Por otra parte, hay que tener
presente el motivo de los segundos encuentros, que slo tienen lugar en las
novelas griegas (cf. Charito III 3.8-13, III 5.9-6.1; X. Eph. IV 3.1-5; Hld. II
21.2, etc.): no existen en los poemas picos13. Es muy probable, por lo tanto,
que Petronio retome el modelo y reescriba estos topoi novelsticos en un tono
pardico14.
Precisamente para analizar esas nuevas motivaciones, recurriremos al pasaje inmediatamente anterior de las Metamorfosis, la introduccin que realiza
Aquemnides a las palabras ya citadas del Cclope:
ut uero fuga uos a certa morte reduxit,
ille quidem totam gemebundus obambulat Aetnen
praetemptatque manu siluas et luminis orbus
rupibus incursat foedataque bracchia tabo
in mare protendens gentem exsecratur Achiuam (Ou. Met. XIV 187-191).

La clave para interpretar la relacin entre este episodio de Aquemnides,


donde se narra el lamento del Cclope, y las palabras amenazadoras de Trifena y la reaccin de Encolpio en el Satyricon es la presencia de los adjetivos verbales en -bundus: gemebundus en Metamorfosis y tremebundus en
el Satyricon. Ya Vannini sostena que tremebundus es una reminiscencia

Cf. Vannini 2010, ad loc.


Cf. Galli 1995, p. 37. Es interesante que la nica excepcin que menciona es el episodio
de Aquemnides en Aen. III 590-592.
14
Para lo inesperado de los sucesos en Sat. 100, cf. Jones 1987, p. 818. Para los momentos
en que los personajes escuchan por casualidad algo inesperado (overhearing), cf. Ach. Tat.
VI 15.4-17.1 y Hld. V 2.5-3.1.
12
13

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

364

MARCOS CARMIGNANI

ovidiana y no una parodia de Cic., Dom. 134 (si dixit aliquid uerbis haesitantibus postemque tremebunda manu tetigit), tal como pensaba Pianezzola
1965, p. 202; Vannini 2005, p. 213, n. 3, agregaba que la carica affettiva
dellagg. in -bundus guadagna molta comicit al gesto di Encolpio; sembra
quasi che Petronio intenda degradare espressioni pi piane, come tremor
inuasit e tremescens15. Esta frase encuentra su confirmacin en Met. XIV
188, cuando Ovidio dice que el Cclope obambulat gemebundus: en definitiva, pensamos que el tremebundus petroniano es una alusin al gemebundus
ovidiano, la marca textual que deja en evidencia la tcnica alusiva petroniana.
Pianezzola 1965 les dedica un completo estudio a los adjetivos verbales
en -bundus, del que podemos extraer algunos elementos importantes para
nuestro anlisis. Recalca el valor dinmico-representativo de este tipo de
adjetivos, que tienen la caracterstica de describir al personaje en los gestos
que realiza y en los comportamientos que asume, de manera tal que la accin
expresada por la raz verbal se vuelve imagen, representacin. Este valor
dinmico y descriptivo es suficiente para distinguir este tipo de adjetivo del
participio presente, que slo tiene la funcin de indicar la accin que se verifica en concomitancia con la del verbo principal, cio laggettivo verbale
in -bundus trasferisce il valore semantico dalla contingenza dellazione, propria del participio presente, alla caratterizzazione della qualit, e in questo
senso la sua funzione si avvicina a quella dellaggettivo (Pianezzola 1965,
p. 45). Sintcticamente, los adjetivos en -bundus se caracterizan por su uso
predicativo y su aspecto imperfectivo o durativo: slo se forman a partir de
verbos que denotan un proceso o un estado. Sin llegar a ser parte regular del
sistema verbal, estn estrechamente vinculados a nivel funcional al verbo,
pero difieren del participio porque presentan no slo el progreso sino las
manifestaciones sensibles, especialmente visuales, de la accin. Fueron Lucrecio y Catulo quienes extendieron el uso de los adjetivos en -(i)(e)bundus
y lo fijaron definitivamente dentro de la tradicin de la poesa pico-lrica.
En cuanto al uso que le dieron Ovidio y Petronio, el primero utiliz de
manera profusa este tipo de adjetivos, con veintids ejemplos16, lo que lleva

En Vannini 2010, ad loc., agrega: Lagg. tremebundus, che compare a partire da Cicerone ... e Catullo (63.11) ha sapore poetico.
16
Dieciocho casos en Met.: pudibundus en III 393, VI 604, IX 568 y X 421; tremebundus
en IV 133; furibundus en IV 512, VIII 107, IX 637, X 410, XIII 871, XIV 107; moribundus en
V 84, VI 291, VII 851, X 716, XII 118; fremebundus en XII 128; y gemebundus en XIV 188.
15

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

365

a pensar en cierto abuso por parte del poeta de este medio expresivo cos
sonoro e appariscente, che tende perci a disespressivizzarsi (Pianezzola
1965, p. 151). Los adjetivos usados por Ovidio son aquellos tradicionales de
la poesa (pudibundus, tremebundus, furibundus, moribundus), con la sola
excepcin de gemebundus, que aparece por primera vez en este pasaje y
tendr una cierta difusin slo en la latinidad posterior17. La innovacin oviGLDQDYLHQHVXJHULGDSRUHOKRPpULFR Od. IX 506) y podra haber
sido modelada sobre la forma plautina plorabundus o sobre la creacin de
Tito Livio lacrimabundus, aunque el gemebundus ovidiano es ciertamente
ms pattico, ya que implica no slo el sonido de los gemidos sino tambin
el comportamiento y los gestos de quien est sufriendo un dolor (Pianezzola
1965, p. 152). Por su parte, Petronio utiliza, adems de tremebundus, otros
dos adjetivos en -bundus:
1. Sat. 62.4:

uenimus inter monimenta: homo meus coepit ad stelas facere18,


sed ego <pergo> cantabundus19 et stelas numero;
2. Sat. 124 v. 282: atque has erumpit furibundo pectore uoces.

El primero es un hapax de carcter popular: pertenece a la historia del


hombre-lobo narrada por Nicerote en la Cena20; el segundo se encuentra en el
Bellum ciuile: se puede ubicar perfectamente en la poesa pica de imitacin.
Con respecto a tremebundus, el OLD (s.u.) da dos acepciones: 1. quivering, trembling, vibrating, y 2. trembling (with fear or a sim. emotion);
shivering (from cold), donde est citado nuestro pasaje petroniano. Para
Lyne 1978, p. 207, los testimonios de este adjetivo demuestran (en contra de
El OLD, s.u., da dos testimonios: el de Met. y el de Ilias 349. Bmer 1986, ad loc.,
comenta: zuerst hier, dann Hom. Lat. 349 und seit der Itala selten in der Prosa ... Zicri,
Studia Oliveriana 2, 1955, 65, 3, verweist auf queribundus (seit Cic. Sull. 30) behauptet
aber (ohne Kenntnis des Thes., s.v.), da es zwischen Ovid und Hieronymus keine weiteren
Belege gebe, und hlt fremebundus fr nicht unwahrscheinlich; vgl. auch die var. lectiones
Thes. VI 1734. 68ff..
18
Cf. OLD, s.v. 27b: (also euphem., for the performance of the excretory functions).
19
Jones 1970, p. 213, seala que, en contraste con los adjetivos en -ibundus, -ebundus,
el grupo de adjetivos en -abundus (como cantabundus) es caracterstico de la prosa histrica,
especialmente en pasajes con marcada expresividad y color descriptivo. Por ello, interesante
la conjetura de Delz 1962: cunctabundus.
20
Para estudios sobre el material folclrico presente en este relato, cf. Blnsdorf 1990 y
Salanitro 1998.
17

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

366

MARCOS CARMIGNANI

Pianezzola) que in general it is rare en poesa: Ennio (prob. 1), Lucrecio21


(1), Catulo (1), Virgilio (1), Ovidio (1), Sneca (Her. O.) (1), Estacio (3),
Valerio Flaco (2), Silio Itlico (8), Marcial (1) y Juvenal (1). Es decir, salvo
en Silio Itlico, es un adjetivo ms bien raro. Sin embargo, Pianezzola
1965, p. 146, est en lo cierto cuando afirma que laggettivo tremebundus
... appartiene essenzialmente al linguaggio epico o comunque poetico: es
decir, a pesar de que aparezca poco, sus testimonios son mayormente en
poesa. Es importante destacar, por otra parte, que los contextos son a menudo de un elevado patetismo: basta recordar Met. IV 133-134, la historia de
Pramo y Tisbe (dum dubitat, tremebunda uidet pulsare cruentum / membra
solum), Aen. X 522 (ille astu subit, at tremibunda superuolat hasta) o Theb.
IV 441-442 (fugit incepto tremibundus ab aruo / agricola insanique domum
rediere iuuenci). Podra pensarse, entonces, que tremebundus es un adjetivo
asociado con un contexto de poesa elevada cuya funcin sera brindar un
tono pattico a la situacin (o personaje) que describe. Sin embargo, no siempre el pathos es la caracterstica con la que podemos vincular a tremebundus:
en este sentido, es muy interesante lo que puede leerse en el comentario de
Lyne al poema atribuido a Virgilio, Ciris. En esta obra encontramos la presencia de tremebundus en dos oportunidades: marmoreum tremebunda pedem
quam rettulit intra (256) y paulatim tremebunda genis obducere uestem /
uirginis (342-343). Lyne 1978, p. 207, comentando el primero de los pasajes,
manifiesta su sorpresa cuando dice, con respecto a tremebundus, que it is
difficult to decide its tone. Y es precisamente el tono lo que nos importa
en nuestro pasaje petroniano: si en un contexto de poesa, como lo es Ciris,
es difcil determinar el tono de tremebundus, no lo es tanto en la prosa del
Satyricon. La notable frecuencia de los adjetivos en -bundus en la poesa
latina da lugar a patrones poticos que tienden a la banalizacin (Pianezzola
1965, pp. 15-16): esto es lo que nos permite afirmar que tremebundisque
manibus de Encolpio implica una degradacin22.

21
En realidad, Lucrecio utiliza la forma tremibundus. Para la apofona de los adjetivos
en -bundus, cf. Pianezzola 1965, p. 59.
22
En su resea a Pianezzola 1965, Jones 1970, p. 214, tambin adverta acerca de la banalizacin de estos adjetivos en -(e)(i)bundus, which by the end of the Augustan era form a
closed group and show a marked tendency to recur as epithets in fixed collocations. El uso
de estos adjetivos can reflect important general aspects of literary tradition and innovation,
the distinction of genres and the stylistic character of individual writers.

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

367

Dentro del marco de alusiones odiseicas, la figura del Cclope es fundamental en estos captulos del Satyricon: en un principio identificado con
Eumolpo (98.5), el Cclope se convierte definitivamente en una referencia
mtica estructural en el episodio de la nave, donde los personajes parecen
encerrados, atrapados ante la presencia amenazadora de Licas y Trifena. Podemos ver incluso cmo Petronio elabora su estrategia alusiva de manera
gradual: en la nave, la alusin al Cclope queda absolutamente explcita en
101.5 y en 101.7, con las palabras de Eumolpo que identifican a Licas y a la
propia nave con Polifemo y su caverna, respectivamente, pero previamente,
en 100.4-5, de manera ms sutil, se produce otra identificacin, la de Trifena
con el monstruo. Es decir, en el episodio de la nave parece ser que todo se
complota en contra de Encolpio y Gitn, puesto que todos son el Cclope:
Licas, Trifena y la embarcacin23. Petronio nos quiere mostrar que la degradacin novelesca da lugar a que una figura como el Cclope, monstrum horrendum, informe, ingens, cui lumen ademptum segn Virgilio, quede reducida a personajes como Licas, que, al reconocer a Encolpio tal como lo hace
(105.9), imposibilita que el lector pueda atribuirle algn rasgo de seriedad, y
como Trifena mulier libidinosa que va en la nave por uoluptas , cuyo
grito enardecido en contra de Gitn provoca la reaccin de Encolpio, una
reaccin cargada de un pathos absolutamente fuera de lugar dentro de este
contexto de degradacin.
En definitiva, Petronio exhibe, de esta manera, otra muestra de su virtuoso arte intertextual, de su exquisito dominio de la imitatio: las alusiones lingsticas y tonales al lamento del Cclope ovidiano en las palabras de
Trifena y en la reaccin de Encolpio tienen la finalidad, en la verticalidad del
discurso, de parodiar la actitud del Cclope homrico y, en general, el tema
de la aventura por mar, ineludible en la novela sentimental griega. Ya se ha
sealado que el episodio homrico es el modelo ms ilustre de toda alusin
al Cclope, pero Petronio busca enriquecer el texto con otras connotaciones
que median y complican las relaciones entre el Satyricon y Homero: esas
connotaciones son las alusiones a Ovidio que permiten, mediante el cambio
de tono, la parodia. Dichas alusiones retoman algunos modismos del Cclope
ovidiano, una figura exageradamente grotesca y cruel, para recrear el patetismo de la descripcin mediante una nica palabra enriquecida por una resoSobre el problema del cambio de papeles de los personajes en relacin con el Cclope,
cf. Rimell 2002, p. 102 ss.
23

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

368

MARCOS CARMIGNANI

nancia interna. Ese cambio de tono del que el Satyricon se sirve est dado
por el uso de tremebundus, que da lugar a la banalizacin. Petronio, gran
conocedor de su tradicin literaria, seguramente reconoca en tremebundus
un adjetivo propio de la poesa elevada, sobre todo de la pica, pero tambin
indudablemente no dejaba de apreciar la enorme carga afectiva del gemebundus ovidiano, con su patetismo evidente por los gemidos y los gestos de sufrimiento: no hay que olvidar que estos adjetivos describen al personaje en
los gestos que realiza y en los comportamientos que asume, en sus manifestaciones sensibles, especialmente visuales, de la accin; al aludir a este pattico gemebundus, Encolpio le quita toda esa carga afectiva para darle un tono
cmico, basado en la degradacin del contexto del episodio de la nave. Como
sealaba Conte 1974, pp. 20-25, el discurso de reuso tiene un arsenal de
elementos para separarse del lenguaje cotidiano las figuras de expresin,
los paralelismos, las repeticiones, la mtrica, etc., adems ayudan a activar la
memoria y garantizan su permanencia: los adjetivos en -bundus son un
excelente ejemplo de este tipo de discurso.
En definitiva, tremebundisque manibus es la pista que nos deja Petronio
para comprender que la reaccin de Encolpio carece absolutamente de decorum: en eso consiste la parodia, que se sirve de la pica homrica y de la
novela griega para ridiculizar, como a menudo ocurre en el Satyricon, a su
narrador Encolpio.
BIBLIOGRAFA
Ediciones crticas, comentarios e instrumenta studiorum
Bmer, F. 1986: P. Ovidius Naso. Metamorphosen Buch XIV-XV, Heidelberg.
Lyne, R. O. A. M. 1978: Ciris. A Poem Attributed to Vergil, Cambridge.
Mller, K. (ed.) 19954: Petronius Satyricon Reliquiae, Stuttgart.
Vannini, G. 2010: Petronii Arbitri Satyricon 100-115. Edizione critica e commento, Berln-Nueva York.

Bibliografa secundaria
Baldo, G. 1995: DallEneide alle Metamorfosi. Il codice epico di Ovidio, Padua.
Baldwin, B. 1973: Ira Priapi, CPh 68, pp. 294-296.
Barchiesi, A. 1984: Il nome di Lica e la poetica dei nomi in Petronio, MD 12,
pp. 169-175.
Barchiesi, A. 1997: Otto punti su una mappa dei naufragi, MD 39, pp. 209-226.
Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

E L C C L O P E O V I D I A N O C O M O I N S P I R A C I N PA R D I C A

369

Blnsdorf, J. 1990: Die Werwolf-Geschichte des Niceros bei Petron als Beispiel
literarischer Fiktion mndlichen Erzhlens, en Vogt-Spira, G. (ed.), Strukturen
der Mndlichkeit in der rmischen Literatur, Tubinga, pp. 193-217.
Callebat, L. 1998: Langages du roman latin, Hildesheim.
Ciaffi, V. 1955: Struttura del Satyricon, Turn.
Collignon, A. 1892: tude sur Ptrone. La critique littraire, limitation et la parodie
dans le Satyricon, Paris.
Connors, C. 1998: Petronius the Poet, Cambridge.
Conte, G. B. 1974: Memoria dei poeti e sistema letterario, Turn.
Conte, G. B. 2007: Lautore nascosto. Uninterpretazione del Satyricon, Pisa.
Courtney, E. 2001: A Companion to Petronius, Oxford.
Cugusi, P. 2001: Modelli epici rovesciati in Petronio. Osservazioni sul riuso di
Odissea e Eneide nei Satyrica, Aufidus 44, pp. 123-135.
Danese, R. 1989: Il ritorno delleroe in patria: quasi una postilla (Petronio, Satyricon 114-115), StudUrb (B) 62, pp. 213-220.
Delz, J. 1962: Resea de Mller, K. 19611, Petronii Arbitri Satyricon, Gnomon 34,
pp. 676-684.
Ernout, A. 19584: Ptrone: Le Satyricon, Pars.
Fedeli, P. 1981: Petronio: il viaggio, il labirinto, MD 6, pp. 91-117.
Fedeli, P. 1988: Encolpio-Polieno, MD 20-21, pp. 9-32.
Ferri, R. 1988: Il Ciclope di Eumolpo e il Ciclope di Petronio: Sat. 100ss., MD
20-1, pp. 311-315.
Galinsky, K. 1975: Ovids Metamorphoses. An Introduction to the Basic Aspects,
Berkeley.
Galli, L. 1995: Meeting again. Some Observations about Petronius Satyricon 100
and the Greek Novels, en Hofmann, H., Zimmerman, M. (eds.), Groningen
Colloquia on the Novel, vol. 7, Groninga, pp. 33-45.
Hinds, S. 1998: Allusion and Intertext: Dynamics of Appropriation in Roman Poetry,
Cambridge.
Jones, D. 1970: Resea de Pianezzola, E. 1965, Gli aggettivi verbali in -bundus,
CR 20, pp. 213-214.
Jones, F. 1987: The Narrator and the Narrative of the Satyrica, Latomus 46,
pp. 810-819.
Klebs, E. 1889: Zur Komposition von Petronius Satirae, Philologus 47, pp. 623655.
Kragelund, P. 1989: Epicurus, Priapus and the Dreams in Petronius, CQ 39,
pp. 436-450.
Labate, M. 1990: Note Petroniane, MD 25, pp. 181-191.
Mazzilli, C. 2000: Petronio 101, 7-103, 2: lusus allusivo e caratterizzazione dei
personaggi, Aufidus 41, pp. 49-72.
Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

370

MARCOS CARMIGNANI

Mazzilli, C. 2003: Petronio 98.7-100.2. Stratigrafia intertestuale e risemantizzazione del modello, Aufidus 50-51, pp. 33-65.
McDermott, M. 1983: The Satyricon as a Parody of the Odyssey and Greek Romance, LCM 8, pp. 82-85.
Mller, K. (19611), Petronii Arbitri Satyricon, Mnich.
Otis, B. 1970: Ovid as an Epic Poet, Cambridge.
Panayotakis, C. 1995: Theatrum Arbitri: Theatrical Elements in the Satyrica of
Petronius, Leiden.
Papaioannou, S. 2005: Epic Succession and Dissension. Ovid, Metamorphoses
13.623-14.582 and the Reinvention of the Aeneid, Berln.
Pianezzola, E. 1965: Gli aggettivi verbali in bundus, Florencia.
Rimell, V. 2002: Petronius and the Anatomy of Fiction, Cambridge.
Salanitro, M. 1998: Il racconto del lupo mannaro in Petronio: tra folclore e letteratura, A&R 43, pp. 156-167.
Slater, N. 1990: Reading Petronius, Baltimore.
Sullivan, J. P. 1968: The Satyricon of Petronius. A Literary Study, Londres.
Vannini, G. 2005: Note a Petronio (Sat. 100, 4; 115, 12; 115, 19), MD 54, pp. 213219.
Walsh, P. G. 1970: The Roman Novel. The Satyricon of Petronius and the Metamorphoses of Apuleius, Cambridge.

Fecha de recepcin de la primera versin del artculo: 13/09/2011


Fecha de aceptacin: 20/07/2012
Fecha de recepcin de la versin definitiva: 26/07/2012

Emerita LXXX 2, 2012, pp. 355-370

ISSN 0013-6662

doi: 10.3989/emerita.2012.18.1118

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 371-385
ISSN 0013-6662 doi: 10.3989/emerita.2012.19.1117

Ablativo de gerundio anterior en la Crnica mozrabe


Jana Mikulov
Universidad de Masaryk, Brno, Repblica Checa
jmikulova@gmail.com

Anterior ablatives of the gerund in the Mozarabic Chronicle


En la Crnica mozrabe de 754 aparecen ablativos
de gerundio que pueden interpretarse como anteriores al predicado principal. Esta interpretacin se
basa, sobre todo, en las caractersticas aspectuales
y el contexto. El uso del ablativo de gerundio anterior demuestra el acercamiento entre el participio de presente y el ablativo de gerundio en latn
tardo. El ablativo de gerundio anterior, sin embargo, no aparece con frecuencia en textos de la
poca.

In the Mozarabic Chronicle of 754, there are ablatives of the gerund that can be interpreted as anterior to the main predicate. Aspectual characteristics
and context are considered to be the main factors
for the previous interpretation. The use of the anterior ablative of the gerund gives evidence of the approximation between the present participle and the
ablative of the gerund in Late Latin. The anterior
ablative of the gerund, however, does not seem to
be frequently used in contemporary texts.

Palabras clave: ablativo de gerundio; anterioridad;


Crnica mozrabe; latn tardo.

Key words: ablative of the gerund; anteriority; Mozarabic Chronicle; Late Latin.

El presente artculo estudia los ablativos de gerundio que hacen referencia al


sujeto de la oracin, desempean la funcin de complemento circunstancial
y pueden interpretarse como anteriores a la accin del verbo finito. Por ello,
omitiremos las construcciones absolutas de ablativo de gerundio (documentadas marginalmente) y los sintagmas formados por un nombre y un adjetivo
con el sufijo -ndo-.
Los ablativos de gerundio anteriores estudiados se han tomado de la
Crnica mozrabe de 7541. Hemos hecho un sondeo para comparar los resultados obtenidos con textos del Corpus Scriptorum Muzarabicorum que datan
del mismo siglo y con textos que aparecen en la edicin electrnica de los
Monumenta Germaniae Historica (MGH), de la serie Scriptores.
1

Hemos utilizado la edicin de la traduccin realizada por Lpez Pereira 1980.

372

JANA MIKULOV

Hemos examinado, sobre todo, los factores responsables de la lectura


anterior del ablativo de gerundio en -ndo. Consideramos anteriores las acciones que empiezan y terminan antes de la accin del predicado principal (v.
Traina 1993, pp. 231 y 307), incluidas aquellas en las que el punto final va
seguido del resultado de la accin. No hemos considerado anteriores aquellas
acciones que empiezan pero no terminan antes de la accin del predicado
principal. Sin embargo, algunos ablativos de gerundio no tienen lectura unvoca.
Basndonos en la literatura secundaria mencionamos algunos datos sobre
el gerundio anterior en espaol antiguo.
I. EL SIGNIFICADO

DEL SUFIJO -NDO-

Los investigadores (Joffre 1995, pp. 375, 378; Christol 1999, p. 120; Vester
1991, p. 303) coinciden en que el sufijo -ndo- no tiene significado implcito de tiempo ni de modo. Los lingistas difieren con respecto a si el sufijo
-ndo- expresa solamente la accin del verbo, o sea, la idea verbal (Touratier
1994, p. 164), o el dinamismo de la accin y su desarrollo hacia el punto final
(Joffre 1995, p. 386; Vester 1991, p. 303).
Mellet y Joffre 1994, pp. 382-383, afirman que el gerundio representa la
accin como abierta y prospectiva y que su significado bsico est reforzado
en algunos contextos y debilitado en otros. A este significado bsico se debe,
segn ellos, el dinamismo del ablativo de gerundio. Joffre 1995, p. 379, y
Carvalho 2001, p. 319, comparan el sufijo -ndo- con el sufijo -to- y dicen que
el gerundio no expresa acciones terminadas ni acciones ya realizadas. Carvalho (ibd.) seala que el gerundio deriva del infectum. Maiden utiliza los
mismos argumentos en su artculo sobre los gerundios romances (Maiden,
1996, p. 174). Afirma que se pueden relacionar con el aspecto imperfectivo,
porque, entre otras cosas, se forman ms bien a partir de temas latinos imperfectivos que de perfectivos.
Por lo tanto, en casos concretos, el significado de las formas en -ndo- no
lo determinan las caractersticas implcitas del sufijo, sino los factores externos. Vester 1983, p. 109 ss., indica que en latn clsico el ablativo de gerundio suele expresar modo, instrumento o causa y que existe una relacin estrecha entre el valor semntico del gerundio y el estado de cosas. El significado del ablativo de gerundio est mucho ms determinado que el del participio de presente (v. Vester 1983, pp. 121-123). Para el estudio del latn tardo
Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

373

es importante el solapamiento funcional del ablativo de gerundio con el


participio de presente, cuyos principios estn atestiguados ya en algunos
textos de la poca clsica (v. Maraldi 1994, p. 142 y Vester 1991, p. 305 s.).
As pues, los ablativos de gerundio anteriores pueden relacionarse con los
participios de presente que expresan anterioridad. Estos son, sin embargo,
mucho ms frecuentes que los ablativos de gerundio anteriores.
II.

FACTORES

DE LA INTERPRETACIN

A continuacin examinamos los factores que pueden influir en la interpretacin anterior de los gerundios. Se trata, sobre todo, de las caractersticas
aspectuales y del contexto.
1.

Aspecto y problemas relacionados

El aspecto y los estados de cosas han sido objeto de muchos estudios. Nos
hemos basado, sobre todo, en el concepto propuesto por Smith 1997 y aplicado al latn por Haverling 2000. Segn Smith 1997, p. 4, el aspecto es ms
bien una caracterstica de toda la oracin que de los verbos o frases verbales.
Distingue2 el aspecto del punto de vista (viewpoint aspect), expresado por las
categoras gramaticales, y el aspecto situacional (situation aspect), expresado
por la constelacin verbal relacionada con un tipo de situacin (situation
type). Los tipos de situacin son grupos de situaciones idealizadas que expresan el verbo y sus argumentos, o sea, lo que se conoce como constelacin
verbal3. Se trata, pues, de un concepto comparable al de los estados de cosas.
A partir de aqu utilizaremos el trmino estado(s) de cosas en vez de tipo
de situacin, porque es ms habitual. Asimismo, utilizaremos el trmino
aspecto gramatical para referirnos al punto de vista. Smith 1997, p. 6 ss. y
pssim, enfatiza el papel del hablante y de la subjetividad. El hablante relaciona una situacin real con la idealizada y destaca un rasgo de la accin. La
seleccin de la expresin aspectual depende de la gramtica de cada lengua y
sus convenciones pragmticas. El hablante puede unir un aspecto gramatical
y un estado de cosas no solo de manera estndar, sino tambin de una manera

2
3

Smith 1997, p. 5.
Smith 1997, p. 17.

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

374

JANA MIKULOV

menos usual con el fin de conseguir un efecto especial que podra influir en
la veracidad de la oracin.
Los criterios utilizados para establecer la tipologa de los estados de cosas
son dinamismo, telicidad y duracin (v. Smith 1997, p. 19). A diferencia de
Vester4, Smith5 no utiliza el parmetro del control como criterio bsico de su
clasificacin. Distingue cinco estados de cosas (Smith 1997, pp. 23-36); para
cuatro de ellos utiliza los trminos vendlerianos y aade los semelfactivos
como un estado de cosas especial. Adems de los estados de cosas bsicos,
Smith 1997, p. 48 ss., distingue tambin los estados de cosas derivados. Segn Smith 1997, p. 53, en caso de conflicto entre la constelacin verbal y el
aspecto gramatical u otro elemento externo (p. ej. el adverbio), el elemento
externo cambia el estado de cosas.
Los parmetros ms importantes para la lectura anterior o simultnea de
los ablativos de gerundio son telicidad, duracin y momentaneidad. Segn
Smith 1997, p. 19, los estados de cosas tlicos expresan un cambio de estado
que es el resultado u objetivo de la accin verbal, y tienen un punto final
inherente. Los estados de cosas atlicos expresan procesos sin resultados que
pueden ser interrumpidos en cualquier momento y que tienen un punto final
arbitrario.
La telicidad es un trmino discutido y, por eso, varios autores tratan de
evitarlo. Haverling 2000, p. 22 ss., por ejemplo, opta por los trminos terminativo y no terminativo. Tambin la momentaneidad y su relacin con
la telicidad son objeto de discusiones entre los especialistas. Este tema no lo
trataremos en el presente artculo.
Segn Smith 1997, p. 26 y 30, el rasgo tlico aparece en los logros
(accomplishments) y las realizaciones (achievements) y el rasgo momentneo en las realizaciones y los semelfactivos (ibd., pp. 29-30). Haverling
2000, pp. 22-36, trata de unir diferentes conceptos. Utiliza categoras vendlerianas, pero dice que se trata de una clasificacin aproximativa y que los
semelfactivos no pertenecen a ninguna categora (ibd., p. 24). Las realizaciones son, segn Haverling, momentneas y terminativas (= tlicas), porque
en la mayora de los casos suponen fases anteriores a la realizacin de la
accin (ibd., p. 39).

4
5

Vester 1983, p. 10.


Smith 1997, p. 19.

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

375

Las pruebas para establecer el estado de cosas en latn se enumeran en la


obra de Vester 1983, pp. 11-36, que tambin explica por qu es difcil o imposible aplicar al latn algunas pruebas utilizadas para el ingls (v. Vester
1983, pp. 9-36)6. Haverling 2000, p. 43 ss., aade una prueba ms: el uso de
los diferentes estados de cosas en las oraciones temporales introducidas por
la conjuncin dum. La adjudicacin de una predicacin concreta a un estado
de cosas no suele ser unvoca. Smith 1997, pp. 56-59, afirma tambin que
algunas constelaciones son tpicamente ambiguas (p. ej., las constelaciones
de los verbos de percepcin). Las dificultades pueden causarlas tambin los
problemas de carcter crtico-textual.
En la Crnica mozrabe aparecen ms de diez ablativos de gerundio que
podran interpretarse como anteriores. La interpretacin de algunos gerundios
es, sin embargo, ambigua.
Los estados de cosas de los gerundios anteriores tienen a menudo las
caractersticas [+ tlico] y/o [+ momentneo]. As pues, se trata de logros,
realizaciones o semelfactivos, como, por ejemplo, patrem effugiendo (1),
Toleto urbem regiam usque inrumpendo (2), cuncta disponendo (3), repatriando (4), fideiussores dando (5).
1. filiusque Cosdroe regis Persarum, patrem tumultualiter effugiendo
principi se dedit Romano (Chron. Muz. 2).
y el hijo del rey persa Cosroes, en medio del tumulto, huye de su padre, se pasa al general romano (Lpez Pereira 1980, p. 25).
2.

Toleto urbem regiam usque inrumpendo adiacentes regiones pace fraudifica male diuerberans nonnullos seniores nobiles uiros, qui utqumque
remanserant, per Oppam filium Egiche regis a Toleto fugam arripientes
gladio patibuli iugulat et per eius occasionem cunctos ense detruncat
(Chron. Muz. 54).
Despus de arrasarla (sc. Espaa) hasta Toledo, la ciudad regia, y
azotar despiadadamente las regiones circundantes con una paz engaosa,
valindose de Opas, hijo del rey Egica, condena al patbulo a algunos
ancianos nobles, que aun quedaban despus de haber huido de Toledo, y
los pasa a espada a todos con su ayuda (Lpez Pereira 1980, p. 71).

Sobre la necesidad de modificar las pruebas para una lengua concreta habla tambin
Smith 1997, pp. 39-59.
6

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

376

JANA MIKULOV

3.

Sicque cuncta obtime disponendo et Trinacrios portus preuigilando proprie sedi clementer se sublimant (Chron. Muz. 82).
As, despus de disponerlo todo convenientemente, y dejando cuidadosamente vigilados los puertos trinacrios, se incorpora indulgente a su trono
(Lpez Pereira 1980, p. 105).

4. Abdallaziz filium linquens in locum, Vlit regis repatriando sese presentat obtutibus anno regni eius extremo (Chron. Muz. 56).
dejando en su lugar a su hijo Abdelaziz, regresa a su patria y se presenta ante el Califa Ulit en el ltimo ao de su reinado (Lpez Pereira
1980, p. 75).
5.

Sicque fideiussores dando per suos libertos congeriem nummorum dinumerat (Chron. Muz. 57).
As, despus de dejar fiadores, por medio de sus libertos rene la cantidad
de dinero (Lpez Pereira 1980, p. 77).

Las actividades estn documentadas de forma ms bien marginal, por


ejemplo preuigilando (3). Tambin la expresin tractando (librum) (6) puede
considerarse una actividad, si tiene el significado de pensar / meditar sobre
el libro. Si, por el contrario, tiene el significado de examinar el libro o
explicar el libro, se trata de un logro. Entre los ejemplos no se encuentran
los estados, al igual que en latn clsico (v. Vester 1983, p. 105).
6.

Eius in tempore librum de tribus substantiis, quem dudum Romam sanctissimus Iulianus urbis regie metropolitanus episcopus miserat et minus
tractando papa Romanus arcendum indixerat (Chron. Muz. 41).
En su tiempo, el virtuossimo Julin, obispo metropolitano de la ciudad
regia, haba ya enviado a Roma el libro Las Tres Substancias en Cristo
y el Papa de Roma, leyndolo sin atencin, haba indicado que deba
ser rechazado (Lpez Pereira 1980, p. 61).

Los estados de cosas de los verbos finitos estn caracterizados, en la mayora de los casos, por los parmetros [+ tlico] y/o [+ momentneo]. Sin embargo
tambin aparecen las actividades, como, por ejemplo flagellat (7). La expresin
regnum retemtat (8) puede considerarse ambigua, a nuestro modo de ver: si se
hace hincapi en la accin de retener el poder, se trata de un logro; si se hace
hincapi en el hecho de estar en el poder, se trata de una actividad.
Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

7.

377

alligatos in carcere et katenis honustos retemptat et quaestionando uel


diuersas penas inferendo flagellat (Chron. Muz. 64).
y los (sc. moros) guarda engrillados en la crcel, cargados de cadenas
As, despus de inculparlos e imponerles diversas penas, los manda
azotar (Lpez Pereira 1980, p. 81).

8.

In Spaniis uero Alaor supra iam dictus Patriciam Cordobam ob seditas


Saracenorum disponendo regnum retemtat (Chron Muz. 64).
En Espaa el ya nombrado Alaor, organizando Crdoba la Patricia mediante guarniciones de soldados sarracenos, se mantiene en el poder
(Lpez Pereira 1980, p. 81).

Aunque los rasgos [+ tlico] y [+ momentneo] en los gerundios y en los


verbos finitos parecen tener importancia para la lectura anterior, es necesario
tener en cuenta tambin el aspecto gramatical. Como el sufijo -ndo- no expresa, por s mismo, las acciones terminadas o realizadas y el gerundio se forma
a partir del tema del infectum (v. supra), se pueden suponer las consecuencias
de la combinacin de un estado de cosas tlico con el aspecto gramatical
imperfectivo. As se puede enfocar, por ejemplo, el intervalo precedente al
cumplimiento de la accin en las realizaciones (v. Smith 1997, p. 75).
Las caractersticas mencionadas del gerundio pueden contribuir a que bajo
ciertas condiciones sea posible la lectura simultnea y anterior. Por ejemplo,
el gerundio effugiendo (1) podra interpretarse como simultneo (durante la
fuga) o anterior (despus de la fuga). Igualmente diuersas occasiones machinando (10) puede leerse, fuera del contexto, como al buscar diversas
oportunidades y despus de buscar diversas oportunidades.
Los verbos finitos7 de las oraciones analizadas aparecen tres o cuatro veces en perfecto y una vez en pluscuamperfecto; y el resto de los verbos estn
en presente histrico. No aparece el imperfecto. El uso del presente histrico
es frecuente en toda la obra; por lo que no se trata de una caracterstica tpica de las oraciones con gerundio anterior8. El presente histrico puede
En la cuestin del aspecto verbal en latn partimos de la opinin de que el tiempo verbal tiene caractersticas temporales y aspectuales (v. Bertinetto 1997, p. 20) y que el tiempo
verbal en latn es ms importante que el aspecto (para la recapitulacin del tema, v. Haverling
2000, p. 9 ss.).
8
El frecuente uso del presente histrico en algunos textos es solamente una cuestin
estilstica o una convencin literaria, v. Pinkster 1998, p. 76, y Pinkster 1983, p. 312.
7

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

378

JANA MIKULOV

sustituir al perfecto o al imperfecto y as se pierde la oposicin aspectual (v.


Comrie 1976, p. 73). En los ejemplos analizados el presente histrico aparece en la enumeracin de los eventos y sustituye al perfecto. La eleccin de
perfecto o presente histrico no influye en la interpretacin anterior del
gerundio.
En resumen, se puede observar la prevalencia de los estados de cosas tlicos
y/o momentneos en los gerundios y los predicados principales. Para la interpretacin simultnea o anterior parece ser importante la (im)posibilidad de que
coincidan las fases internas del estado de cosas del gerundio y del verbo finito.
Es notable la ocurrencia de los gerundios anteriores en las oraciones en las
que se relata la sucesin de los hechos. El gerundio puede, por su ndole, contribuir a la lectura ambigua.
2.

Contexto

Otro factor importante es el del contexto amplio o restringido. La lectura


anterior del gerundio repedando (9) se basa, por ejemplo, en la informacin
sobre el regreso de Ulit que aparece en la oracin precedente.
9.

Quem et Dei nutu iratum repperit repedando et male de conspectu principis ceruice tenus eiicitur pompizando (Chron. Muz. 56).
Quiso Dios que, al regresar, encontrara a Ulit airado contra l y para
humillarle fue expulsado de mala manera de su vista montado en un asno
para que sirviera de burla (Lpez Pereira 1980, p. 75).

La interpretacin anterior del gerundio est condicionada por el contexto


tambin en la oracin (10). Al final de la oracin precedente aparece la informacin sobre la preparacin de la trampa y el verbo machinant. La interpretacin anterior est reforzada por el adverbio ilico enseguida.
10.

Denique ubi hoc diuersas occasiones machinando ilico impetrant


(Chron. Muz. 88)
Por fin, cuando despus de buscar diversas oportunidades, encuentran
una, inmediatamente (Lpez Pereira 1980, p. 117)

En la oracin (2), la interpretacin anterior est apoyada por el uso de


usque hasta que indica explcitamente el lmite y destaca el hecho de que
Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

379

el gerundio precede al verbo finito. El adverbio postremo en la oracin (11)


establece el orden cronolgico de los hechos y contribuye as a la lectura
anterior del gerundio9.
11.

Unde et eos conprehensos aliquandiu diuersas rebellionis occasiones


flagellis extorquens, ut clam iussus ab emulis transmarinis fuerat, penas
inferendo, postremo capite truncat (Chron Muz. 78).
Como consecuencia de ello, los hace prisioneros y despus de someterlos durante algn tiempo a los tormentos de ltigo, para averiguar, mediante torturas, los diversos pormenores para la rebelin, los decapita,
segn le haba sido ordenado secretamente por sus aliados del otro lado
del mar (Lpez Pereira 1980, p. 93).

La lectura anterior del gerundio diuidendo (12) est apoyada por el objeto
directo del verbo finito (partem ex omni re mobili et inmobili), que destaca
que el sorteo se realiz primero y la entrega de la parte de los bienes al tesoro
pblico despus.
12.

preda et manualia uel quidquit illud est, quod olim predauiliter indiuisum retemtabat in Spania gens omnis Arabica, sorte sociis diuidendo
partem ex omni re mobili et inmobili fisco adsociat (Chron. Muz. 69).
Sortea entre sus aliados campos y ganados, as como cualquier otra
cosa que los rabes conservasen en Espaa aun sin repartir, fruto de los
anteriores botines. Al Tesoro Pblico entrega parte de todos los bienes
muebles e inmuebles (Lpez Pereira 1980, p. 85).

En la oracin (13), el objeto directo superbos exercitus, comn al gerundio y al verbo finito favorece la interpretacin anterior del gerundio, porque
as est claro que los ejrcitos fueron primero sometidos y despus enviados
para luchar.
13. Tunc Abulcathar transmarinis partibus nec mora superbos Hispaniae
domando sub nomine prelii mittit exercitus (Chron. Muz. 88).

9
A diferencia del traductor, creemos que tanto el participio como el gerundio se refieren
al sujeto de la oracin y que el gerundio no expresa el modo de la accin del participio. El
participio ya est determinado por el complemento circunstancial de modo flagellis y, adems,
est separado de penas inferendo por la oracin subordinada.

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

380

JANA MIKULOV

Abulcatar sometiendo inmediatamente a los turbulentos ejrcitos de


Espaa, los enva allende los mares con el pretexto de una guerra (Lpez
Pereira 1980, p. 115).

Otro factor de carcter contextual es la coordinacin de dos gerundios,


que puede contribuir a que los dos se interpreten como anteriores o simultneos, si no lo prohben otros factores. En la oracin (3), la coordinacin del
gerundio preuigilando con el gerundio disponendo, que es tlico y anterior
al predicado principal, apoya, a nuestro modo de ver, la lectura anterior del
preuigilando con el sentido de dejar vigilar u organizar la vigilancia.
Como en la Crnica mozrabe no aparece la coordinacin del gerundio o
del participio de presente con el verbo finito, no suponemos probable la
coordinacin del disponendo con el predicado se sublimat, lo cual sera un
argumento a favor de la lectura simultnea.
En la Crnica mozrabe aparecen tambin los participios de presente que
estn situados en el mismo nivel de la oracin que los ablativos de gerundio
anteriores, por ejemplo, extorquens (11) o diuerberans (2). Se trata, en nuestra opinin, de muestras de la aproximacin entre el participio de presente y
el ablativo de gerundio.
La (im)posibilidad o la (im)probabilidad de la interpretacin simultnea o
anterior se basa, tambin, en el conocimiento del mundo por parte del emisor
y el receptor. A menudo se prefiere una de las interpretaciones, aunque la otra
no queda necesariamente descartada. Por ejemplo, en (6) se nos viene antes
a la mente la interpretacin despus de leer el libro que la interpretacin
durante la lectura del libro.
Igualmente, en la oracin (7) preferimos interpretar los gerundios como
anteriores, porque no consideramos probable que la inculpacin, la imposicin de diversas penas y el azotamiento tengan lugar al mismo tiempo.
La interpretacin del gerundio belligerando en la oracin (14) es difcil
por varias razones.
14.

(Vlit) quatuor per annos belligerando gentes, iam regno agendo multis honoribus preditus triumphat per annos VIIII (Chron. Muz. 51).
empeado en la labor de ensanchar su reino en lucha con otros pueblos durante cuatro aos, vive (sc. Ulit) colmado de honores nueve aos
de constantes triunfos (Lpez Pereira 1980, p. 67).

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

381

Aparece all un lugar oscuro regno agendo con variantes textuales y conjeturas (v. Lpez Pereira 1980, pp. 66-67). El gerundio belligerando es una
actividad, pero la expresin temporal quatuor per annos le otorga las caractersticas de una oracin tlica (v. Smith 1997, pp. 23-25). El sintagma de
gerundio en combinacin con el predicado principal triumphat, acompaado
de la expresin temporal per annos VIIII, parece expresar anterioridad. La
duracin del reinado de Ulit10 sera, entonces, de 13 aos. La Crnica bizantina-arbiga, fuente de la Crnica mozrabe, dice que Ulit estuvo en el poder
nueve aos y despus pasa a describir su reinado con ms detalle. El autor
de la Crnica mozrabe sigue este esquema y copia frases enteras, pero aade ms datos, como, entre ellos, informacin sobre la duracin de las luchas.
La discrepancia entre las fechas se puede deber, en nuestra opinin, a las
dificultades del autor a la hora de construir el texto. Martn 2006, pp. 6-7,
afirma que ya el autor de la Crnica bizantina-arbiga parece tener serias
dificultades para expresarse en un latn escrito mnimamente correcto. Esta
observacin es aun ms vlida para el latn de la Crnica mozrabe. Nos
parece posible que con el predicado principal triumphat el autor quiera referirse al reinado en su conjunto y con el gerundio belligerando solamente a
una de sus partes. La corrupcin de los manuscritos hace la explicacin de
este pasaje ms difcil. Partiendo solamente del texto conservado creemos,
sin embargo, que es posible considerar belligerando como anterior al predicado principal.
A nuestro modo de ver, la existencia de los gerundios anteriores no
puede explicarse solamente como un mero error casual o como la incapacidad
del autor para utilizar y compilar bien sus fuentes. Los gerundios anteriores
estn en consonancia con la tendencia a la aproximacin gradual entre el
ablativo de gerundio y el participio de presente (cf. supra). Ntese que en la
oracin (1) aparece el gerundio effugiendo, mientras que en la Crnica bizantina-arbiga aparece el participio de presente fugiens11.

Walid I, que rein entre 705-715 (v. Martn 2006, p. 18, n. 58).
Filius quoque Cosdroe Persarum regis patrem fugiens principi se Romano obtulit
(Chron. Byz.-Arab. 10). El hijo del rey persa Cosroes huy de su padre y se entreg al
general romano
10
11

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

382

3.

JANA MIKULOV

Orden de los constituyentes

Los gerundios que se pueden interpretar como anteriores, preceden, en la


mayora de los casos, al verbo finito. Solamente el gerundio repedando (9)
est pospuesto, aunque su valor semntico queda claro a partir del contexto.
Los otros gerundios pospuestos documentados en la Crnica no expresan
anterioridad; este es el caso, por ejemplo, de peruenit nauigando (Chron.
Muz. 1). La misma tendencia se puede observar en los participios de presente
anteriores.
III.

GERUNDIO

ANTERIOR EN OTROS TEXTOS

Al hacer una bsqueda en los textos del mismo territorio y de la misma


poca, o de un territorio y poca cercanos, hemos averiguado que el uso de
los gerundios anteriores no es habitual. Hemos examinado los textos del
Corpus Scriptorum Muzarabicorum, datados en el siglo VIII, y los textos de
la edicin electrnica de los MGH, procedentes de los siglos VII y VIII. Los
ejemplos de los gerundios anteriores son muy escasos y no pasan de diez.
La escasez de ejemplos se puede deber tambin al gnero de la obra. Este es
el caso de los tratados teolgicos (que conforman, en gran parte, el Corpus),
cuyo objetivo no es la descripcin cronolgica de los eventos. Sin embargo
estos tambin se encuentran con poca frecuencia en textos narrativos de
carcter historiogrfico. La interpretacin de los gerundios es a menudo ambigua y la lectura anterior se establece a partir del contexto. En el ejemplo
tomado de Paulo Dicono12 aparece el gerundio uidendo, de estado de cosas
tpicamente ambiguo (v. Smith 1997, pp. 56-57), acompaado del adverbio
subito de repente, enseguida que indica unvocamente la sucesin de las
acciones. En otro ejemplo, tomado de Ionas13, el valor de anterioridad del
gerundio penetrando se deduce a partir del orden de los constituyentes y el
conocimiento del mundo. Por eso es ms probable la interpretacin anterior
12
Ille autem qui baptismum, accipere uolebat, uidendo tam novam causam subito abiit
ad catholicam ecclesiam (Paul. Diac., Hist. Rom. Excerpta Bamb., AA II, 16). Pero cuando este, quien quera ser bautizado, vio una cosa tan nueva, enseguida se fue a la iglesia
catlica
13
frater [communis] Segonus abdite fores ecclesie penetrando Dominum orationibus
pulsat. (Ionas, V. Ioh. abb. Reomaensis, MGH SS rer. Germ. XXXVII, 14) el fraile Segono
entr a escondidas en la iglesia y rez al Seor con insistencia.

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

383

(entr en la iglesia y rez) que la simultnea (rez solamente durante la


entrada en la iglesia).
En los textos narrativos abundan los participios de presente, incluidos los
que expresan anterioridad. En los MGH se encuentran tambin los participios
de presente anteriores de algunos de los verbos cuyos gerundios pueden
interpretarse como anteriores en la Crnica mozrabe. Se trata, por ejemplo,
de los participios diuidentes (Fredeg. cont., SS rer. Merov. II, 25) o inrumpentes (Ionas, V. Columbani SS rer. Germ. XXXVII, 2, 10).
IV.

COMPARACIN

CON EL ESPAOL ANTIGUO

Algunas caractersticas del gerundio en espaol antiguo, descritas en la obra


de Muo Valverde 1995, son muy semejantes a las caractersticas de los
ablativos de gerundio anteriores en la Crnica mozrabe. Muo Valverde
1995, pp. 92-93, observa que la coincidencia de las acciones del gerundio y
el verbo principal puede ser muy limitada. Segn l, en algunos contextos
puede desaparecer y el gerundio puede expresar anterioridad o posterioridad
real. Los gerundios simultneos son mucho ms frecuentes que los anteriores
y entre los anteriores prevalecen los que expresan anterioridad inmediata.
Muo Valverde 1995, p. 97, afirma que los gerundios anteriores suelen anteponerse al verbo finito y que, en caso de posponerse, el orden cronolgico de
los eventos se expresa mediante otros procedimientos. Observa (ibd., p. 94)
que los factores importantes son el contexto, el lexema del gerundio y del
verbo finito y el tiempo verbal del verbo finito. Es posible, por lo tanto, ver
paralelos entre el uso del gerundio en espaol antiguo y de los ablativos de
gerundio en la Crnica mozrabe.
V.

CONCLUSIN

La interpretacin anterior de los ablativos de gerundio es resultado de la


interaccin de varios factores. Entre los ms importantes se encuentran el estado de cosas del gerundio y del predicado principal de la oracin, el aspecto
gramatical, el contexto, el orden de constituyentes y tambin los conocimientos compartidos por el emisor y el receptor. La mayora de los gerundios
anteriores y los predicados principales correspondientes pueden clasificarse
como tlicos y/o momentneos. Los verbos finitos de las oraciones analizadas aparecen en la mayora de los casos en presente histrico, tiempo que en
Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

384

JANA MIKULOV

la Crnica mozrabe alterna con el perfecto en la narracin de los hechos. La


ausencia del morfema terminativo en el gerundio y su derivacin del tema
del infectum contribuye a la interpretacin ambigua de algunos gerundios. El
factor importante para la interpretacin anterior de algunos gerundios es el
contexto. Se puede observar una fuerte tendencia a anteponer los gerundios
anteriores a los verbos finitos y a organizar las acciones cronolgicamente,
en consonancia con el gnero de la obra y con el modo de estructurar el texto
en las obras historiogrficas de la latinidad tarda. El receptor desempea el
papel ms importante, puesto que a partir de los factores mencionados y su
conocimiento del mundo es quien opta por la interpretacin ms probable.
La bsqueda, realizada en algunas obras del perodo comparable, muestra
que en ellas el ablativo de gerundio anterior es poco frecuente y que aparecen ms a menudo los participios de presente anteriores. En nuestra opinin, el uso del gerundio anterior en la Crnica mozrabe es una muestra
del proceso de aproximacin entre el ablativo de gerundio y el participio de
presente. Este, al expresar anterioridad, es mucho ms frecuente y tiene caractersticas comparables a las que hemos descubierto en los ablativos de
gerundio estudiados. Existen tambin paralelos entre el uso del ablativo de
gerundio en la Crnica mozrabe y en los textos en espaol antiguo.
BIBLIOGRAFA
Bertinetto, P. M. 1997: Il dominio tempo-aspettuale, Turn, Rosenberg & Sellier.
Carvalho, P. de 2001: Du nom (d)verbal en -ndo/a-: gerundivm vs gerundivvm, en Moussy, C. et al. (eds.), De lingua Latina novae quaestiones: Actes
du X Colloque International de Linguistique Latine, Paris - Srves, 19-23 avril
1999, Lovaina, Peeters, pp. 307-320.
Christol, A. 1999: Autour du grondif latin : Comment le temps vient aux noms
verbaux, en Vogeleer, S. et al. (eds.), La modalit sous tous ses aspects, msterdam-Atlanta (GA), Rodopi, pp. 115-133.
Comrie, B. 1976: Aspect, Cambridge, Cambridge University Press.
Gil, J. (ed.) 1973: Corpus Scriptorum Muzarabicorum I, Madrid, Instituto Antonio
Nebrija.
Joffre, M.-D. 1995 : Le verbe latin: voix et diathse, Lovaina, Peeters.
Haverling, G. 2000: On Sco- Verbs, Prefixes and Semantic Functions: A study in the
development of prefixed and unprefixed verbs from Early to Late Latin, Studia
Graeca et Latina Gothoburgensia LXIV, Gotemburgo.
Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

A B L AT I V O D E G E R U N D I O A N T E R I O R E N L A C R N I C A M O Z R A B E

385

Lpez Pereira, J. L. (ed.) 1980: Crnica mozrabe de 754, Zaragoza, Anubar Ediciones.
Maiden, M. 1996: The Romance gerund and system dependent naturalness in
morphology, Transactions of the Philological Society 94, 2, pp. 167-201.
Maraldi, M. 1994: Some remarks on the historical development of the ablative
of the gerund in Latin, en Calboli, G. (ed.), Papers on Grammar IV, Bolonia,
CLUEB, pp. 141-164.
Martn, J. C. 2006: Los Chronica Byzantia-Arabica, e-Spania [En lnea], 1, junio 2006, puesto en lnea el 22 agosto 2010, <http://e-spania.revues.org/329>
(28/04/2011).
Mellet, S., Joffre, M.-D. 1994: Le supin et le grondif, en Mellet, S., Joffre, M.D. y Serbat, G. (eds.), Grammaire fondamentale du latin. Le signifi du verbe,
Lovaina-Pars, Peeters, pp. 369-384.
Monumenta Germaniae historica (MGH 8) [CD-ROM], Turnhout, Brepols, 20088.
Muo Valverde, J. L. 1995: El gerundio en el espaol medieval (s. XII-XIV), Mlaga: gora.
Pinkster, H. 1983: Tempus, Aspect and Aktionsart, Aufstieg und Niedergang der
rmischen Welt 29, 1, pp. 270-319.
Pinkster, H. 1998: Is the Latin present tense the unmarked, neutral tense in the system?, en Risselada, R. (ed.), Latin in Use: Amsterdam studies in the pragmatics
of Latin, msterdam, J. C. Gieben, pp. 63-83.
Smith, C. S. 19972: The Parameter of Aspect, Dordrecht-Boston-Londres, Kluwer.
Traina, A., Bertotti, T. 19932: Sintassi normativa della lingua latina: teoria, Bologna,
Cappelli.
Touratier, Ch. 1994: Syntaxe Latine, Lovaina-la-Nueva, Peeters.
Vester, E 1983: Instrument and Manner expressions in Latin, Assen, Van Gorcum.
Vester, E. 1991: Reflections on the gerund and gerundive, en Coleman, R. (ed.),
New Studies in Latin Linguistics. Selected Papers from the 4th Internalional Colloquium on Latin Linguistics, Cambridge, April 1987, msterdam, Benjamins,
pp. 295-309.

Fecha de recepcin de la primera versin del artculo: 01/08/2011


Fecha de aceptacin: 09/07/2012
Fecha de recepcin de la versin definitiva: 07/08/2012

Emerita LXXX 2, 2012, pp. 371-385

ISSN 0013-6662

doi: 10.3989/emerita.2012.19.1117

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 387-399
ISSN 0013-6662 doi: 10.3989/emerita.2012.20.1206

Notas e informacin
El canto de Quirn y el ethos de la msica.
A propsito de Silio Itlico XI 453-458
The song of Chiron and the ethos of music.
Note on Silius Italicus XI 453-458

Antonio Ro Torres-Murciano
Universidad Nacional Autnoma de Mxico
antonio_rio@enesmarelia.unam.mx

A pesar de las transposiciones propuestas por varios editores, los versos XI 453-458 de las
Pnicas de Silio Itlico, que atribuyen al centauro Quirn un canto de tema cosmolgico,
tienen sentido si se los entiende como una estilizacin literaria de ciertas doctrinas antiguas
acerca de los efectos morales y el valor pedaggico de la msica.
Palabras clave: pica flavia; Silio Itlico; crtica textual; msica antigua y educacin.
Despite the transpositions proposed by several editors, lines XI 453-458 of Silius Italicus
Punica, which attribute to the Centaur Chiron a cosmological song, make sense if they are
understood as a literary stylization of ancient doctrines about the moral effects and pedagogical value of music.
Keywords: Flavian epic; Silius Italicus; textual criticism; ancient music and education.

En el libro XI de las Pnicas (434-482), el bardo Teutras acta por segunda vez para
Anbal y sus hombres, quienes, tras la victoria de Cannas, se han abandonado a los
placeres que les ofrece la rica ciudad campana de Capua. El objeto de su cantar lo
constituyen las soberbias glorias de la lira (superbas / Aoniae laudes testudinis,
435-436), instrumento taido con portentosas consecuencias por clebres msicos
mticos como Anfin, Arin, Quirn y Orfeo:
isque ubi mirantem resonantia pollice fila
ductorem uidit Libyae, canere inde superbas
Aoniae laudes sensim testudinis orsus
concordem citharae mouit per carmina linguam,
uincere linquentis uitam quae possit olores,

435

388

N O TA S E I N F O R M A C I N

atque haec e multis carpsit mollissima mensae:


Argolicis quondam populis, mirabile dictu,
exaudita chelys lapidem testudine felix
ducere et in muris posuisse uolentia saxa.
haec Amphionio uallauit pectine Thebas
ac silice aggeribus per se scandente uocatis
iussit in immensum cantatas surgere turres.
altera turbatum plectro moderata profundum
et tenuit phocas et in omni Protea forma
traxit et aequoreo portauit Ariona dorso.
nam quae Peliaca formabat rupe canendo
heroum mentes et magni pectora Achillis,
Centauro dilecta chelys, compesceret iras
percussa fide uel pelagi uel tristis Auerni.
namque chaos, caecam quondam sine sidere molem
non surgente die, ac mundum sine luce canebat.
tum deus ut liquidi discisset stagna profundi
tellurisque globum media compage locasset,
ut celsum superis habitare dedisset Olympum,
castaque Saturni monstrabat saecula patris.
sed quos pulsabat Riphaeum ad Strymona neruos
auditus superis, auditus manibus Orpheus,
emerito fulgent clara inter sidera caelo.
hunc etiam mater, tota comitante sororum
Aonidum turba, mater mirata canentem.
non illo Pangaea iuga aut Mauortius Haemus,
non illo modulante sonos stetit ultima Thrace.
cum siluis uenere ferae, cum montibus amnes,
immemor et dulcis nidi positoque uolatu
non mota uolucris captiua pependit in aethra.
quin etiam, Pagasaea ratis, cum caerula nondum
cognita terrenae pontumque intrare negaret,
ad puppim sacrae cithara eliciente carinae
adductum cantu uenit mare. pallida regna
Bistonius uates flammisque Acheronta sonantem
placauit plectro et fixit reuolubile saxum.
o dirae Ciconum matres Geticique furores
et damnata deis Rhodope! tulit ora reuulsa
in pontum ripis utraque sequentibus Hebrus.
tum quoque, cum rapidi caput a ceruice recisum
portarent fluctus, subito emicuere per undas
ad murmur cete toto exultantia ponto.
sic tunc Pierius bellis durata uirorum
pectora Castalio frangebat carmine Teuthras.
Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

440

445

450

455

460

465

470

475

480

doi: 10.3989/emerita.2012.20.1206

389

N O TA S E I N F O R M A C I N

La situacin de los vv. 453-458, que atribuyen al centauro Quirn un canto acerca
del origen del universo1, fue puesta bajo sospecha ya por Ruperti 1795-1798, ad loc.,
quien, recordando que tanto Apolonio de Rodas (I 496-511) como las Argonuticas
rficas (419-431) relatan una cosmogona por boca de Orfeo, aventur la posibilidad
de colocarlos tras el v. 461. Y esta propuesta fue contemplada favorablemente por
Delz 1987 en el aparato crtico de su edicin teubneriana, de la que hemos tomado el
texto. Mas el propio Ruperti reconoca que la formacin del mundo no era un tema
que le perteneciese exclusivamente a Orfeo, puesto que Virgilio haba hecho ejecutar
cantares de este jaez al agreste Sileno (Ecl. VI 31-40) y al aedo pnico Jopas (Aen.
I 740-746). El segundo de estos loci Vergiliani ha sido aducido por Burck 1984,
p. 17, y por Schenk 1989, pp. 353-354, para defender la transposicin planteada
por Summers 1900, pp. 306-307, y aceptada por Duff 1934, quien al igual que
Summers 19042 imprime el pasaje que nos ocupa entre los vv. 290 y 291 del libro XI, hacindolo pasar del segundo canto de Teutras al primero, que reproducimos
a continuacin tal como se encuentra en la edicin de Delz (XI 288-297):
Personat Euboica Teuthras testudine, Cymes
incola, et obtusas immiti murmure saeuae
inter bella tubae permulcet cantibus auris.
namque Iouem et laetos per furta canebat amores
Electraeque toros Atlantidos, unde creatus
proles digna deum tum Dardanus, isque Tonanti
ut det Ericthonium magna de stirpe nepotem.
hinc Tros, hinc Ilus, generis tunc ordine longo
Assaracus, nulloque minor famaue manuue
tum Capys ut primis dederit sua nomina muris.

290

295

En caso de que se aceptase la transposicin, el Teutras de Silio interpretara un


canto de tema cosmognico en el marco de un convite servido a los cartagineses
establecidos en Capua, al igual que haca el Jopas de Virgilio durante el banquete
ofrecido por Dido a los troyanos recin llegados a su ciudad. Y la imitacin virgiliana
vendra a corroborar as la interpretacin de Summers, quien vea en la cosmogona
coronada por el reinado de Saturno (453-458) un perfecto preludio de la genealoga
que hace descender de Jpiter a Capis, fundador mtico de la capital campana (291-

Como bien ha precisado Summers 1900, p. 306, el sujeto del canebat del v. 454 no
puede ser Teutras aun cuando en el v. 453 se lea ianmque en lugar de namque, ya que el
canto de Orfeo (459 ss.) es narrado en estilo directo inmediatamente despus del de Quirn.
Cf. Spaltenstein 1990, ad loc.
2
Con la diferencia de que, en el v. 453, Duff conserva el namque de los manuscritos, al
que Summers prefiere el iamque que se halla en varias ediciones anteriores.
1

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

390

N O TA S E I N F O R M A C I N

297)3. Hallaran as sentido unos versos que, en el lugar en que los transmiten los
manuscritos, quiebran la lnea argumental del segundo canto de Teutras, por cuanto
introducen abruptamente la filosofa natural en el elogio de la lira.
El predicamento obtenido por la propuesta de Summers hizo que Martin incluyera en la edicin Bud de las Pnicas un apndice dedicado a la defensa del textus
receptus (Volpilhac-Lenthric et al. 1984, pp. 257-261)4. A su juicio, mientras que
el primer canto de Teutras tiene una funcin analptica ya que, a travs de la genealoga de Capis, se rememora el vnculo entre Capua y Roma, ambas de estirpe
troyana, el segundo desempea una funcin prolptica con respecto a la accin
del poema siliano: as como las murallas de Tebas, construidas por Anfin al son de
la lira (440-445), prefiguran las de Roma cuyo decisivo papel cual ltima defensa
contra Anbal constituye un motivo recurrente en las Pnicas, bien estudiado por
von Albrecht 1964, pp. 24-46, el dominio sobre el mar logrado por Arin con su
msica (446-448) anticipa la conquista romana de Sicilia relatada por Silio en el
libro XIV, y la educacin procurada por Quirn a sus alumnos (449-458) apunta
al herosmo de Escipin, el glorioso vencedor de Zama. Aun cuando estas referencias
prospectivas y sobre todo la ltima nos parecen francamente forzadas, compartimos con Martin el convencimiento de que slo un estudio literario que esclarezca
la dimensin didctica de la actividad musical del centauro podr arrojar luz sobre
el pasaje controvertido. Si, con tal estudio, conseguimos desentraar las razones que
pueden haber movido al autor de las Pnicas a especificar el contenido del canto de
Quirn cosa que no hace en el caso de los otros tres msicos mencionados junto
con este, estaremos en condiciones de responder a aquellos que, tras la estela de
Summers, han considerado que la cosmogona est decididamente fuera de lugar en
un pasaje consagrado a las glorias de la lira.
Empezaremos por los vv. 449-452, cuya colocacin nadie discute. Ya en ellos encontramos una particularidad de la lira de Quirn, puesto que slo en su caso se hace
referencia el efecto de la msica sobre oyentes humanos5. Mientras que los cantos de
los otros tres arpistas embelesan a seres inanimados (las piedras movidas por Anfin,
3
Para sostener la transposicin podra hallarse otro paralelismo virgiliano en el canto de
Clmene, que narra los amores de los dioses a partir del Caos (inter quas curam Clymene
narrabat inanem / Volcani, Martisque dolos et dulcia furta, / aque Chao densos diuum numerabat amores, G. IV 345-347). De modo similar, el primer canto de Teutras enlazara una
cosmogona originada en el Caos (453) con los amores furtivos de Jpiter (291).
4
No fue seguida, en cambio, por ningn editor, la transposicin de Bothe 1855-1857,
quien tradujo los vv. 453-458 tras el v. 433, de tal modo que la cosmogona constituye un
canto ejecutado por Teutras que precede, en estilo indirecto, al elogio de la lira referido en
estilo directo.
5
Hasta cierto punto, el centauro es desde el primer momento un intruso en el catlogo
de los msicos de poderes prodigiosos, puesto que Orfeo suele comparecer en compaa de

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

N O TA S E I N F O R M A C I N

391

los mares dominados por Arin, los montes y los ros y el mar encantados por Orfeo),
a animales (las focas y los delfines atrados por Arin, las fieras y los pjaros fascinados por Orfeo) o a divinidades (Proteo al escuchar a Arin, los dioses celestes y
los del inframundo y las Musas al escuchar a Orfeo), la de Quirn es una lira profesoral que ejerce su poder sobre los hroes encomendados a la tutela del centauro y,
en particular, sobre Aquiles, el ms seero de sus discpulos: Peliaca formabat rupe
canendo / heroum mentes et magni pectora Achillis (449-450). La idea de que la msica es pedaggicamente til porque puede influir de una determinada manera en el
FDUiFWHUGHOR\HQWHVHUHPRQWDDODVUHIOH[LRQHVSLWDJyULFDVDFHUFDGHOD
 FI6WUGeog. I 2.3), a partir de las cuales el ateniense Damn de Oa puso
HQ pSRFD GH 3HULFOHV ORV FLPLHQWRV GH XQD HQWHUD WHRUtD DFHUFDGH ORV GLYHUVRV
RHIHFWRVPRUDOHVGHPHORGtDVULWPRV\6, a la que contribuyeron filsofos
como Platn y Aristteles y musiclogos como Aristxeno, de Tarento, Clenides y
Arstides Quintiliano7. Segn la versin simplificada de esta doctrina que hallamos
en Sneca y en Quintiliano el rtor, la msica causa en el nimo efectos opuestos, ya
que puede resultar bien excitante o bien calmante:
Pythagoras perturbationes animi lyra componebat; quis autem ignorat lituos et tubas
concitamenta esse, sicut quosdam cantus blandimenta quibus mens resoluatur? (Sen.,
De ira III 9).
Pythagoreis certe moris fuit et cum euigilassent animos ad lyram excitare, quo essent
ad agendum erectiores, et cum somnum peterent ad eandem prius lenire mentes, ut, si
quid fuisset turbidiorum cogitationum, componerent (Quint., Inst. I 10.31-32).

Por cuanto atae concretamente a la influencia de la lira de Quirn en el nimo


de Aquiles, Ovidio, en la que constituye la primera referencia escrita a la educacin
musical como parte de las enseanzas recibidas del centauro por el hroe8, se decanta

Anfin (Hor., Ars 391-396; Prop. III 2.3-6), de Arin (Verg., Ecl. VIII 56) o de ambos (Ou.,
Ars III 321-326; Stat., Silu. II 2.60-62).
6
Aunque los tericos de poca helenstica y romana utilizaron este trmino en sentido
restringido para referirse a la disposicin de los intervalos en el interior de la escala, precisa
&RPRWWL  SS   TXH HQ ORV VLJORV 9, \ 9 D &  LQGLFDYD LQIDWWL XQ
complesso di caratteri che concorrevano ad individuare un certo tipo di discorso musicale.
7
Cf. Abert 1899, esp. pp. 5-26; Anderson 1966; Mathiesen 1984; Comotti 1991, pp. 3334, 48; West 1992, pp. 246-253; Gibson 2005, pp. 112-121.
8
Aunque Quintiliano (Inst. I 10.30) afirma que la utilidad pedaggica de la msica ha
sido generalmente reconocida antiquitus usque a Chirone atque Achille ad nostra tempora, la
historia segn la cual Aquiles haba aprendido de Quirn a tocar la lira es menos antigua de lo
que sus palabras podran inducir a suponer. Todos los ejemplos de representaciones plsticas
aportados por el LICM (1.1, s. u. Achilleus, 50-63) datan del perodo romano, aun cuando
Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

392

N O TA S E I N F O R M A C I N

por la segunda posibilidad. La ctara9 le sirve al maestro para apaciguar el carcter


impetuoso del alumno: Phillyrides puerum cithara perfecit Achillem, / atque animos
placida contudit arte feros (Ars I 11-12)10. Sneca, en cambio, pone en boca del coro
de las Troyanas (832-835) una versin segn la cual Quirn azuza con su instrumento
la innata ferocidad de Aquiles:
iam trucis Chiron pueri magister,
tinnulas plectro feriente chordas,
tunc quoque ingentes acuebat iras
bella canendo.

Al lector familiarizado con el idlico retrato de la relacin pedaggica entre


Aquiles y Quirn trazado por Ovidio en los Fasti, donde el ethos sereno de la msica
del centauro parece llamado a retardar el sanguinario destino de su pupilo (ille manus
olim missuras Hectora leto / creditur in lyricis detinuisse modis, V 385-386)11, le
cabrn pocas dudas de que Sneca est reaccionando aqu contra el pacfico enfoque

muchos de ellos, como el famoso fresco de la baslica de Herculano (51), parecen remontarse
a un modelo griego de los siglos III-II a. C., que podra ser el original del grupo escultrico
de los Saepta Iulia mencionado sin descripcin por Plinio el Viejo (Nat. XXXVI 29); hace
ver, sin embargo, Kemp-Lindemann 1975, pp. 18-24, que no se puede datar con certeza
este particular del mito de Aquiles antes del siglo I a. C. Slo en poca tarda se encuentran
referencias escritas a Quirn como msico (Orph., A. 380-382, 404 ss.), como profesor de
msica (Iuv. 7.212; Philostr., Her. 32, 45; Plu., Mus. 1145d-1146a; Orph., A. 398) o incluso
FRPR   (XVW Il. 463.30). A pesar del escolio a Hom., Il. XVI 37 segn el
cual Licofrn habra incluido el arte de la lira entre las enseanzas recibidas por Aquiles de
su maestro, aducido por Roussel 1991, p. 115, la hiptesis de Guerrini 1958-1959, pp. 47-48,
50-52, acerca de una Aquileida helenstica en la que habra figurado la leccin de msica es,
como advierte Ripoll 2008, pp. 8-9, altamente especulativa.
9
Acerca de las diferencias tcnicas entre la lyra, usada con frecuencia para ensear msica a los jvenes, y la cithara, instrumento de mayor complejidad que se confunde con la
primera en el lenguaje potico, cf. Comotti 1991, pp. 64-68; West 1992, pp. 49-60; Mathiesen
1999, pp. 237-270; Landels 2001, pp. 47-68; Hagel 2010, pp. 76-92.
10
Una explicacin ms precisa del objetivo perseguido por Quirn se halla en Filstrato:
            
        Her. 45). La reluctancia mostrada por
el discpulo frente a las clases de msica es ilustrada por una escena del plato de plata de
Kaiseraugst (LICM 1.1 , s. u. Achilleus, 63), en la que Aquiles aparece arrojando al suelo
la lira que le ha ofrecido Quirn; cf. Manacorda 1971, pp. 45-51; Fantham 1999, pp. 59-60;
Leader-Newby 2004, pp. 125-130.
11
Cf. Brookes 1994, p. 445; Newlands 1995, p. 116.
Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

N O TA S E I N F O R M A C I N

393

dado al asunto en las obras del Sulmonense12. Veamos ahora qu postura adopta Silio
Itlico frente a esta respuesta dada por el escritor neroniano al augusteo.
A primera vista, el planteamiento de Silio se descubre ms ovidiano que senecano. Sometiendo el mar y el inframundo a la lira que ha moldeado el carcter de
Aquiles (compesceret iras / uel pelagi uel tristis Auerni XI 451-452), el pico
flavio no slo refuta el acuebat iras del trgico neroniano (Tro. 834), sino que amplifica los efectos calmantes del canto de Quirn de tal manera que, potencialmente,
lo pone en paralelo con los de Anfin, Quirn y Orfeo, capaces de dominar a seres
inanimados13. Pero la utilidad educativa de la msica es slo una de las posibilidades
que se derivan de su poder de seduccin, explotado por Teutras con el fin de enervar
los nimos de los cartagineses. Al cantar para ellos las glorias de la lira, el bardo
itlico est llevando a cabo el designio de Venus, valedora de los romanos que ha
encontrado en este instrumento un arma para debilitar a Anbal (madenti / post epulas
sit grata chelys, XI 407-408)14. Junto con el amor, el vino y los banquetes, la msica
ocupa un lugar muy notable entre las delicias de Capua, que habrn de corromper el
ardor marcial de los enemigos de Roma (Bacchi dona uolunt epulasque et carmina
rursus / Pieria liquefacta lyra, XI 414-415); en consecuencia, la cancin de Teutras
termina por quebrar los belicosos espritus de los oyentes (sic tunc Pierius bellis
durata uirorum / pectora Castalio frangebat carmine Teuthras, 481-482), un ejrcito
en el que no haban hecho mella las penalidades de la guerra (acies, quam non perfregerit ensis, / non ignes, non immissis Gradiuus habenis, XI 398-399).
Mas, si centramos nuestra atencin en Quirn y Aquiles, no estar de ms preguntarnos hasta qu punto la msica, cuyos efectos debilitantes han sido tan enfatizados,
puede ser de utilidad para educar a un hroe. Constituye la msica, en general, una
influencia corruptora? Esta opinin, tal como fue sostenida por un escptico cual
Sexto Emprico (M. 6.27-35)15, chocara con el reconocimiento que hace Silio del
Propsito al cual incluso la diccin del pasaje est enderezada, puesto que iras acuere
es una expresin marcial referida a la agresividad de los soldados por Livio (IX 9.18, XXII
4.1, XL 26.9) y por Virgilio (Aen. IX 464), y tambin al ardor guerrero de las abejas por el
segundo (Aen. XII 590).
13
Como bien ha notado Brure 1959, p. 234, no existe una diferencia sustancial entre
el hecho de someter los mpetus de Aquiles, de acuerdo con el enfoque de Ovidio, y el de
dominar el mar y el inframundo. Schenk 1989, p. 367, le atribuye al pasaje un sentido adversativo que, en nuestra opinin, no se encuentra en el texto latino, entendiendo que la msica
spornt sie an, wie im Fall des Achill, bricht aber auch wildes Ungestm.
14
Designio que, como ha sealado Martin (Volpilhac-Lenthric et al. 1984, p. 258), podra estar realizando conscientemente Teutras, cuya ciudad de origen, Cumas (XI 288), haba
permanecido leal a Roma.
15
Deudor en este punto de la aversin epicrea a la msica atestiguada en Filodemo de
Gdara (Mus. IV, col. 13.28-32 Kemke), probablemente cercana a las ideas defendidas por
12

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

394

N O TA S E I N F O R M A C I N

poder pedaggico de la lira del centauro. La solucin a esta aparente contradiccin se


encuentra en el hecho de que, segn ha precisado el narrador de las Pnicas, Teutras
ha escogido una cancin blandsima (haec e multis carpsit mollissima, XI 439),
acomodada al propsito de Venus. En efecto, desde Damn de Oa (fr. 6 Lasserre)16
constituye un punto muy importante de la doctrina del ethos musical la idea de que
no cualquier tipo de msica resulta apropiado para la educacin de la juventud.
Siguiendo una dicotoma establecida por Platn (R. 397b-d; Lg. 700d-701a) y probablemente desarrollada por Aristxeno de Tarento17, de la que se hace eco Cicern
(Leg. II 39), Quintiliano (Inst. I 10.31) opone netamente la adusta msica viril de los
viejos tiempos a la msica afeminada de su propia poca:
Quamuis autem satis iam ex ipsis quibus sum modo usus exemplis credam esse manifestum quae mihi et quatenus musice placeat, apertius tamen profitendum puto non
hanc a me praecipi quae nunc in scaenis effeminata et inpudicis modis fracta non ex
parte minima si quid in nobis uirilis roboris manebat excidit, sed qua laudes fortium
canebantur quaque ipsi fortes canebant.

De acuerdo con este esquemtico antagonismo entre msica moralmente buena


o mala, cuyos orgenes se quiso remontar a la Ilada18, Silio Itlico ha enfrentado la
vieja lira de Quirn a la nueva lira de Teutras. Y, a fin de preservar esta distincin
aun cuando el canto pedaggico del centauro se inserta en el canto corruptor del

un personaje del De re publica ciceroniano en un pasaje perdido criticado por Arstides Quintiliano (II 6, p. 61 Winnington-Ingram). Algunas muestras de la prevencin mostrada frente
a la msica por los romanos afectos al mos maiorum se hallan en Sneca el Rtor (Con. I 1
praef. 8) y Macrobio (III 14.7).
16
Cf. Comotti 1991, p. 33.
17
Segn cuanto se puede inferir de los testimonios de Ateneo (XIV 632b) y de Temistio
(Or. 33) y del pseudo-plutarqueo De musica (1140a-1142b). Cf. Abert 1899, pp. 18-19; Gibson
2005, pp. 113-114.
18
 /DGH$TXLOHVXQuir fortis que canta laudes fortium ,; 
FRQVWLWX\H HO UHYHUVR GH OD  GH 3DULV FHQVXUDGR FRPR P~VLFR DIHPLQDGR SRU VX KHUPDQR+pFWRU 
,,, $XQTXHODDFWLYLGDGPXVLFDOGHO3HOLGDHVSUHVHQWDGDEDMRXQ
aspecto poco heroico en algunas reescrituras no picas del pasaje homrico (p. ej. Ou. Her.
3.113-120; Tr. IV 1.15-6; [Sen.], Oct. 814-816), la diferencia entre su lira y la de Paris, tal
como la pudieron concebir los antiguos, es claramente puesta de manifiesto en cierta historia
que cuenta Plutarco (Alex. 15; cf. De Alex. Fort. 331d; Ael., VH 9.38) acerca de la respuesta
dada por Alejandro Magno a quien ofreca mostrarle el instrumento del prncipe troyano:

               
Cf. Veneri 1995; Perceau 2007, pp. 19-20.
Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

N O TA S E I N F O R M A C I N

395

bardo itlico, ha tenido la precaucin de especificar el contenido del primero en los


vv. 453-458. Esta es, a nuestro juicio, la razn por la cual Teutras, que se limita a
referir los milagrosos efectos, pero no los contenidos, de las canciones de Anfin,
Arin y Orfeo, atribuye a Quirn una cosmogona que evoca los cantos virgilianos
de Jopas y de Sileno, junto con el relato ovidiano del origen del universo (Met. I
5-115)19. As como, en la sexta gloga, la frmula explicativa namque canebat (31)
introduce el canto de Sileno despus de que se haya descrito el entusiasmo que este
despierta en los oyentes (26-30), la cosmogona de Quirn e xpl i c a los efectos logrados en Aquiles y otros jvenes hroes por el canto de su maestro (namque /
canebat, 453-454), que no pueden ser los mismos que los causados por el canto
de Teutras en los cartagineses. La cancin filosfica enseada a sus pupilos por el
centauro se contrapone as a la cancin mitolgica ejecutada por el bardo de Cumas
para los hombres de Anbal, en la cual se incluye. Con el propsito de dejar claro
que la msica educativa de Quirn no es de la misma clase que la msica corruptora
de Teutras, Silio ofrece su propia respuesta a una pregunta a la que Ovidio y Sneca
haban contestado de manera ms ambigua: cul pudo ser el tema de las canciones
aprendidas por Aquiles de boca de su tutor? La cuestin no es balad, ya que, puesto
que la msica est inextricablemente ligada a y constituye desde Homero una
metonimia por la poesa, los efectos de la enseanza musical en el carcter de un
GLVFtSXORVHUiQSURGXFLGRVSRUODVPHORGtDVORVULWPRV\ODVSHURWDPELpQ
por las palabras20. No es pues sorprendente que, al identificar el objeto del canto de
Quirn, se le adjudique al centauro no solo un tipo de msica, sino tambin y a la
vez un tipo de poesa, i. e. un gnero potico. As, mientras que Ovidio se haba
referido a la msica apaciguadora del centauro como lyrici modi (Fast. V 386),
Sneca haba encontrado en la guerra (bella canendo, Tro. 835) el asunto idneo para
estimular la belicosidad de Aquiles. La primera formulacin puede aludir vagamente
a la poesa lrica, mientras que la segunda apunta a la poesa pica, cuyo objeto no
es otro que cantar guerras. Y precisamente con la pica identificar Estacio en su
Aquileida el canto de Quirn, maestro dedicado a celebrar a los antiguos hroes
(monstrare lyra ueteres heroas alumno, I 118) para incitar a la emulacin a un discpulo que ejecuta con gusto las piezas aprendidas (canit ille libens inmania laudum
/ semina, I 188-189), de gnero anlogo al de aquellos cantares de gesta puestos por

Cf. Ruperti 1795-1798, ad loc.; Brure 1959, p. 234; Burck 1984, pp. 17-18; Schenk
1989, pp. 353, 354 n.6.
20
En opinin de un detractor de la doctrina del ethos musical como Filodemo, los oyentes
eran de hecho persuadidos no por las caractersticas de la msica, sino por los textos poticos
DHVWDOLJDGRV>@ Mus. IV, col.
20.12-14 Kemke).
19

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

396

N O TA S E I N F O R M A C I N

+RPHURHQERFDGHOPHMRUGHORVDTXHRV Il. IX 189)21.


Silio, en cambio, halla en la filosofa natural el tema del canto del centauro.
La solucin adoptada por el autor de las Pnicas es ciertamente original, ya que
la cosmologa no figuraba entre los conocimientos tradicionalmente atribuidos a
Quirn, clebre por haber instruido a sus ilustres pupilos en la medicina (p. ej. Hom.,
Il. XI 832; Pi., P. 3.45-46, N. 3.52-58; Verg., G. III 550; Stat., Silu. I 4.98-99, Ach. I
117, II 159-63; Hyg., Fab. 138) y en la caza y las artes de la guerra (p. ej. Pi., N. 3.4352, 59-63; X., Cyn. 1; Stat., Ach. II 102-156; Apollod. III 4.4, 10.3). Parece razonable
suponer que tal innovacin obedece a la conocida admiracin de Silio por Virgilio,
que lo habra movido a hacer del centauro su propio Jopas22. Es Jopas, encarnacin
ficcional del poeta-filsofo retratado con pincel lucreciano en las Gergicas (II
475-492)23, el nico bardo cuyo canto se refiere en estilo indirecto en la Eneida (hic
canit I 742). Se podra, pues, ver aqu una imitacin fallida del Mantuano, en la
medida en que, al remedar el pasaje de Jopas, Silio ha introducido de manera forzada
en su poema un canto a la filosofa natural que no acaba de encajar en el himno a la
lira ejecutado por Teutras. Pero, mientras que la de Jopas era una cosmologa pura,
no reducida a prlogo de un variado poema mitolgico como aquel que sucede a la
de Sileno (Ecl. VI 41-84), la de Quirn es prolongada por un par de hexmetros que,
PHGLDQWHXQUHVXPHQODVXFHVLyQGHOUHLQRGH6DWXUQRSRUHOGH
los olmpicos: ut celsum superis habitare dedisset (sc. deus) Olympum, / castaque
Saturni monstrabat saecula patris. (XI 457-458)24. Esta referencia a la castitas de
los viejos tiempos saturnales pone en relacin el conocimiento de la naturaleza con
la moral, como bien ha notado Martin (Volpilhac-Lenthric et al. 1984, p. 259): son
chant, dans une perspective pythagoricienne peut tre une cosmogonie qui doit
rvler aux hros dont il a former lintelligence et le courage, les resorts du monde
o ils auront agir (rerum cognoscere causas), tout en leur donnant des exemples de
rgles morales suivre et en leur dsignant iidal atteindre: castaque Saturni.
Y la filosofa moral, la inculcacin de la rectitud y de la justicia, s constitua uno de
los objetos tradicionales de la actividad didctica de Quirn (p. ej. Pi., N. 3.57-58,
21
 (QFRQWUDPRVGHKHFKRXQDWUDGXFFLyQILHOGHODIyUPXODKRPpULFDHQHO
uirum honores mediante el que el Aquiles estaciano se refiere al objeto de los cantos que con
gran esfuerzo ha aprendido bajo la tutela de Quirn (nec maior in istis / sudor, Apollineo quam
fila sonantia plectro / cum quaterem priscosque uirum mirarer honores, Ach. II 156-158).
22
A no ser que estemos dispuestos a aceptar, con Nelis 2005, que la cosmogona atribuida a Quirn por Silio se remonta a una fuente perdida que habra sido utilizada tambin por
Apolonio Rodio (I 496-511), por Valerio Flaco (I 252-293) y por el autor de las Argonuticas
rficas (404-441).
23
Cf. Hardie 1986, p. 56.
24
Ya la cosmogona atribuida por Apolonio de Rodas a Orfeo conclua con el destronamiento de Crono por Zeus, narrado segn el orden cronolgico (I 505-510).

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

N O TA S E I N F O R M A C I N

397

P. 6.23-27; E., IA. 926-927; Stat., Ach.,, OODPDGR\DSRU+RPHUR Il. XI 832)25. Al proponer la cosmologa cuya dimensin tica
es reconocida por los antiguos a propsito de la cancin de Jopas26 como tema de
las enseanzas del centauro, Silio no hace sino revestir con el ropaje de la theologia
fabulosa los argumentos con los que Sneca recomendaba a Lucilio el estudio de la
rerum natura por sus beneficios morales, en la idea de que la filosofa natural cuyas bondades haba sido proclamadas por Virgilio (felix qui potuit rerum cognoscere
causas, G. II 490) puede liberar al alma inmortal del ser humano de los vnculos
que la atan al mundo sublunar gracias a la contemplacin de la mquina grandiosa
del universo27. Se dira en fin que, para de deslindar el aejo canto didctico de
Quirn del moderno canto corruptor de Teutras, de acuerdo con la contraposicin
entre msica vieja y nueva recabada de la doctrina del ethos, el pico flavio ha
desdoblado la cancin virgiliana de Sileno, reservndole al probo centauro la parte
filosfica la cosmogona que conduca a los hroes educados por l a la sabidura y adjudicndole al bardo itlico la parte mitolgica las seductoras aventuras
de Anfin, Arin y Orfeo, que hunden a los cartagineses de Anbal en la molicie28.
En opinin de Roussel 1991, pp. 108-109, estas enseanzas morales, recopiladas en las
 atribuidas a Hesodo, habran encontrado un eficaz medio de transmisin
en la msica: Son influence morale, de mme que ses pouvoirs mdicaux, a pu sexercer
travers un support musical, conu non comme un ornement mais comme un mode dexpression privilgi, o le rythme aidait la mmorisation des sentences et rehaussait le pouvoir
incantatoire des mots.
26
Mientras que el Eustacio de Macrobio incide en la inadecuacin del canto filosfico
del vate africano al marco festivo del banquete ofrecido por Dido a los Enadas (nonne, si
quis aut inter Phaeacas aut apud Poenos sermones de sapientia erutos conuiualibus fabulis
miscuisset, et gratiam illis coetibus aptam perderet et in se risum plane iustum moueret?, Sat.
VII 1.14), Servio considera la filosofa un tema apropiado en la idea de que el convite precede
a la degradacin moral que supone el enamoramiento de la reina (bene philosophica introducitur cantilena in conuiuio reginae adhuc castae, ad Aen. I 742). Cf. Hardie 1986, p. 64 n. 75.
27
A las razones esgrimidas en el prefacio a las Cuestiones naturales (12-13) podemos
aadir un paso de la Epstola 65 que, por el nfasis puesto en la separacin de los elementos,
resulta bastante cercano a la cosmogona siliana: Ego non quaeram quae sint initia uniuersorum? quis rerum formator? quis omnia in uno mersa et materia inerti conuoluta discreuerit?
Non quaeram quis sit istius artifex mundi? qua ratione tanta magnitudo in legem et ordinem
uenerit? quis sparsa collegerit, confusa distinxerit, in una deformitate iacentibus facies diuiserit? unde lux tanta fundatur? ignis sit, an aliquid igne lucidius? ego ista non quaeram?
ego nesciam unde descenderim? Vetas me caelo interesse, id est iubes me uiuere capite
demisso? (19-20). Debemos estas referencias acerca de la relacin entre filosofa natural y
moral a la erudicin de la profesora Cecilia Criado.
28
As, la msica moralmente benigna del primero se confronta con la msica moralmente
perniciosa del segundo de un modo que reproduce cum grano salis la amplia oposicin en25

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

398

N O TA S E I N F O R M A C I N

Creemos, por lo tanto, que los vv. 453-458 del libro XI de las Pnicas tienen perfecto
sentido en el lugar que ocupan segn el testimonio unnime de los manuscritos.
BIBLIOGRAFA
Abert, H. 1899: Die Lehre vom Ethos in der griechischen Musik, Leipzig (reimpr. Tutzing
1968).
Albrecht, M. von 1964: Silius Italicus. Freiheit und Gebundenheit rmischerEpik, msterdam.
Anderson, W. D. 1966: Ethos and Education in Greek Music: The evidence of Poetry and
Philosophy, Cambridge (Mass.).
Bothe, F. H. (tr.) 1855-1857: Des Cajus Silius Italicus punischer Krieg oder Hannibal, Stuttgart.
Brookes, I. 1994: The Death of Chiron: Ovid, Fasti 5.379-414, The Classical Quarterly
44, pp. 444-450.
Brure, R. T. 1959: Color Ovidianus in Silius Punica 8-17, Classical Philology 54, pp. 228245.
Burck, E. 1984: Silius Italicus. Hannibal in Capua und die Rckeroberung der Stadt durch
die Rmer, Stuttgart.
Comotti, G. 19912: La musica nella cultura greca e romana, Turn.
Delz, J. (ed.) 1987: Sili Italici Punica, Stuttgart.
Duff, J. D. (ed.) 1934: Silius Italicus: Punica, Cambridge (Mass.).
Fantham, E. 1999: Chironis exemplum: On Teachers and Surrogate Fathers in Achilleid and
Silvae, Hermathena 167, pp. 59-70.
Guerrini, L. 1958-1959: Infanzia di Achille e sua educazione presso Chirone, Studi
Miscellanei 1, pp. 43-53.
Gibson, S. 2005: Aristoxenus of Tarentum and the Birth of Musicology, Nueva York.
Hagel, S. 2010: Ancient Greek Music: A New Technical History, Cambridge.
Hardie, P. 1986: Virgils Aeneid: Cosmos and Imperium, Oxford.
Kemp-Lindemann, D. 1975: Darstellungen des Achilleus in griechischer und rmischer Kunst,
Frankfurt.
Landels, J. G. 2001: Music in Ancient Greece and Rome, Londres.
Lasserre, F. (ed.) 1954: Plutarque: De la musique, Lausana.
Leader-Newby, R. E. 2004: Silver and Society in Late Antiquity. Functions and Meanings of
Silver Plate in the Fourth to Seventh Centuries, Aldershot.
Manacorda, M. A. 1971: La paideia di Achille, Roma.
Marks, R. D. 2010: The Song and The Sword: Siliuss Punica and the Crisis of Early Imperial
Epic, en Konstan, D. y Raaflaub, K. A. (eds.), Epic and History, Chichester, pp. 185-211.
tre la poesa mitolgica y ovidiana de Teutras y la poesa histrica y virgiliana de
Silio, sealada por von Albrecht 1964, p. 160, y reformulada recientemente por Marks 2010,
pp. 192-193.
Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

399

N O TA S E I N F O R M A C I N

Mathiesen, T. J. 1984: Harmonia and Ethos in Ancient Greek Music, The Journal of
Musicology 3, pp. 264-279.
Mathiesen, T. J. 1999: Apollos Lyre: Greek Music and Music Theory in Antiquity and the
Middle Ages, Lincoln.
Nelis, D. P. 2005: The Reading of Orpheus: The Orphic Argonautica and the Epic Tradition,
en Paschalis, M. (ed.), Roman and Greek Imperial Epic, Herakleion, pp. 169-192.
Newlands, C. E. 1995: Playing with Time: Ovid and the Fasti, Ithaca.
Perceau, S. 2007: Hros la cithare. La musique de lexcellence chez Homre, en
Malhomme, F. y Wersinger, A. G. (eds.), Mousik et Aret. La mousique et lthique de
lantiquit lge moderne, Pars, pp. 17-38.
Ripoll, F. 2008: Introduction, en Ripoll, F. y Soubiran, J. (eds.), Stace: Achillide, Lovaina,
pp. 1-99.
Roussel, M. 1991: Biographie legendaire dAchille, msterdam.
Ruperti, G. A. (ed.) 1795-1798: Caii Silii Italici Punicorum libri septemdecim, Gotinga.
Schenk, P. 1989: Die Gesnge des Teuthras (Sil. It. 11-288-302 u. 432-482), Rheinisches
Museum 132, pp. 350-368.
Spaltenstein, F. 1990: Commentaire des Punica de Silius Italicus (livres 9 17), Ginebra.
Summers, W. C. 1900: Notes on Silius Italicus, IX-XVII, The Classical Review 14, pp. 305309.
Summers, W. C. (ed.) 1904: Sili Italici Punicorum libri XVII, en J. P. Postgate (ed.), Corpus
Poetarum Latinorum, II, Londres, pp. 210-307.
Veneri, A. 1995: La cetra di Paride: laltra faccia della musica in Omero e nei suoi interpreti
antichi, en Gentili, B. y Perusino, F. (eds.), Mousik. Metrica ritmica e musica greca in
memoria di Giovanni Comotti, Pisa, pp. 111-132.
Volpilhac-Lenthric, J., Martin, M., Miniconi, P. y Devallet, G. (eds.) 1984: Silius Italicus: La
guerre punique. Tome III. Livres IX-XIII, Pars.
West, M. L. 1992: Ancient Greek Music, Oxford.

Fecha de recepcin de la primera versin del artculo: 05/03/2012


Fecha de aceptacin: 06/06/2012
Fecha de recepcin de la versin definitiva: 03/09/2012

Emerita LXXX 2, 2012, pp. 387-399

ISSN 0013-6662

doi: 10.3989/emerita.2012.20.1206

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 401-410
ISSN 0013-6662 doi: 10.3989 /emerita.2012.21.1025

Dioniso y el vino en el Cclope de Eurpides


Dionysus and wine in Euripides Cyclops
Sara Macas Otero
CCHS-CSIC
sara.macias@cchs.csic.es
Resumen: En el drama satrico Cclope, Eurpides trata el episodio mtico de Odiseo en la
tierra de los cclopes. Uno de los principales temas de la obra es la oposicin entre el mundo
civilizado del hroe y el salvajismo del monstruo, oposicin que cobra especial relevancia
en los trminos de la hospitalidad y del banquete. Es en este ltimo punto donde ms nos
centramos porque, no slo el hecho de que el Cclope desconozca el vino brinda a Odiseo la
posibilidad de escapar, sino que tambin es crucial la presencia de Dioniso en la obra como
uno de los motores de la accin a travs de su identificacin con su atributo ms importante,
el vino.
Palabras clave: Eurpides; Cclope; Dioniso; vino; banquete.
Abstract: The plot of Euripides satiric drama Cyclops takes as its base the mythical episode
of Odysseus and the Cyclops. One of the main themes of the play is the confrontation between the civilized world of the hero and the monsters wildness. This confrontation becomes
very important by the hospitality and the symposium. We pay special attention to that latter
point because, besides the fact that the Cyclops is ignorant of wine gives to Odysseus the
possibility of escaping, Dionysus becomes an active character in the satiric drama by his
identification with his most important attribute, the wine.
Key words: Euripides; Cyclops; Dionysus; wine; symposium.

1.

Introduccin

La trama de este drama satrico1 tiene como base el episodio mtico de Odiseo y el
Cclope, que ya aparece en la Odisea2. El tema central es el enfrentamiento entre el
hroe civilizado, Odiseo, que pide hospitalidad al Cclope, y este ser monstruoso y

Algunos comentarios y estudios sobre esta obra que podemos sealar: Duchemin 1945,
Kassel 1955 y 1973, Diggle 1971, Arnott 1972, Ussher 1978, Stoessl 1984, Lpez Frez 1987,
Seaford 1988 y 1991, Rodrguez Adrados 1997, Pechtein y Krumeich 1999, Napolitano 2000,
2003. Hemos seguido la edicin de Murray 1902.
2
Od. IX 105-505. Respecto a los puntos en los que difieren ambas versiones cf. Wetzel
1965; Lpez Frez 1995, pp. 83-85; Katsouris 1997; Lange 2002.
1

402

N O TA S E I N F O R M A C I N

rudo3 que no slo no ofrece su hospitalidad a los extranjeros, sino que los mata y
devora. Dioniso, como personaje, parece no estar presente en la obra, sin embargo, a
travs de su continua identificacin con el vino, su presencia se hace indispensable
en la victoria de Odiseo sobre el Cclope4.
2.

La civilizacin de Odiseo frente a la vida salvaje del Cclope

La obra gira en torno a la fuerte oposicin que se da entre Odiseo, que representa las
costumbres y las leyes de la civilizacin, y el Cclope, que vive completamente al
margen de ellas. Este contraste se hace patente en distintos mbitos:
En primer lugar, podemos sealar que Odiseo se caracteriza por su astucia, pues
gracias a ella consigue idear el plan que le salva de las garras del Cclope. La astucia
del hroe implica inteligencia y don de palabra para poder convencer al monstruo
de que beba el vino y permanezca en la cueva sin alertar a sus semejantes. De estos
atributos carece el Cclope, que, con cierta ingenuidad quiz debida a su falta de
contacto con la civilizacin, en absoluto sospecha de las palabras de Odiseo, y llega
a creer todo lo que el hroe le dice, incluso que se llama Nadie.
Ms llamativa es la oposicin de ambos personajes en relacin a las leyes de hospitalidad. Mientras que Odiseo reclama los derechos que como husped le concedera
cualquier ser civilizado, Polifemo los quebranta no slo no ofrecindole su ayuda,
sino incluso cometiendo un acto de salvajismo extremo: la antropofagia. As Odiseo
se lo reprocha en el v. 299 ss.:





Y es ley para los mortales, si rehsas mis palabras, acoger a los suplicantes devastados
por el mar, darles obsequios de hospitalidad y proveerlos de ropas, y no, atravesando
3
Sin embargo, Eurpides tiende a presentar un Cclope ms refinado que el de Homero,
pues adems de poseer a los stiros como esclavos que se ocupan de servirle y mantener limpia su
cueva, y tener un cierto don de palabra, demuestra un determinado cuidado en la manera de cocinar
sus alimentos, aunque practique el canibalismo, y conoce la leyenda de Ganmedes y lo que estaba
sucediendo en Troya por el amor de Helena.
4
Para un estudio detallado sobre la dualidad entre la ausencia de Dioniso y presencia
de elementos dionisacos en el gnero del drama satrico y su relacin con el origen de este
gnero y de la tragedia ateniense cf. Lmmle 2007.

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

403

N O TA S E I N F O R M A C I N

sus miembros con espetones de asar vacas, saciar tu vientre y tu mandbula (vv. 299303).

Adems tampoco respeta ningn tipo de norma religiosa, ni a ninguno de los


dioses:

  
  
  
  
Cicl.: Yo no hago sacrificios en honor de nadie, excepto mo, y no de los dioses, y
en honor de la ms grande de las divinidades: este estmago. Porque beber y comer
cada da, eso es Zeus para los hombres sensatos, y no preocuparse de nada ms (vv.
334-338).

Como el propio Cclope afirma en este pasaje, su manera de vida es muy bsica
y rudimentaria, cercana a la de los animales, pues su nica preocupacin es comer
cada da. Carece de cualquier norma o creencia que pudiera aproximarlo a la forma
de vida de las comunidades humanas. Esta incivilidad del Cclope aparece ya en los
primeros momentos de la obra; los stiros entran en escena lamentndose con su
canto de su servidumbre a Polifemo y, sobre todo, del hecho de que Dioniso y sus
festejos no estn presentes en esa tierra:




1R HV HVWR %URPLR QL HOHVWUpSLWR GH ORVWtPSDQRVMXQWRDODVIXHQWHVTXHPDQDQ
agua, ni las vigorosas gotas de vino (vv. 63-67).

Poco despus Sileno le explica a Odiseo cmo es la vida en ese lugar:












Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

404

N O TA S E I N F O R M A C I N

OD. Y dnde estn las murallas y las torres de la ciudad?


SI. No hay. Las montaas estn deshabitadas, extranjero.
OD. Y quines poseen esta tierra? Un linaje de fieras?
SI. Cclopes, que tienen cuevas y no casas.
OD. Y a quin obedecen? O es que el poder es democrtico?
SI. Son nmadas, nadie obedece a nadie en nada.
OD. Siembran la espiga de Demter o de qu viven?
SI. De leche, de quesos y de carne de sus ovejas.
OD. Tienen la bebida de Bromio, que fluye de la vid?
SI. En absoluto, por ello habitan un pas sin danzas (vv. 115-124).

Los cclopes, casi como si se tratara de fieras, viven en cuevas, sin ningn tipo
de asociacin entre ellos ni normas que regulen su convivencia. Y su carcter salvaje
queda intensificado porque se dedican exclusivamente a la caza y al pastoreo, carecen del mximo exponente de la civilizacin, la agricultura: no poseen ni los dones
de Demter ni los de Dioniso. El hecho de que no conozcan el vino es el verdadero
motor de la accin, pues Odiseo se aprovecha de ello para poder vengarse y huir.
3.

Identificacin de Dioniso y el vino.

El vino puede producir en quien lo consume efectos positivos o negativos; esta doble
vertiente del poder de Dioniso est presente en el drama. Ya en la primera mencin
expresa del vino en la obra (vv. 63-67 que hemos visto antes), las gotas de esta
EHELGDYLHQHQFDOLILFDGDVFRQHODGMHWLYRTXHVLJQLILFD IUHVFDVOOHQDVGH
vida. Cuando este adjetivo se aplica a lquidos suele referirse bien a las lgrimas o
bien a la sangre5, incidiendo en la frescura y el vigor de esta ltima como elemento
indispensable para la vida. Eurpides con ese adjetivo est adelantando las referencias
a los efectos positivos del vino que Sileno expone posteriormente:




4XHHVWiORFRTXLHQQRVHDOHJUDEHELHQGRFXDQGRHVSRVLEOHDOPLVPRWLHPSROD
danza y el olvido de las desgracias (vv. 168-172).

5
 3DUDHODGMHWLYRDSOLFDGRDODVOiJULPDVFI(Med. 906, 922, Hel. 1189; aplicado
a la sangre aparece p. ej. en S., Trach. 1055 y E., Hec. 127. Cf. Seaford 1988, pp. 113-114.
La identificacin del vino con la sangre de Dioniso puede encontrarse en la lrica: Tim. 780
Hordern.

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

405

N O TA S E I N F O R M A C I N

Una de las principales virtudes de Dioniso es producir la alegra en quienes


consumen vino, pues da lugar a un estado de exaltacin que conduce a una liberacin momentnea gracias al olvido de las desdichas6. Por ello, ya Homero7 llama a
Dioniso alegra de los mortales, Hesodo8OHDSOLFDHOHStWHWRHOPX\
gozoso y en esa misma lnea, Eurpides, en Cyc. 415, llama al vino bebida divina,
alegra de Dioniso. Esta es la versin positiva, la que Odiseo vende al Cclope
para instigarle a que beba, y por ello afirma de Dioniso que es:


(OPiVJUDQGHSDUDORVKRPEUHVSDUDHOJRFHGHODYLGD
As es esta divinidad. No perjudica a ninguno de los mortales (vv. 522, 524).

Sin embargo, los efectos que obtiene el Cclope son precisamente los contrarios,
pues, a pesar de la alegra y el placer iniciales, el vino propicia su desgracia: tras
resultar su mente y su fuerza impedidas, el monstruo queda a merced del hroe que
le deja ciego.
La vertiente positiva del vino va unida a su consumo civilizado, a la mesura y
al saber beber dentro de una serie de normas que rigen el simposio, y, sobre todo, a
rendir homenaje a Dioniso reconociendo su divinidad y agradecindole el don que
entreg a los hombres. Por el contrario, los efectos negativos van ligados al consumo salvaje e indiscriminado. Este es el caso de Polifemo que ha perdido el control
porque no ha sabido beber de una manera civilizada; as lo indican los trminos
\HQHOVLJXLHQWHSDVDMH




Pero que vaya Marn9! Que acte!; que arranque el prpado del Cclope enloquecido, dado que ha bebido de mala manera! (vv. 616-618).
Podemos encontrar tambin en la lrica referencias a este poder del vino como mitigador
de las penas, cf. Ba. 20B; Lyr. Adesp. 926 (e); Pi., Paian, fr. 52d, 25 ss. (= 4 Sandys). El
propio Eurpides en Ba. 278-285 incide en este tema.
7
Il. XIV 325.
8
Hes., Th. 941, Op. 614.
9
Eurpides llama aqu Marn al vino porque, como menciona versos antes (vv.141-143),
fue l quien le entreg el vino. En la Odisea (IX 195-211) ya encontramos este episodio:
Marn, sacerdote de Apolo en smaro, como agradecimiento a Odiseo por haberle dejado con
vida a l y a su familia le regal, entre otras cosas, doce nforas llenas de un excelente vino
6

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

406

N O TA S E I N F O R M A C I N

Puede establecerse una comparacin con el mito de los centauros: estos seres de
carcter fiero y salvaje, semejante al de los cclopes, no estn habituados al vino, por
ello, cuando acuden a la boda de Pirtoo y lo consumen, enloquecen y acaban por
provocar un enfrentamiento del que salen muy mal parados10.
Es ms, podramos considerar que Dioniso, a travs de su identificacin con el
vino, llega a ser un personaje activo en el drama satrico, y que es l quien realmente
vence al Cclope. La identificacin del dios con su atributo ms importante es recurrente a lo largo de la obra. As, en v. 518, cuando Odiseo se proclama ante Polifemo
experimentado en este Baco que te di a beber, denomina al vino con el nombre del
dios, y de la misma manera podemos aadir otro ejemplo que resulta ms llamativo:

Cuando se duerma vencido por Baco (v. 454).

E incluso esa identificacin se hace ms estrecha gracias a ciertos paralelismos


entre las referencias que Sileno hace al rapto de Dioniso por parte de los piratas y
la manera en que Odiseo utiliza el vino11: en el prlogo se cuenta que Hera ha enviado a los piratas tirrenos para raptar y vender al dios en tierras lejanas (vv. 11-12);
Odiseo, nada ms llegar a la lejana tierra del Cclope, pretende obtener comida ofreciendo como moneda de cambio el vino que le regal Marn (v. 139 ss.), y adems
resulta llamativo que cuando el Cclope entra en su cueva y se da cuenta de que all
hay unos extranjeros, lo primero que piensa es que podra tratarse de piratas (vv.
222-223). As, la actitud que Odiseo toma hacia el vino es la misma que los piratas
habran tomado con respecto a Dioniso, y de manera metafrica se podra entender
que el reencuentro de los stiros con su dios se produce cuando Odiseo les ofrece el
vino, y que es el propio Dioniso a travs de su bebida quien consigue liberarlos de
la servidumbre a Polifemo.

puro, mucho ms fuerte que ningn otro. La mayora de las fuentes, entre ellas la Odisea,
considera a Marn como hijo de Evantes, que a su vez es hijo de Dioniso. Sin embargo Eurpides estrecha an ms esta relacin y es la nica fuente que hace a Marn hijo directamente
del propio Dioniso (Cyc. 141-143).
10
Para este relato mtico cf. p. ej. Hes., Scut. 178-190; Apollod., Epit. 1.21; Higin., Fab.
33; Paus. V 10.8; Verg., Aen. VII 304; Ou., Met. XII 210-535.
11
Olson 1988, pp. 502-504.
Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

407

N O TA S E I N F O R M A C I N

4.

El simposio: un banquete salvaje, frente a uno civilizado

En la obra, Eurpides presenta dos escenas de banquete con estructura muy semejante12 pero que contrastan haciendo chocar el mundo salvaje del Cclope con el
civilizado de Odiseo: el primer banquete es llevado a cabo segn las costumbres del
monstruo, sin vino, en soledad y practicando el canibalismo; el segundo es dirigido
por el hroe, aparentemente con las normas propias la civilizacin griega, con el
vino y Dioniso como protagonistas, pero con la verdadera intencin de emborrachar
y dejar indefenso al Cclope. Se trata en realidad de una caricatura grotesca de un
simposio.
Tanto el coro como Odiseo saben cmo se ha de rendir culto a Dioniso, mientras
que el Cclope lo ignora por completo. sta ser el arma que permita al hroe vengar
la muerte de sus compaeros: hace creer al Cclope que lo est aleccionando en el
arte del simposio, cuando en realidad lo est manipulando para que beba en soledad
y no vaya a compartir el vino con sus hermanos, como fue su primer impulso13.
Es el vino, y, por tanto, la presencia de Dioniso lo que marca la diferencia fundamental entre los dos banquetes: Dioniso acta como un dios civilizador a travs del
vino, al mismo nivel que Demter mediante la agricultura14.
5.

La desdicha del Cclope: un castigo de Dioniso

Por otra parte, a pesar de que Dioniso no es un personaje del drama, est presente
en l y sirve como motor de la accin identificado con el vino, como hemos visto.
Es realmente el dios quien castiga al Cclope, pero qu motivos tiene para ello?
Adems de liberar a su squito, habra una razn mucho ms poderosa: los banquetes
del monstruo son totalmente contrarios a las normas de civilizacin, pero tambin
carecen de cualquier tipo de piedad hacia los dioses; Polifemo solo se preocupa de
beber y comer para tener su estmago lleno y se jacta de no rendir culto ni dar ningn

Cf. Hamilton 1979, pp. 289-291, que describe detalladamente cada uno de los paralelos
estructurales entre ambas escenas.
12

13
Lo habitual en el simposio griego es compartir el vino con el resto de compaeros, formar
SDUWHGHOVHWUDWDGHXQDFWRVRFLDOVLQHPEDUJRHO&tFORSHHVGLVXDGLGRSRU2GLVHRGHFRPpartir la bebida con sus congneres, puesto que no le conviene para que su plan pueda tener xito.
Se trata por tanto de una especie de mascarada en la que Odiseo hace creer al monstruo que est
siendo aleccionado correctamente en las normas del simposio, cuando en realidad est quebrando
una de las principales. Sobre este pasaje y la parodia del simposio tico que encierra el Cclope de
Eurpides, cf. Rossi 1971, pp. 12-13, Hamilton 1979, pp. 288-289, Clavo 1998, Napolitano 2000.
14

Cf. E., Ba. 272-287.

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

408

N O TA S E I N F O R M A C I N

tipo de agradecimiento a las divinidades15. Incluso llega a hablar desdeosamente y


con insolencia del soberano de los dioses:


Yo no tiemblo ante el rayo de Zeus, extranjero, ni s por qu Zeus es un dios ms
poderoso que yo (vv. 320-321).

Tambin toma esta actitud irreverente hacia Dioniso, hasta el punto de dudar de
su divinidad:
16






CIC. Quin es Baco?, se le considera un dios?
OD. El ms grande para los hombres para el goce de la vida
CIC. En verdad que yo lo eructo con placer.
OD. As es esta divinidad. No perjudica a ninguno de los mortales.
CIC. Y cmo es que un dios se contenta con tener su morada en un odre?
OD. Donde uno lo coloque, all est cmodo.
CIC. Pero es necesario que los dioses no tengan su cuerpo entre pellejos (vv. 521-527).

Adems de mal iniciado por Odiseo en el simposio, Polifemo se acerca al culto


de Dioniso, a travs del vino, de una manera irrespetuosa y falto de veneracin. El
propio Odiseo llega a exclamar que el Cclope merece el castigo divino por su impiedad y si no lo recibe habra que poner en duda el poder de los dioses:






Cf. et. E., Cyc. 322-335.


Sigo la propuesta de Wieseler, aceptada por Duchemin 1945, Diggle 1984 y Seaford
1988, de considerar que este verso se compone de dos interrogativas y no de una sola. En ese
~OWLPRFDVRGHEHUtDOHHUVH3DUDXQDH[SOLFDFLyQPiVGHWDOODGD
del problema textual cf. Seaford 1988, p. 235.
15
16

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

N O TA S E I N F O R M A C I N

409





Hefesto, soberano del Etna, prendindolo fuego destruye el brillante ojo de este malvado vecino, y t, vstago de la negra Noche, Sueo, con violencia ven a esta fiera odiada
por los dioses. Y tras los honorabilsimos esfuerzos de Troya no matis a Odiseo y
a sus marineros a travs de un hombre que no se preocupa en nada ni de los dioses
ni de los mortales. O, si no, sera necesario considerar al azar una divinidad, y a las
divinidades como inferiores al azar (vv. 599-607).

La actitud insolente, e incluso soez, de Polifemo hacia la divinidad de Dioniso


nos lleva a pensar que en este drama satrico subyace la misma idea que sirve de
motor de la accin en las Bacantes, aunque salvando las distancias que impone la
tipologa de cada gnero. Ni Penteo ni Polifemo rinden culto a Dioniso (aunque en el
caso del primero se debe a su radical oposicin a esa divinidad y en el del segundo
a su carcter salvaje y aislado de la civilizacin) y adems los dos han dudado de
su carcter divino. El desastroso final de Penteo tiene lugar cuando, movido por una
impa curiosidad, pretende espiar los cultos dionisacos de manera ilcita, sin haberse
iniciado en ellos; podra ser comparable al hecho de que la desgracia del Cclope
se debe a que igualmente se asoma al culto de Dioniso sin estar aleccionado o
iniciado en l: bebe vino sin saber cmo debe hacerse, de una forma salvaje. La
verdadera arma utilizada contra Polifemo no es el tizn, sino el vino que le deja indefenso. La ceguera del Cclope es la venganza tanto de Odiseo por haberse comido
aqul a algunos de sus compaeros, como la del propio Dioniso por haber dudado
de su divinidad y no rendirle culto.

BIBLIOGRAFA
Arnott, W. G. 1972: Parody and ambiguity in Euripides Cyclops, en Hanslik, R., Lesky,
A. y Schwabl, H. (eds.), Antidosis. Festschrift fr Walter Kraus, Viena-Colonia-Graz,
pp. 21-30.
Clavo, M. T. 1998: Una parodia del simposio en el Cclope de Eurpides, en Adrados, F. R.
y Martnez Dez, A. (eds.), IX Congreso Espaol de Estudios Clsicos, Madrid 27-30 de
septiembre de 1995, vol. IV: Literatura griega, Madrid, pp. 107-110.
Diggle, J. 1971: Notes on the Cyclops of Euripides, CQ 21 (65), pp. 42-50 (= Euripidea.
Collected Essays, 1994, Oxford, pp. 34-43).
Diggle, J. 1984: Euripides Fabulae, vol. I, 1984, Oxford.
Duchemin, J. 1945: Le Cyclope dEuripide, Pars.
Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

410

N O TA S E I N F O R M A C I N

Hamilton, R. 1979: Euripides Cyclopean Symposium, Phoenix 33, pp. 287-292.


Kassel, R. 1955: Bemerkungen zum Kyklops des Euripides, RhM 98, pp. 279-286 (= Kleine
Schriften, 1991, Berln-Nueva York, pp. 191-198)
Kassel, R. 1973: Zum euripideischen Kyklops, Maia 25, pp. 99-106 (= Kleine Schriften,
1991, Berln-Nueva York, pp. 199-206).
Katsouris, A. G. 1997: Euripides Cyclops and Homers Oddyssey: An Interpretative
Comparison, Prometheus 23, pp. 1-24.
Lmmle, R. 2007: Der eingeschlossene Dritte. Zur Funktion des Dionysos im Satyrspiel,
en Bierl, A., Lmmle, R. y Wesselmann, K. (eds.), Literatur und Religion, vol I, BerlnNueva York, pp. 335-386.
Lange, K. 2002: Euripides und Homer. Untersuchungen zur Homernachwirkung in Elektra,
Iphigenie im Taurerland, Helena, Orestes und Kyklops, Stuttgart.
Lpez Frez, J. A. 1987: El Cclope de Eurpides: Tradicin e innovacin literarias, Minerva
1, pp. 41-59.
Lpez Frez, J. A. 1995: Euripides. Tragedias I, Madrid.
Murray, G. 1902: Euripides Fabulae, vol. I, 1902, Oxford.
Napolitano, M. 2000: Odisseo simposiarca fraudolento e Polifemo simposiasta raggirato nel
Ciclope di Euripide, en Arrighetti, G. (ed.): Letteratura e riflessione sulla letteratura
nella cultura classica (Atti del Convegno Pisa, 7-9 giunio 1999), Pisa, pp. 51-63.
Napolitano, M. 2003: Euripide. Ciclope, Roma
Olson, D. S. 1988: Dionysus and the pirates in Euripides Cyclops, Hermes 116, pp. 502504.
Pechtein, N. y Krumeich, R. 1999: Euripides. Kyklops. en Krumeich, R., Peichtein, N. y
Seidensticker, B. (eds.), Das griechische Satyrspiel, Darmstadt, pp. 431-441
Rodrguez Adrados, F. 1997: Notas crticas a Eurpides, Cclope, en Criscuolo, U. y Maisano,
R. (eds.), Synodia. Studia humanitatis Antonio Garzya septuagenario ab amicis atque discipulis dicata, Npoles, pp. 13-21.
Rossi, L. E. 1971: Il CiclopeGL(XULSLGHFRPHPDQFDWR, Maia 23, pp. 10-38.
Seaford, R. A. S. 1988: Euripides. Cyclops, Oxford.
Seaford, R. A. S. 1991: Il dramma satiresco di Euripide, Dioniso 61, pp. 75-89.
Stoessl, F. 1984: Sprecherverteilung, Handlungsverlauf und Auffhrung des Kyklops von
Euripides, Prometheus 10, pp. 1-18.
Ussher, R. G. 1978: Euripides. Cyclops, Roma.
Wetzel, W. 1965: De Euripidis fabula satyrica quae Cyclops inscribitur cum Homerico comparata exemplo, Wiesbaden.

Fecha de recepcin de la primera versin del artculo: 06/09/2010


Fecha de aceptacin: 02/02/2011
Fecha de recepcin de la versin definitiva: 20/08/2012

Emerita LXXX 2, 2012, pp. 401-410

ISSN 0013-6662

doi: 10.3989/emerita.2012.21.1025

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 411-448. ISSN 0013-6662

Reseas de libros
I. Ediciones y tcnica filolgica
Simonides lyricus. Testimonia und Fragmente. Einleitung, kritische Ausgabe, bersetzung und Kommentar von Orlando Poltera, Schweizerische Beitrge zur
Altertumswissenschaft 35, Basilea, Schwabe, 2008, XII + 664 pp.
De acuerdo con su ttulo, este grueso volumen reagrupa los fragmentos lricos de
Simnides de Ceos, hasta ahora dispersos entre los Poetae Melici Graeci (PMG)
y el Supplementum Lyricis Graecis (SLG) de Page. Como el autor explica en el
prlogo, la reunin y reedicin de los fragmentos lricos de Simnides era un viejo
desideratum. En efecto, la empresa parece especialmente oportuna, pues si haba un
autor fragmentario necesitado de revisin y reedicin era Simnides, y en concreto
los restos de su obra lrica. La vertiente elegaca de su produccin, mucho mejor
conocida desde la publicacin del P. Oxy. 3965 en 1993, ha sido objeto de amplio
estudio en las dos ltimas dcadas, parte de l recogido en el volumen colectivo editado por D. Boedeker y D. Sider, The New Simonides: Contexts of Praise and Desire
(Oxford, 2001). La aparicin de dicho papiro, que vino a coincidir con la monografa
de tema histrico y cronolgico de J. H. Molyneux, Simonides. A Historical Study
(Wauconda 1992), impuls a su vez una renovacin de los estudios simonideos que
ha dado lugar a sendos libros sobre los epigramas atribuidos a nuestro autor (L. Bravi, Gli epigrammi di Simonide e le vie della tradizione, Roma, 2006 y A. Petrovic,
Kommentar zu den simonideischen Versinschriften, Leiden, 2007). En Espaa fue
Carmen Barrign quien, desde su tesis doctoral, se ocup ms de Simnides, y entre
sus proyectos estaba el publicar una edicin completa de este autor, que lamentablemente no pudo llevar a cabo.
Dentro de esta renovada atencin al poeta de Ceos, que se ha revelado una figura
especialmente interesante por su versatilidad, su relacin con la historia de su tiempo, que ahora conocemos un poco mejor, su biografa semilegendaria y la amplia
fama que obtuvo ya en vida, Orlando Poltera public en 1997 una monografa que
atenda a los aspectos lingsticos y estilsticos de los fragmentos de Simnides (Le
langage de Simonide: tude sur la tradition potique et son renouvellement, Berna,
Peter Lang, 1997)
La presente edicin es consecuencia lgica y, a la vez, preludio de aquel estudio
lingstico. Como bien explicaba entonces Poltera, y por nuestra experiencia con

412

RESEAS DE LIBROS

otros lricos fragmentarios podemos creer plenamente sus palabras, era imposible
abordar un estudio lingstico sin una amplia labor textual previa referida a los textos
lricos, dispersos en diversas colecciones y editados con numerosas divergencias textuales en las distintas ediciones. Por el contrario, los fragmentos elegacos, reeditados
en su totalidad en la segunda edicin de los Iambi et elegi Graeci de West (19922)
y luego en las reediciones de Gentili-Prato (20022) y Adrados (20104), eran ajenos
a este problema. Siendo la culminacin de aquella labor previa, a su vez la presente
edicin se beneficia de la experiencia del autor sobre estos textos y del profundo
estudio lingstico llevado a cabo antes, lo que halla reflejo tanto en el texto como,
muy especialmente, en el comentario.
Una breve introduccin justifica la obra, explica cmo ha sido organizada y aade
una serie de generalidades sobre el poeta, su contexto histrico, su poesa, lengua
y estilo. Lo ms valioso reside, probablemente, en las pginas sobre la transmisin
del texto de Simnides en las distintas pocas, constituyendo una buena aportacin
al tema de la transmisin de la lrica, en el que todava queda bastante por hacer. Se
aade una lista de fragmentos annimos atribuidos en ocasiones a Simnides pero
excluidos de la edicin, y un til conspectus metrorum.
Los testimonios (pp. 27-90), que alcanzan el nmero de ciento diez, ms del
doble de los recogidos por Campbell, estn organizados segn su contenido, indicado por numerosos epgrafes relativos a las caractersticas de la obra de Simnides,
su valoracin posterior, noticias sobre contenido, datos sobre la vida del poeta, las
numerosas noticias y ancdotas de tipo sapiencial (dichos, paignia, etc.), as como
sobre sus supuestas invenciones y las cualidades que la tradicin posterior le atribuy. Todos estos testimonios estn traducidos.
Pasando a los fragmentos, PMG (1962) presentaba ciento cuarenta y ocho fragmentos, entre los que se incluyen algunos testimonios sobre las obras y sus contenidos. En SLG (1974) Page recogi como adespota una serie de papiros, dando como
probable autor de dos de ellos (P. Oxy. 2623, 2624) a Simnides. La autora simonidea de P. Oxy. 2623 fue confirmada en 1981 por Lobel. Ambos papiros aparecen ya
recogidos en la edicin de Campbell (n.os 519A y 519B), que adems aade cuarenta
y siete Testimonia vitae atque artis antes de los fragmentos. Frente a Campbell, Poltera acepta solo la autora del primer papiro (= F 34-99 Poltera), pero no la de P. Oxy.
2624, no demostrada. Sin descartar por completo la autora simonidea, este papiro
2624 figura recogido en la p. 20 como uno de los fragmentos de adscripcin dudosa.
El nmero de fragmentos de Simnides se ve aumentado en esta nueva edicin
hasta 357 incluyendo dubia et spuria (F 341-357), aunque este nmero tan alto se
debe al hecho de numerar individualmente casi cada uno de los ciento sesenta y seis
fragmentos del P. Oxy. 2430 (= PMG 519), repartidos por toda la edicin pero en
especial a partir del F 100, y de aadir los sesenta y ocho fragmentos del P. Oxy.
2623 (= SLG 319-386), editados a partir del F 34. Si a ello sumamos el hecho de que
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

413

Poltera reordena en ocasiones los fragmentos papirceos, resulta comprensible que


haya optado por adoptar su propia numeracin, renunciando sensatamente a mantener la de PMG. Algunas alteraciones de orden o ubicacin, son por ejemplo: P. Oxy.
2431.frs. 1a-b con el fr. 2 insertado entre ellos (PMG 511.1-2 = F 7a), del epinicio
a los hijos de Eacio, donde tambin se han mejorado lecturas; PMG 519.97-98 han
sido unidos en un nico fragmento (F 185); el verso PMG 524 ha sido insertado en el
P. Oxy. IU ) FRUULJLHQGRRYSRUYVHJ~QFRQMHWXUD
de Garrod defendida por Poltera en su libro anterior (p. 413 s.); Poltera considera
simonideo (= F 250) un verso transmitido por Prisciano entre otros de Alcmn, tradicionalmente recogido entre los fragmentos de este poeta (14c PMG, PMGF). De
otro lado, dos fragmentos de PMG han pasado a formar parte de las elegas (PMG
534 = 3 West2 y PMG 635 = 1 West2).
Varios fragmentos recogidos en PMG han sido mantenidos en la edicin de Poltera como dubia o spuria. Los dubia consisten en siete fragmentos para cuya autora
se duda entre Simnides y Semnides de Amorgos. Se trata de un verso transmitido
por Estobeo (PMG 525 = E341) y seis glosas, cuatro de ellas recogidas por Page
como simonideas (PMG 610 = E342, 620 = E343, 624 = E346, 652 = E347) y dos
recogidas por West y otros editores entre los fragmentos de Semnides (E344, E345
= 33-34 West = 42 y 37 Adrados). En cuanto a los espurios, se trata en todos los casos
de citas de tradicin indirecta que, o bien deben permanecer annimas (PMG 526.3-4
= F EE348 y PMG 527 = EE349, ambas en Tefilo de Antioqua) o que se pueden
atribuir con mucha verosimilitud a otros autores (PMG 513 = EE350 a Pndaro, PMG
539 = EE351 al historiador Semo de Delos, PMG 540 = EE352 al gramtico Seleuco,
PMG 563 = EE353 probablemente a Baqulides, PMG 596 = EE354 a Eumelo, etc.).
Cada fragmento aparece acompaado de una abundante informacin: esquema
mtrico, texto griego, aparato de fuentes, aparato de loci similes y aparato crtico,
seguido de traduccin alemana. Informacin que a su vez es explicada y ampliada
en el comentario. En cuanto al texto, Poltera es mucho ms decidido y menos austero que Page a la hora de incluir restituciones. Vase, a modo de ejemplo, el F 4 =
519fr.79 Page. Pero con toda la actualizacin y mejora que supone la edicin de los
fragmentos, quiz la contribucin mayor de la obra que reseamos reside en el amplsimo comentario (pp. 269-590), que recoge prcticamente toda la informacin de
que disponemos para estos textos difciles, recogiendo toda la bibliografa anterior e
incluyendo una considerable contribucin personal de Poltera en cuanto a propuestas
de localizacin de fragmentos y de interpretacin del contenido.
En fragmentos largos como el dirigido a Escopas, que transmite Platn (F 270), o
el lamento de Dnae (F 271) podemos apreciar la estructura del comentario y hacernos idea de la amplitud y complejidad a que puede llegar. Comprende en primer lugar
la bibliografa especfica sobre el fragmento, ms una serie de apartados numerados
que, segn los fragmentos, pueden versar sobre: datos relativos a su transmisin, conEmerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

414

RESEAS DE LIBROS

tenido, estructura, gnero potico o tipo de obra a que pertenece, rasgos estilsticos
generales y forma mtrica, incluyendo anlisis y comentario mtrico verso a verso.
Tras ellos viene el comentario detallado verso a verso, sobre cuestiones lingsticas,
textuales, estilsticas, detalles de contenido, etc.
El libro se completa con una exhaustiva bibliografa, unas concordancias con
PMG/SLG y con los Testimonia de Campbell, y unos cuidados ndices de palabras
griegas y de fuentes (pp. 591-664).
Aunque puntualmente pueda discreparse en algunas lecturas o interpretaciones, es
claro que esta obra ha pasado ya a ser la edicin de referencia, y la obra imprescindible de consulta para todo lo relativo al poeta de Ceos y a la parte lrica de su obra.
HELENA RODRGUEZ SOMOLINOS
CSIC

Pagano, V., LAndromeda di Euripide, Alessandria-Miln, Edizioni delli Orso, 2010,


270 pp.
El libro consiste en una edicin bilinge con comentario de los fragmentos euripideos que se han adscrito a la tragedia Andrmeda, completada con el estudio de otra
serie de temas relacionados con ella, como su transmisin, el contexto histrico en el
que fue compuesta o la influencia de este mito en la iconografa griega. El resultado
es un libro prctico a la vez que completo, puesto que presenta una muy buena edicin griega de los textos1 con su traduccin italiana paralela, seguida de un excelente
comentario fragmento a fragmento que entra en distintas cuestiones segn convenga
en cada uno de ellos: mtrica, transmisin, problemas textuales, interpretaciones
lingsticas y contextualizacin.
El autor ha organizado el contenido del libro en seis captulos y dos apndices, precedido todo ello de una breve presentacin de G. Zanetto. As, en primer
lugar encontramos una introduccin (pp. 1-24) que expone el mito de Andrmeda,
las primeras menciones de l y sus fuentes, tanto griegas como latinas, aunque
insistiendo en las versiones de Sfocles y Eurpides. Seala tambin las variantes
y las similitudes que hay entre las diferentes versiones tomando como punto de
comparacin la Biblioteca de Apolodoro. Para terminar (pp. 18-24) se centra en el
texto de Eurpides y comenta brevemente las fuentes que nos han transmitido los
fragmentos de esta tragedia, pues la mayora son de transmisin indirecta, sealanComo el propio autor seala, hay que destacar que la edicin procede en su mayor parte
de la de Kannicht e, incluso, el aparato crtico que presenta es una simplificacin del de aquel.
1

Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

415

do la importancia de las Tesmoforias de Aristfanes, seguida por los Catasterismos


de Eratstenes.
El segundo captulo (pp. 25-39) trata sobre la tradicin y la fortuna de la Andrmeda, rastreando la presencia de esta tragedia en la literatura greco-latina desde los
primeros testimonios, como son las Tesmoforias o las Ranas de Aristfanes, hasta
Procopio de Gaza o Mximo Confesor. Termina el captulo con una breve presentacin del contexto histrico en que Eurpides produjo la tragedia.
A continuacin est el captulo dedicado a la bibliografa (pp. 41-56), organizada
en tres apartados: las ediciones crticas de la Andrmeda, los lxicos y manuales
utilizados, y las monografas y artculos. Es una bibliografa completa y actualizada.
El cuarto apartado (pp. 57-100) consiste en la edicin y traduccin de los fragmentos. Sigue la edicin de Kannicht y, en los atribuidos sin duda a la tragedia,
tambin su numeracin, aunque no la ordenacin.
El quinto apartado es el ms extenso (pp. 101-220), pues se trata del completo
comentario de cada uno de los fragmentos.
El ltimo captulo est dedicado a la propuesta de reconstruccin de la tragedia que el autor defiende y que motiva su diferente ordenacin de los fragmentos
(pp. 221-238).
Cierran el libro dos apndices: en el primero (pp. 239-258) el autor comenta
los testimonios del arte tico en los que la saga de Andrmeda fue representada.
El segundo (pp. 259-266) recoge algunas de las imgenes ms importantes que ha
comentado en el apndice anterior.
Para terminar, aade un pequeo ndice de nombres y trminos importantes en
italiano y en griego. Quiz podramos echar de menos un ndice de pasajes citados,
pues por ejemplo encontramos las pginas donde Aristfanes es citado, pero no se
indica qu pasaje en concreto lo es en cada una de ellas.
Por otra parte, considero que nicamente podramos encontrar dos aspectos mejorables en cuanto a la ordenacin del libro: parece ms coherente colocar el captulo
dedicado a la propuesta de reconstruccin justo antes de la edicin y traduccin de
los textos, puesto que permitira al lector comprender la ordenacin que se presenta
de ellos. Por otra parte, respecto a la numeracin, quiz hubiera sido preferible, por
cuestin de claridad y comodidad para el lector, sobre todo a la hora de manejar el
comentario, haber dado a los fragmentos una numeracin propia, tal y como se ha
hecho con los espurios y dudosos, manteniendo entre parntesis la de Kannicht y
Jouan-Van Looy. Y, en ese caso, podra haberse aadido un cuadro de correspondencias que permitira hacerse una idea global, de un solo vistazo, de las variaciones
que el autor ha introducido en la ordenacin y reconstruccin de la tragedia respecto
a las ediciones anteriores.
En definitiva, se trata de un buen libro que permite una amplia y completa visin
de la Andrmeda de Eurpides, y que a su vez es innovador puesto que propone una
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

416

RESEAS DE LIBROS

nueva ordenacin de los fragmentos y comenta algunos puntos de estos que hasta el
momento no haban sido suficientemente atendidos.
SARA MACAS
CSIC

, .
. , Atenas, , 2010, xxvi +
194* + 315 pp.
Los estudios sobre msica griega antigua, as como, en general, sobre la transmisin
y recepcin de la matemtica griega en la erudicin bizantina estn de enhorabuena.
QRVSUHVHQWDXQWH[WRQHFHVDULRSDUDFRPSOHWDUXQDODJXQDHQHOUHpertorio de la teora musical griega que ha llegado hasta nosotros, dado que del texto
de Dionisio no disponamos ms que de la edicin, incompleta y basada en cinco manuscritos de los veintitrs que lo contienen, de F. Bellermann, su venerable 
. Anonymi scriptio De musica. Bacchii Senioris Introductio artis musicae, Berln, 1841.
Bellermann atribuy este opsculo a Baquio, terico tardoantiguo de tono escolstico
conocido slo por su . Salvo los autores ms estudiados, como Aristxeno
o Arstides Quintiliano, la teora musical griega a menudo inseparable de la pura
matemtica adolece, por lo general, de ediciones recientes que conozcan todos los
codices musici, catalogados por Th. J. Mathiesen en el Rpertoire International des
Sources Musicales (Mnich, 1985). Slo recientemente se ha incorporado la edicin
del  de Filodemo a cargo de D. Delattre (2007); otros esperan desde la
edicin del siglo XIX de Jan (Musici Scriptores Graeci, de 1895).
El tratado de Dionisio es sintomtico de tales carencias en la edicin de estos
textos, a menudo poco accesibles por su especializacin. La consecuencia es trabajar con ediciones que ignoran nuevos manuscritos, o bien el olvido de la crtica
especializada. Concretamente, sobre Dionisio hay poca o ninguna atencin en los
estudios que ha producido una filologa ltimamente muy interesada tanto en aspectos puramente tcnicos (son imprescindibles los estudios recientes de S. Hagel, A.
Barker y D. Creese en el dominio en que se desenvuelve Dionisio), como literarios
RKLVWRULRJUiILFRV(QOHQJXDJULHJDH[LVWHHOHVWXGLRGHFRQMXQWRGH
    , Atenas, 1997).
Pues no por tarda esta  de Dionisio es menos valiosa, dado que est
por hacer un estudio de las fuentes musicales griegas slo conocidas indirectamente
por los bizantinos. De ah la relevancia de la edicin de Terzis, que vuelve a atribuir
este escrito a Dionisio, tratando minuciosamente los indicios que lo sitan tempoEmerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

417

ralmente (s. X) y ofrecindonos un texto rico en material matemtico y musical.


La  deriva, en ltima instancia, de la epistme euclidiana y de poca
altoimperial, al tiempo que ofrece interesantes paralelos de loci bien conocidos pero
a menudo extraordinariamente complejos .
Tras un prlogo (pp. xi-xii) y una introduccin general (pp. xiii-xxv), donde se
adelanta brevemente el tipo de obra terica ante la que estamos (esto es, el tipo de especulacin de los kanoniko bien representados por el Ps.Euclides, Ten o PtolemaiGH HOYROXPHQVHDUWLFXODHQWUHVJUDQGHVFDStWXORV\
/RV SS  VHDEUHQFRQODVHFFLyQ
   TXH LQWURGXFH ORV DVSHFWRV SULQFLSDOHV
de la transmisin del texto, as como los datos que permiten la atribucin de este
RS~VFXORD'LRQLVLR\VXGDWDFLyQVHDSR\DHQXQDPD\RUGLVSRQLELOLGDGGH
copias respecto a Bellermann, describiendo aqu las secciones pertinentes de los dos
mss. ms antiguos e independientes, V (Venet. Marc. gr. app.cl.VI/10) y N (Neap. gr.
262), respectivamente de los siglos XIII y XIV, el primero de ellos desconocido para
%HOOHUPDQQDSRUWDPiVGDWRVFRGLFROyJLFRVDODVQRWDVGH0DWKLHVHQHQHOUHpertorio citado, que dan razones de tipo externo para la distincin entre los textos de
Dionisio y Baquio (uso de guiones y cruces, distincin diferente de ttulos respecto a
%HOOHUPDQQFIS (QODVHFFLyQVLJXLHQWHVHH[DPLQDHOHSLJUDPDWUDQVPLWLGR
junto al texto, argumento central para el editor en su atribucin, dado que el poema
menciona los dos autores y observa en su mtrica el tipo de dodecaslabos bizantiQRVTXHGLVWLJXLHUD0DDVHVWRGDMXQWRDODPHQFLyQGHXQHPSHUDGRU&RQVWDQWLQRXQDUFRWHPSRUDOGHVGHHOVLJOR9,,KDVWDHO;,,ORLGHQWLILFDFRQHO
Porfirogeneta (s. X), coherentemente con el hecho de que la musicologa anticuaria
bizantina comienza realmente con su reinado. De este modo, confirma la datacin
que ya A. Cameron adelantara en 1984 (Phoenix 38, pp.256-260). A continuacin, los
FRQWH[WXDOL]DQDGHFXDGDPHQWHHOWUDWDGRHQODWHRUtDPXVLFDOKHOpQLFD
en relacin con Ps.Euclides y autores fragmentarios como Adrasto, Trasilo y Panecio,
GHORVTXHVHJ~Q'LRQLVLRQRGHSHQGHVXIXHQWHGHEHGHVHUXQWH[WRWDUGtR
QRIUDJPHQWDULRSHUGLGR SS  HVODH[SUHVLyQGH'LRQLVLRFI /D~OWLPDVHFFLyQ  UHYLVDORVYHLQWLWUpV
manuscritos del texto (adems de la versin del mismo que transmite el bizantino
Brienio), con una detenida descripcin y recuento de uariae lectiones, recogidas
~WLOPHQWH HQ IRUPD GH  R GLDJUDPDV DO ILQDO GHO YROXPHQ /D FRODFLyQ

VHJ~QDILUPDHOHGLWRUHQS[[ FRPpleta, naturalmente, las lagunas de la edicin de Bellermann. En cuanto al stemma
S HVVLJQLILFDWLYRTXHODVILOLDFLRQHVHVWDEOHFLGDVSRUYDUtDQUHVSHFWR
a otros stemmata que contienen algunos de estos cdices, como el de Dring para su
edicin de los ptolemaicos (Gotemburgo, 1930): por ejemplo, la relacin
entre Vat. Barb. gr. 265 y Vat. gr. 221 est clara, pero no as la de Neap. gr. 262 y su
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

418

RESEAS DE LIBROS

apgrafo Vat. Urb. gr. 77, lo que dibuja un complicado panorama en la transmisin
de los codices musici, que, como ya advirti Mathiesen en un trabajo de 1990 (Ars
&ULWLFDHW)DWD/LEHOORUXP7KH6LJQLILFDQFHRI&RGLFRORJ\WR7H[W&ULWLFDO7KHRU\
en A. Barbera [ed.], Music Theory and Its Sources. Antiquity and Middle Ages, Indiana, pp. 19-37), muy a menudo son copiados en bloque, con el mismo orden interno,
con lo que sus relaciones se establecen, tambin, a varios niveles.
$OWH[WR\WUDGXFFLyQ SS VLJXHHO~OWLPRFDStWXOR
FRQGRVVHFFLRQHV SS FRQULFDVDQRWDFLRQHV
WH[WXDOHV \   SS   FRQ FRPHQWDULRV DO FRQWHQLdo, prcticamente a cada palabra o sintagma. El tratado en s est organizado a la
manera de la  pseudoeclidiana, con una introduccin seguida de
ocho proposiciones matemticas, de estilo sencillo, pero con una notable aportacin
de una discusin sobre los criterios de conocimiento, que va ms all de un Ten
o un Trasilo, y que recuerda los pasajes de Ptolemaide que transmite Porfirio. Con
diferencia, es la parte ms atractiva y original del opsculo, con interesantes ecos
de la tratadstica antigua no siempre sealados: por ejemplo, las insuficiencias de
OD  FXDQGR VXPD HUURUHV LPSHUFHSWLEOHV XQ locus communis de la teora
musical y las matemticas, cf. Ptol., Harm. I 1 y Alm. IX 2). Pero el manejo de las
IXHQWHVSRUHVH[FHOHQWHFRPRTXHGDGHPDQLILHVWRHQHODSDUDWRGHQRWDV
(OYROXPHQVHFLHUUDFRQXQRV SS TXHUHFRJHQHQWUHLQWD\
seis esquemas prcticamente todo el material desplegado en los captulos precedentes, y con una bibliografa e ndices (uerborum, nominum antiquorum, locorum). En
suma, un texto necesario en una edicin solvente, que hasta ahora estaba ausente en
la discusin y anlisis de la tratadstica musicolgica antigua, y que viene a completar la doctrina matemtico-musical helena, casi toda ella fragmentaria.
PEDRO REDONDO REYES
Universidad de Murcia

II.

Lingstica

Denizot, Camille, Donner des ordres en grec ancien: tude linguistique des formes
de linjonction. Cahiers de lERIAC 3 Fonctionnements linguistiques,
Mont-Saint-Aignan, Presses des Universits de Rouen et du Havre, 2011, 571pp.
El ttulo del libro define con sencillez y claridad su contenido: el estudio lingstico
de todos los procedimientos de expresin de las rdenes en griego antiguo. Camille
Denizot ha reelaborado su tesis doctoral (Universidad de Rouen, 2008) y dirige esta
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

419

obra no solo a los especialistas en lingstica griega, sino a los helenistas en general y a los estudiosos de la lingstica general. Aunque es difcil conjugar intereses
diferentes, el libro de Denizot tiene la virtualidad de permitir diferentes niveles
de lectura: la exposicin del marco terico y el anlisis lingstico de los datos se
presenta de forma clara, muy bien estructurada, con una terminologa rigurosa pero
accesible, con referencias frecuentes a otras lenguas que enriquecen el contenido y
permiten la comparacin y, por supuesto, con el comentario de numerosos pasajes de
textos griegos que, adems, se presentan traducidos al francs para facilitar su lectura, de manera que el acceso al libro puede hacerse, en efecto, desde muy diversas
perspectivas e intereses.
En el captulo I Denizot expone su marco terico y punto de partida: el anlisis
de las rdenes no ha de hacerse solo desde un punto de vista morfosintctico, sino
esencialmente pragmtico y, en este sentido, su estudio se inscribe en una teora de los
actos de habla (J. L. Austin, J. R. Searle). Los enunciados en los que se dan rdenes o
prohibiciones se entienden como actos de habla ilocutivos directivos. Para marcar la
diferencia de rdenes y prohibiciones con respecto a otros tipos de actos directivos es
inevitable la referencia a R. Risselada (msterdam, 1993): a los dos criterios conocidos, el grado de constriccin de locutor sobre el destinatario (para distinguir los actos
directivos obligatorios de los opcionales, p. ej. orden vs. proposicin) y el mayor o
menor beneficio del destinatario en la accin que se le solicita (para distinguir la orden
del consejo o la sugerencia, p. ej.), Denizot aade un tercer eje, el grado de inters del
locutor en el que se supone una cierta autoridad sobre su interlocutor por la voluntad de este en el cumplimiento de lo ordenado. Esta tipologa de los actos directivos
se refleja (en lugar de en un continuum) en un esquema triangular en el que, en efecto,
se aslan las ordenes y prohibiciones, si bien no se logra diferenciar tan claramente
entre s otros actos de habla directivos como instrucciones, consejos, proposiciones o
sugerencias (p. 24). Dado que el estudio de las rdenes se hace desde un punto de vista
pragmtico, Denizot asume que las rdenes no siempre se dan por medio del verbo,
sino que hay una gran diversidad de medios, algunos de los cuales, como el orden de
palabras, la puntuacin o la entonacin no sirven en el caso del griego antiguo. Estos
presupuestos condicionan la estructura del libro: el eje del estudio es morfosintctico,
pero no solo se estudia el modo verbal. El corpus empleado se define como coheUHQWH\YDULDGR S FRPSUHQGHYHUVR +RPHUR\+HVtRGR(VTXLOR\$ULVWyIDQHV 
y prosa literaria (Herdoto, Lisias, los dilogos del primer perodo de Platn), obras
tcnicas (algunos tratados del Corpus hipocrtico) y una representacin epigrfica (la
ley de Gortina y los decretos atenienses del 400 al 350 a. C.). Naturalmente podra
objetarse la ausencia de algunos otros autores, pero el conjunto de formas analizadas
es suficientemente importante como para no restar validez al estudio.
En la primera parte (cap. II-III) se estudian las caractersticas de las rdenes y
prohibiciones, comenzando por las particularidades morfolgicas y sintcticas. En
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

420

RESEAS DE LIBROS

este sentido, Denizot pone acertadamente de manifiesto que este tipo de enunciados
se caracteriza en griego antiguo por presentar ciertas tendencias generales, coincidentes con los actos directivos en los que se insertan, como su carcter dbilmente
marcado (as, en el caso de la marca de persona, sobre todo en el imperativo y el
LQILQLWLYR \HOHPSOHRGHGHWHUPLQDGDVSDUWtFXODV HQ+RPHUR RGHOD
QHJDFLyQTXHVLQHPEDUJRQRFRQVWLWX\HQPDUFDVH[FOXVLYDV\GLIHUHQFLDGRUDV
(enunciados no directivos pueden llevar las mismas partculas y negacin; la mayor
parte de los enunciados directivos no presentan ninguna de estas marcas). Otro rasgo
que suele emplearse para caracterizar las rdenes es su incompatibilidad con la subordinacin. A este respecto Denizot dedica algunas pginas muy sugerentes a estudiar
los casos que las gramticas presentan para explicar la presencia de imperativos en
oraciones subordinadas: la autora limita a menos de una veintena los autnticos casos
GHHVWHWLSR\HQSDUWLFXODUDODH[SUHVLyQILMD SVV (QFXDOquier caso, ninguno de estos rasgos morfosintcticos diferencia especficamente las
rdenes y prohibiciones, por lo que Denizot aborda otro criterio, compartido tambin
por todos los actos directivos y que tiene consecuencias lingsticas: la presencia del
destinatario. En este sentido, uno de los aspectos ms interesantes de la obra es la
propuesta de diferenciar tres dominios: la lgica, la enunciacin y la sintaxis, que se
corresponden con el interlocutor, el agente del proceso requerido por el acto directivo
y el sujeto sintctico. En la mayor parte de los enunciados directivos se superponen,
pero no siempre es as: se presentan algunos ejemplos en los que hay que distinguir
la persona morfolgica del verbo del destinatario real del acto directivo (p. 169 ss.),
a veces el destinatario no coincide con el sujeto sintctico, etc., de modo que, tomando como referencia a S. C. Dik (1997), la autora propone que en griego antiguo
el destinatario es un constituyente extra-proposicional, comparable al apstrofe en
vocativo y no un sujeto sintctico. Los rasgos distintivos de la expresin directa del
enunciado directivo en griego antiguo se situaran, en fin, en el plano enunciativo (la
relacin entre el locutor y el interlocutor es una situacin de co-enunciacin) y no
en el plano morfo-sintctico.
La segunda parte del libro (cap. IV-VIII) se centra en las formas verbales tpicas
de las rdenes directas, es decir, el imperativo, el subjuntivo y el infinitivo, de los
que se estudian las particularidades morfolgicas, semnticas y pragmticas. En el
caso del imperativo, Denizot asume la idea (Y. Desportes, 2006; A. Lemarchal,
2006) de que no es un modo, como el subjuntivo o el optativo, dado que el hablante
no adopta ningn punto de vista de verdad sobre el contenido proposicional de su
enunciado, sino que su empleo se sita en el nivel de la enunciacin: por su significado, es la forma prototpica de la orden (aunque puede expresar todos los actos
GLUHFWLYRV DOJXQRVLPSHUDWLYRVVHKDQOH[LFDOL]DGRHQSDUWtFXODV  H
LQYHUVDPHQWH IRUPDV QR YHUEDOHV VH KDQ FDUDFWHUL]DGR FRPR LPSHUDWLYRV 
WLHQHDILQLGDGHVFRQODLQWHUMHFFLyQ\ODH[FODPDFLyQHWF1RVHGHMDGHODGR
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

421

la espinosa cuestin del empleo de los diferentes temas verbales del imperativo
(p. 217 ss.) y se presentan unas tablas reveladoras del uso de cada uno de ellos: la
escasa frecuencia de los temas de perfecto y futuro se justifica por diferentes razones
(verbos documentados solo en perfecto, formas mtricamente cmodas en futuro,
valor marcado aspectual o temporal); en la discusin sobre la diferencia entre el
tema de presente y el aoristo (p. 219 ss.), la autora evita la polmica, opta por dar
las referencias bibliogrficas de las principales teoras y asume la que, a su juicio,
explica mejor sus datos (A. Culioli, 2000): sera una eleccin del hablante basada en
la distincin entre proceso continuo, expresada por el tema de presente, y proceso
discontinuo, propio del tema de aoristo. Evidentemente estas explicaciones no sern
aceptadas por quienes partan de otros presupuestos, de modo que, en este punto en
particular, cobra importancia la posibilidad de disponer de los datos y los ejemplos
para su discusin. Adems del estudio de las caractersticas del subjuntivo y del
infinitivo (pocas lenguas le dan tanta productividad en la expresin de las rdenes
como el griego antiguo: p. ej., en el corpus hay ms infinitivos que subjuntivos directivos), uno de los aspectos ms interesantes de la obra de Denizot es precisamente
la comparacin de estos dos modos con el imperativo. Se pone de manifiesto que
mientras el imperativo es poco especfico en lo que respecta a las marcas de personas
y el subjuntivo, en cambio, expresa regularmente esas marcas, el infinitivo expresa
la relacin entre locutor e interlocutor mediante la sintaxis y no la morfologa. Es la
funcin eminentemente enunciativa del imperativo, que prima la interaccin entre el
locutor y el interlocutor, lo que diferencia al imperativo del subjuntivo, modalmente
marcado, y del infinitivo, que pone la relacin de interlocucin en segundo plano y
se centra en la expresin del proceso.
En la tercera parte (cap. IX-X) se estudian las formas indirectas de expresar las
rdenes (necesitan de un contexto para ser interpretadas como tales). Los enunciados
directivos pueden, en efecto, presentarse bajo la forma de las tres modalidades lJLFDVGHyQWLFD  VLQPDUFDGHODYROXQWDG\ODDXWRULGDGGHOORFXWRU
por lo que se emplean para expresar actos directivos corteses (en este contexto quiz
podra haberse mencionado el trabajo de E. Ruiz Yamuza Tres verbos que significan
deber en griego antiguo, 2008); altica, esto es, que expresan una posibilidad
RSWDWLYR SRWHQFLDO DGMHWLYR YHUEDO HQ   HSLVWpPLFD OD PRGDOLGDG PiV DOHMDGD
del acto directivo (el presente de indicativo, muy raro en griego en uso directivo,
y el futuro de indicativo). En este captulo uno de los apartados de ms inters es
precisamente el dedicado al futuro, de difcil adscripcin por su estatus entre tiempo
y modo (p. 423). Denizot explica sus empleos directivos sin hacer intervenir valores
modales; en particular, aborda la situacin de los poemas homricos (p. 433), por
cuanto tradicionalmente se considera que no conocen un uso directivo del futuro,
VLQR TXH VRQ VXEMXQWLYRV GH YRFDO EUHYH R IRUPDV FRPR    VH
analizan como imperativos de aoristo. Denizot argumenta con numerosos ejemplos
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

422

RESEAS DE LIBROS

que podra tratarse de futuros comparables a otros de poca posthomrica: aserciones


que describen procesos que se sitan en un momento posterior, pero que en el nivel
locutivo, en un contexto determinado, se cargan indirectamente de un valor directivo,
casi siempre para dar rdenes. En la expresin indirecta de los enunciados directivos
hay una gradacin, por lo que se dedica un captulo (X) a estudiar esta cuestin.
Aqu se trata el optativo solo (p. 445 ss.) o la interrogacin y su combinacin con la
QHJDFLyQFRPRHQ SVV /DH[SUHVLyQGH
los actos directivos se describe, en fin, como un continuum en el que el imperativo
es la forma prototpica, a continuacin el subjuntivo, luego el infinitivo, despus
formas de modalidad dentica, ms lejos an formas alticas y epistmicas y, por
ltimo, mecanismos indirectos como las formas interrogativas e interro-negativas.
En este captulo planea inevitablemente la cuestin de la cortesa: Denizot concluye,
a partir del comentario de numerosos ejemplos, que el carcter indirecto de un acto
de habla directivo no implica necesariamente esta relacin de cortesa y, en concreto, las formas indirectas de las rdenes apenas se limitaran en griego al empleo
de determinados adverbios, partculas, negacin (II.1.2) y al futuro en enunciados
asertivos, interrogativos e interro-negativos. Para dar una orden cortsmente habra
que reformularla en otro acto de habla (consejo, peticin, etc.).
A lo largo de todo el libro, uno de los objetivos centrales de la autora es identificar y caracterizar de forma especfica las rdenes y prohibiciones dentro del conjunto
de los actos directivos. No siempre, sin embargo, se logra esa delimitacin. Por eso
creo que resulta acertado y eficaz el captulo XI, que representa no solo una recapitulacin de las conclusiones, sino tambin una puntualizacin, necesaria a mi juicio,
sobre esos lmites y la caracterizacin morfosintctica, pero sobre todo, pragmtica,
de las rdenes dentro del conjunto de los actos directivos.
El libro concluye con diversos ndices (pasajes citados, palabras griegas, nociones, referencias bibliogrficas, ediciones, bibliografa), todos los cuales son muy de
agradecer por su utilidad prctica. Adems del ndice final de contenidos, muy detallado, se incluyen unos anexos de datos y cifras en forma de tablas que me parecen
extraordinariamente tiles para quien desee entrar en el detalle. La edicin est muy
bien cuidada, muy limpia de erratas, pero lo que, sin duda, me gustara destacar es la
gran claridad con la que el libro est redactado: su sencillez, su exposicin directa,
sus recapitulaciones frecuentes, todo ayuda a su lectura. Quiz no se asuman absolutamente todas las conclusiones o la interpretacin de absolutamente todos los datos
que Denizot presenta es lgico en un estudio tan extenso, pero sin duda es un
estudio imprescindible para quien desee avanzar en el conocimiento de la expresin
de las rdenes en griego antiguo.
M. DOLORES JIMNEZ LPEZ
Universidad de Alcal
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

423

Ruiz Darasse, Coline y Lujn, Eugenio R. (eds.), Contacts linguistiques dans


lOccident Mditerranen antique. Collection de la Casa de Velzquez 126, Madrid, Casa de Velzquez, 2011, XII + 312 pp.
Se renen en este libro una serie de estudios sobre contactos lingsticos en la Antigedad en el Mediterrneo occidental agrupados geogrficamente (Hispania, frica
Proconsular, Italia e Ilrico, Galia meridional) y en un arco temporal que abarca desde
la Prehistoria hasta el siglo III, fruto de un Coloquio Internacional celebrado en la
Casa de Velzquez (Madrid) en abril de 2009.
Tras una introduccin de C. Ruiz Darasse, abren la parte dedicada a la Pennsula Ibrica F. Beltrn Lloris y M. J. Estarn Tolosa (Comunicacin epigrfica e
LQVFULSFLRQHV ELOLQJHV HQ OD 3HQtQVXOD ,EpULFD  TXH HVWXGLDQ ORV HStJUDIHV TXH
de una u otra manera son testimonio de bilingismo, distinguiendo entre epgrafes
estrictamente bilinges, mixtos, transliteraciones y epgrafes en una lengua distinta
de la esperable por el contexto. J. de Hoz (Las funciones de la lengua ibrica como
OHQJXDYHKLFXODU DERUGDXQDFXHVWLyQ\DWUDWDGDSRUpOGHVGHKDFHDxRVHVWXGLDQGR
en detalle el uso del ibrico como lengua vehicular fuera del sudeste peninsular, atendiendo al uso de antropnimos no ibricos, lo que le lleva a precisar el no iberismo
de Languedoc-Rousillon, nordeste peninsular (con la excepcin de Ampurias) y valle
del Ebro hasta el ro Mijares por el sur. J. Gorrochategui (Contactos lingsticos y
HSLJUiILFRVHQOD]RQDYDVFRDTXLWDQD HVWDEOHFHTXHORVHVFDVRVWH[WRVLQGtJHQDVQR
monetales de la zona vasca son ibricos, celtibricos o de dudosa interpretacin, las
leyendas monetales siguen la escritura ibrica con algunos signos marginales y no
hay datos de raz uskara para los Pirineos orientales. En textos latinos los antropnimos terminan declinndose, habiendo en la fontica un claro intento de adaptacin
y teniendo la epigrafa latina al oeste del ro Gllego ms rasgos indgenas y siendo
ms pobre. Por otra parte en Aquitania en su zona oriental hay nombres indgenas que
faltan en la occidental y se testimonian contactos galo-aquitanos con predominio de
lo aquitano. J. Velaza Fras (Los contactos lingsticos en la Hispania prerromana
\URPDQD&XHVWLRQHVFRQFHSWXDOHV\PHWRGROyJLFDV DILUPDTXHDSHQDVHVSRVLEOH
determinar cmo se han verificado los contactos lingsticos entre las lenguas paleohispnicas debido al escaso conocimiento que tenemos de estas, estando adems
abiertas cuestiones sobre el ibrico, las lenguas indgenas y el paleoeuropeo e inclinndose el autor a considerar lo que se llaman hechos de sustrato como producto de
la evolucin interna del latn.
La contribucin de C. Mrcia (Que sait-on de la langue des Maures? Distribution gographique et situation sociolinguistique des langues en Afrique ProconsuODLUH  HV OD ~QLFD UHIHUHQWH D IULFD 3URFRQVXODU (VWDEOHFH TXH HO DQiOLVLV GH PiV
de un centenar de palabras sacadas de fuentes griegas y latinas prueba que la lengua
indgena es el estadio antiguo del bereber (o amzigo), aunque quedan por analizar
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

424

RESEAS DE LIBROS

las fuentes medievales, y este conoce ciertamente latinismos a causa de innovaciones


tecnolgicas, la explotacin econmica y el cristianismo.
A la situacin en el Ilrico dedica su contribucin S. Destephen (La coexistence
du grec et du latin en Illyricum (Ier - VIe VLqFOH  TXH GHVWDFD OD DEXQGDQFLD GH
inscripciones que testimonian el contacto entre latn y griego en el Ilrico central
y meridional durante el Alto Imperio, con una simplificacin de la situacin en el
Bajo Imperio.
En los estudios dedicados a Italia P. Poccetti (Anthroponymes et toponymes
LVVXVGHWKQLTXHVHWQRPVJpRJUDSKLTXHVpWUDQJHUVGDQVOD0pGLWHUUDQpHDUFKDwTXH 
pasa revista a numerosos antropnimos de la Italia antigua provenientes de etnnimos y topnimos con especial atencin al nombre de los etruscos en griego y latn y
al de los latinos en etrusco y griego. G. van Heems ( propos de lchange graphiTXH)+HQpWUXVTXH LQWHUSUHWDHOFDPELRJUiILFRHWUXVFRf-/h- como reflejo de
un hecho fontico debido a un fenmeno de convergencia tpico de un Sprachbund
y no como un prstamo del latino-falisco (y/o del sablico) al etrusco o como un
proceso inverso.
Para la Galia meridional M. Bats (Emmlements de langues et de systmes graSKLTXHVHQ*DXOHPpULGLRQDOH 9,H,HUVLqFOHDY-& VHxDODTXHORVSULPHURV
textos conocidos son griegos y etruscos con algn caso de mezcla, apareciendo luego
(s. IV-III) el ibrico, y que hay mezclas de lenguas y escrituras junto con numerosos
nombres galos; finalmente (s. II-I) se desarrolla la escritura galogriega y la galolatina. A. Mullen (Reflets du multiculturalisme. La cration et le dveloppement du
JDOORJUHF VRVWLHQHTXHHOJDORJULHJRPiVTXHFRPRODPDQLIHVWDFLyQGHXQVHQWLmiento de identidad y la asociacin de su nacimiento a Marsella, se comprende mejor
por los contactos itlicos y como fruto de un desarrollo interno de las poblaciones
galas, lo que aplica a la explicacin de la frmula dedebriatoudekanten.
Por su parte P. Schrijver (La langue hattique et sa pertinence possible pour
OHV FRQWDFWV OLQJXLVWLTXHV SUpKLVWRULTXHV HQ (XURSH RFFLGHQWDOH  HQWLHQGH TXH
se puede hablar tambin de contactos lingsticos en poca prehistrica, proponiendo que los hablantes de htico (y minoico) se han extendido por Europa
desde el neoltico.
)LQDOPHQWH(/XMiQ &RQFOXVLRQHV UHYLVDODVDSRUWDFLRQHVGHFDGDDXWRUHQmarcndolas en consideraciones generales sobre el cambio lingstico: tipos y grados
del cambio, mecanismos e indicios del mismo. Sostiene que conviene distinguir entre
lenguas que arraigan en un lugar y lenguas de minoras extranjeras y que importan
las circunstancias sociales e histricas en que se produce el contacto.
Se trata, en resumen, de un interesante conjunto de trabajos que iluminan desde
diversas perspectivas el problema de los contactos habidos en la Antigedad entre
las lenguas de las que tenemos testimonios en el Occidente europeo y norteafricano.
Tal vez habran sido tiles un ndice de materias (solo lo hay bibliogrfico) y los reEmerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

425

smenes de cada trabajo, si bien esta ltima ausencia queda paliada por la dimensin
moderada de los estudios.
JOS A. CORREA
Universidad de Sevilla

III.

Literatura y filosofa

Rotstein, Andrea, The Idea of Iambos, Oxford, Oxford University Press, 2010,
388 pp.
Libro importante este, relativo a iambos, palabra bastante misteriosa en griego antiguo, as como todas las formas de l derivadas. A qu se refiere la palabra, a ritmo,
a metro, a gnero literario?, a forma, a contenido, a qu? Probablemente, de mezclar
todo esto, de unir interpretaciones antiguas, de Aristteles a los gramticos latinos,
procede la confusin.
Una parte I, dedicada a Greek Iambos (7th to 4thFHQW%& *HQUHDQG&RUSXV
abre el tema. Se refiere el trmino a poemas en diferentes metros o de un contenido
especfico? Por ejemplo, hablar de yambos en Safo (Suda) debe referirse al contenido, a algo prximo a la poesa ymbica. Esta parece que en el siglo sexto debi de
ser algo distinto de la poesa burlesca. Inversamente, llamar yambos a poemas de
Jenfanes conocidos luego como silloi burlas nos desconcierta.
Hay ms ejemplos en que llamar iamboi a ciertos pasajes nos desconcierta tambin. En fin, hay diez poetas calificados de ymbicos, otros calificados de ymbicos
cuando no lo son predominantemente, tal Safo, otros calificados slo a veces de
ymbicos. No creo que esto tenga importancia. Rotstein (p. 56) habla de yambo
FRUHDQGSHULSKHU\
Es un error empearse en definiciones esencialistas. Y ms buscarlas en Aristteles, nuestra misma autora ve (pp. 96-97) cmo este autor flucta en la definicin
relativa de iamboi y psogoi. Creo que dirigirse a Aristteles sobre la iambik idea
o la relacin de iambos y iambeion es un error. Hay que partir de nuestros datos y
nuestra ciencia. Rotstein ve muy bien que iambos es la base, iambeion un derivado
de sentido puramente mtrico.
Tanta especulacin sobre Aristteles y los gramticos latinos daa al libro. Son
mucho ms interesantes captulos como, en la parte III, el 5 IambosLQ$UFKLORFKXV
el 6 Iambe and Iambos HO  Iambos and Iambeion LQ WKH &ODVVLFDO 3HULRG HO
primero es un trmino rtmico y genrico, el segundo un derivado (contra lo que dice
Aristteles, en esto nuestra autora y yo estamos de acuerdo).
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

426

RESEAS DE LIBROS

Tambin la Parte IV The Performance of Iambos< OD 9 VREUH OD LQYHFWLYD
FRPR WKH LPSRUWDQW IHDWXUH RI ,DPERV $TXt 5RWVWHLQ VH VHSDUD FRPR D YHFHV
antes, pero con vacilacin) de las definiciones esencialistas: slo el contexto decide
cundo hay una definicin esencial, cundo otra marginal.
El libro es importante, tan solo opino que le sobran algunas especulaciones sobre
Aristteles y los gramticos latinos que no aportan gran cosa.
FRANCISCO R. ADRADOS

Manzano Ventura, M.Victoria, Los discursos de exhortacin militar en la Farsalia de Lucano, Madrid, Ediciones Clsicas, 2010, 270 pp.
(OOLEURTXHQRVRFXSDHVODUHHODERUDFLyQGHXQWUDEDMRGHJUDGRPHUHFLGDPHQWH
premiado por la Universidad de Extremadura, por la Fundacin Pastor, por la SEEC y
por la SELat. En l, M. Victoria Manzano Ventura desarrolla un estudio monogrfico
de las arengas lucaneas no acometido como tal por la crtica precedente desde
un punto de vista ideolgico que vindica la relevancia de las circunstancias histricopolticas bajo las que vivieron y murieron el autor y los receptores de la Farsalia, sustrayendo la interpretacin del poema a los excesos inmanentistas de lecturas
deconstruccionistas como las de W. R. Johnson (Momentary Monsters, Ithaca, 1987)
y J. Masters (Poetry and Civil War in Lucans Bellum Civile, Cambridge, 1992).
/D PRQRJUDItD VH DEUH FRQ XQD H[FHOHQWH ,QWURGXFFLyQ JHQHUDO SS  
que, adems de ofrecer nuevas perspectivas acerca de aspectos fundamentales de
la vida del poeta cordobs, como los celos literarios de Nern y los objetivos de la
conjura de Pisn, propone interesantes soluciones a problemas clsicos de los estudios lucaneos, como el sentido del elogio del emperador que se explica como una
concesin para evitar la censura y el posible final no escrito de la Farsalia a la
TXHODKHURLFDPXHUWHGH&DWyQKDEUtDSURFXUDGRXQDFRQFOXVLyQLGHDO(QFRQsonancia con esta hiptesis, la lectura del poema se plantea a partir de los tres ejes
SROtWLFRLGHROyJLFRVTXHHQRSLQLyQGHODDXWRUDORYHUWHEUDQGHVGHXQSXQWRGH
YLVWD PRUDO ORV YHQFLGRV VRQ ORV ~QLFRV \ DXWpQWLFRV YHQFHGRUHV HV YHUJRQ]RVR
FRQVHUYDUODYLGDSULYDGRGHOLEHUWDG\DODPSDURGHXQWLUDQRODPXHUWHVLQynimo de felicidad, es la mejor arma del ser humano para lograr la libertad plena y
DEVROXWD SS $VtORVGLVFXUVRVSDUHQpWLFRVFX\RHVWXGLRFRQVWLWX\HHOREMHWR
del trabajo se irn descubriendo como una prolongada sucesin de uariationes en
torno a estas tres ideas.
Deja de lado Manzano las arengas pronunciadas por Csar (I 296-351; VII 250329) y por Pompeyo (II 530-595; VII 342-382) cuya funcin principal estriba, a
su juicio, en la caracterizacin negativa de ambos generales para establecer como
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

427

corpus de su investigacin las de los cesarianos Vulteyo (IV 476-520) y Esceva (VI
150-165) y las de los pompeyanos Catn (IX 256-283, 379-406) y Petreyo (IV 211235), a cada una de las cuales dedica un captulo. El estudio previo de la tradicin
parentico militar (pp. 59-69) le permite dejar sentado que estos cinco discursos,
compuestos con una tcnica ms cercana a la del historiador que a la del poeta pico,
tienen en comn el singular hecho de estar construidos exclusivamente en torno al
WySLFR GH OD FRQYHQLHQFLD pWLFD \ PRUDO GH DIURQWDU OD OXFKD S   \ VREUH XQ
esquema que se repite sin modificaciones significativas: van dirigidas a hombres en
una situacin desesperada que, cuando se hallan dispuestos a rendirse servilmente,
son llamados de nuevo a las armas por un jefe cuya actitud de compromiso tiene
carcter ejemplarizante, de tal manera que la dramtica situacin se resuelve con
la ponderacin de la uirtus suprema que anima a afrontar la muerte con valenta
(pp. 117, 147, 177-178). Si el cotejo con las fuentes historiogrficas descubre en las
arengas un genuino producto de la inuentio lucanea, el anlisis minucioso de la terminologa en ellas empleada p. ej. securus (pp. 161-163), famulus (pp. 164-165),
dominus (p. 165, 207-208), uiri (p. 198) revela el desajuste entre los argumentos
exhortativos, cercanos a los esgrimidos por la oposicin al principado en el siglo I
d. C., y el perfil de los interpelados, tropas no romanas que se hallaban unidas a Csar o a Pompeyo por vnculos clientelares. Sostiene, en consecuencia, la autora que
el destinatario ltimo de estas reiteradas exhortaciones a anteponer la libertas a la
servidumbre aun a costa de la propia vida es la aristocracia senatorial oprimida por
el despotismo neroniano, receptor no representado que se reconstruye a partir de las
obras de Sneca y Tcito. As, las cinco arengas militares se revelan como vehculo
privilegiado del indignado mensaje poltico de un Lucano que, lejos de acomodarse
DODHVWRLFDSURSXJQDGDSRUVXWtR6pQHFDFHOHEUDODPXHUWHFRPRYLFWRULD
ltima en la lucha sin cuartel por la libertas republicana, a fin de animar a las vctimas del Principado a la resistencia.
La calidad de la argumentacin de Manzano, apoyada en numerosos grficos y
cuadros comparativos, salta a la vista en cada pgina, y prueba el profundo conocimiento que tiene no slo de la Farsalia, sino tambin de la retrica y de la tradicin
historiogrfica, as como de la obra de Sneca y del estoicismo. Destaca, adems, el
rigor con el que se maneja la bibliografa citada, precedida al final del volumen por
tres apndices (un catlogo de obras de Lucano, un listado de las arengas presentes
en la pica imperial y un estudio acerca de los topoi parenticos empleados por la
historiografa griega y latina).
Bienvenida sea, pues, esta magnfica monografa, aun cuando no resulte fcil
compartir la conclusin de que no es el pesimismo la ltima palabra de la epoSH\D S (VWiFODURTXH/XFDQRDGRSWDXQDSRVWXUDPXFKRPiVSROtWLFD\
ms rebelde que la que sera propia de un estoico ortodoxo (p. 191), pero no lo
est tanto que su intencin fuera infundir consuelo y esperanza en los enemigos del
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

428

RESEAS DE LIBROS

Principado. El XHOXWLXHQLHQWLDIDWDQRQWUDQVPLVVDOHJHQW (VII 212-213) apunta


a las concomitancias entre lo narrado por Lucano y la actualidad poltica, dejando
DELHUWDODSRVLELOLGDGGHRSRQHUVHDODEDUEDULHGHORVWLHPSRV S RH[SUHVD
ms bien al hecho de que la Repblica, cada sin remedio, slo ha podido sobrevivir
a travs de la poesa (cf. IX 980-986)? Es la Farsalia, a la postre, una consolatio o
un desesperado epicedion in libertatem?
ANTONIO RO TORRES-MURCIANO
Universidad Nacional Autnoma de Mxico

Casali, Sergio y Stok, Fabio (eds.), Servio: stratificazioni esegetiche e modelli culturali / Servius: Exegetical Stratifications and Cultural Models. Latomus 317,
Bruxelles, 2008, 280 pp.
El volumen 317 de la Collection Latomus contiene las actas del encuentro que en el
marco del proyecto del profesor F. Stock Modelli culturali e letterari dellesegesi
ODWLQD WDUGRDQWLFD WXYR OXJDU HQ 5RPD 8QLYHUVLWj GL 7RU 9HUJDWD  HQ  VREUH
Servio y la exegesis serviana. En l aparecen recogidas la mayor parte (16) de las
contribuciones al tema y ello desde diferentes puntos de vista. Son las siguientes en
orden de aparicin: 1. Alison R. Sharrock, Aemulatio WKH FULWLF DV LQWHUWH[W 
6HUJLR&DVDOL(FFH dixit : allusioni irrazionali alle varianti scartate
GHOOD VWRULD GL 'LGRQH H$QQD VHFRQGR 6HUYLR  5XWK 0RUHOOR Segregem eam
efficit9HUJLOV&DPLOODDQGWKHVFKROLDVWV&RVWDQ]D0DVWURLDFRYR,celeres e
ODQWLFD FDYDOOHULD QHOO
HVHJHVL VHUYLDQD  &DUOR 6DQWLQL 9LUJLO DV HWUXVFRORJLVW
in Serviuss commentary or: from the author to the author; 6. Tiziana Privitera,
Servius and the city of Amyclae FDVH  5LFKDUG ) 7KRPDV  6HUYLXV DQG WKH
HPSHURU  -RVHSK$ )DUUHOO 6HUYLXV DQG WKH +RPHULF VFKROLD  )DELR 6WRN
Servio fra sinonimia e differentiae uerborum $OGR 6HWDLROL 6WRLF DQG (SLFXUHDQLQWHUSUHWDWLRQVLQ6HUYLXVVFRPPHQWDU\RQ9HUJLO)DEUL]LR&RPSDUHOOL
6WUDWLILFD]LRQLRUILFKHLQ6HUYLR/XFD&DGLOL6FKROLDDQGDXWKRULDOLGHQWLW\
the Scholia Bernensia on Vergils Georgics as Servius auctus&ODXGLR%DVFKera, Servius Danielinus and Scholia Veronensia5LFFDUGR6FDUFLD:RUNLQJ
K\SRWKHVHVRQWKHFRQQHFWLRQEHWZHHQ6HUYLXVDQG,VLGRUHRI6HYLOOH*LXVHSSH
5DPLUHV1HZVRI*XDULQRVORVW6HUYLXV*UHJRU9RJW6SLUD6HUYLXVLQGHU
Tradition des Homer-Vergil-Vergleichs: einige berlegungen zu Methode und KriWHULHQ$GHPiV XQ EUHYH SUHIDFLR GH ORV HGLWRUHV DEUH HO YROXPHQ \ OR FLHUUD XQD
profusa y heterognea bibliografa extrada del conjunto de los artculos recogidos
en el volumen.
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

429

Con estas premisas es indudable que no se puede esperar de la obra una suerte
de Companion acerca de Servio, ni se pretende tampoco. Con todo, ello no obsta
para que sus editores hubieran sido ms generosos en las explicaciones a la hora
de presentar la seleccin de trabajos y, sobre todo, su organizacin, que por lo que
cabe deducir de la lectura de la obra va progresivamente avanzando desde ejemplos
particulares sacados de diferentes libros de la Eneida a explicaciones ms o menos
amplias sobre diferentes temas virgilianos en Servio, para finalizar con reflexiones
sobre la fortuna de Servio, aunque a veces las transiciones de un trabajo a otro sean
realmente difciles de justificar, como cuando pasamos de un estudio de las differentiae uerborum propuestas por Servio (F. Stok) a un trabajo sobre interpretaciones
estoicas y epicreas del material serviano (A. Setaioli). Un poco ms pormenorizadamente los contenidos tratados son los que siguen:
1. Alison R. Sharrock discute sobre la consideracin de un Servio como exgeta
QHXWUDORHOSHUVRQDMHTXH6HUYLRSUHVHQWDGHVtPLVPRFRQXQDYROXQWDGFDVLGH
rivalizar con el propio Virgilio a la hora de la consideracin de la reina Dido. Explcitamente llama a esta forma de actuar Servian creative involvement and partisanship
ZLWK 'LGR DVt HQ OD S  GRQGH DSDUHFH XQD GH ODV HVFDVDV HUUDWDV TXH KHPRV
detectado, Iarbus donde se esperara, entendemos, Iarbas).
2. Sergio Casali insiste tambin en el tema de Dido para tratar de demostrar
partiendo del comentario de Servio a I 267 que mediante determinadas anfibologas
Virgilio tambin se habra hecho eco de otra tradicin presente en Varrn y recogida
tambin por Servio segn la cual la enamorada de Eneas sera tambin Anna, la
hermana de Dido.
3. El artculo de R. Morello se centra ahora en el personaje de Camila, el cual
es analizado desde la perspectiva de los estudios de gnero. Para ello su autora
H[DPLQDODVUHVSXHVWDVGH6HUYLRD&DPLODTXHDYHFHVVHJ~QODDXWRUDQRFDEH
deducirlas del propio texto de Virgilio, y de paso las de los crticos modernos ante
la misma situacin.
4. La contribucin de Costanza Mastroiacovo se centra en la interpretacin que
se puede hacer de los celeres Latini de XI 603, como referencia etimolgica a la
ms antigua formacin de caballera de poca de Rmulo, a partir del comentario de
Servio para destacar el uso anacrnico y, por tanto, ms que etiolgico, de carcter
ideolgico de referentes militares de la poca augstea en descripciones de tiempo
mtico, o al menos contemporneamente homricos.
5. La contribucin de C. Santini se basa en el inters despertado en poca de
Servio por la cultura etrusca, de donde procedera el gusto del exgeta y del Servius
Danielinus por las posibles alusiones al mundo etrusco, sus instituciones polticas
o los principios religiosos susceptibles de aparecer en la Eneida, elementos todos
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

430

RESEAS DE LIBROS

relacionados con el inters contemporneo a Servio por la disciplina etrusca como


medio de oposicin al avance del cristianismo.
6. El trabajo de Tiziana Privitera trata de esclarecer la oscura referencia al
origen de un guerrero muerto por Eneas natural de tacitis Amyclis. Sin embargo, a
pesar de que en apariencia el trabajo se centra en un aspecto muy concreto, en el que
adems abundaran los sobreentendidos, las alusiones ms o menos veladas, etc., sin
embargo es de destacar porque pone de relieve un hecho singular a la hora del estudio
de la Eneida y del propio Servio: la informacin superpuesta en la exgesis no opera
solo diacrnicamente, sino tambin de forma sincrnica superponiendo informacin
en una suerte de contaminacin horizontal entre las glosas, lo cual para quien ha
tenido delante la tarea de editar y traducir la Eneida (vase Luis Rivero Garca, Juan
A. Estvez Sola, Miryam Librn Moreno y Antonio Ramrez de Verger P. Vergilius
Maro. Aeneis || Publio Virgilio Marn. Eneida, Madrid: CSIC, 2009-2011, 4 vols.)
se revela como un elemento con validez para la crtica textual.
7. Richard F. Thomas indaga en las posiciones que han venido manteniendo
ORV HVFROLDVWDV D PXOWLSOLFLW\ RI YLHZV IUHQWH D ORV HOHPHQWRV GH LGHRORJtD
augustea plasmados por Virgilio segn aparecen en la Eneida.
8. Joseph A. Farrell traza una sugestiva visin segn la cual la exgesis serviana
pudo usar la tradicin escoliasta homrica no solo como fuente de documentacin,
sino como fuente de imitacin estructural en un intento de rivalizar con ella.
9. Fabio Stok ensaya una clasificacin en cinco tipos de las differentiae de
trminos semntica, fontica o gramaticalmente afines, que puede revelarse til para
el estudio de dicho modo de interpretacin gramatical en poca tardoantigua y sobre
todo medieval, con especial inters por lo que pueda tener de contacto con autores
como Isidoro.
10-11. Las contribuciones de Aldo Setaioli y Fabrizio Comparelli versan sobre
interpretaciones de carcter estoico-epicreo, por un lado, y rficas, por otro (ad.
Aen. III, 94-98 ; VI, 392 ; VI, 565 ; georg. I, 5-11 y IV, 492) y que resultan reveladoras de la cultura de Servio, e igualmente sacan a la luz la amalgama de elementos
cuasi religiosos presentes en l. Si Macrobio refleja una interpretacin de Virgilio
segn sus convicciones neoplatnicas, Servio en la marea de neoplatonismo imperante explicita algunas convicciones de orden estoico o epicreo, aunque degradadas hasta el estereotipo. El anlisis de Comparelli, por su lado, tiene la virtud
de llevar ms all de Virgilio y Servio las notaciones rficas y ejemplificarlas en
autores del Medievo, como Rabano Mauro o Dante, y modernos como C. Pavese y
G. Bufalino.
12-14. Los trabajos de Luca Cadili, Claudio Baschera y Riccardo Scarcia, sobre
Servio y Servio Danielino, y los scholia Bernensia y Veronensia, y sobre Servio en
la tradicin de Isidoro tal vez formen el grupo de carcter ms unitario de los vistos
hasta ahora. Sus conclusiones ponen de relieve una tradicin de Servio independienEmerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

431

te del Servius auctus en la que se recoge lo mejor de los comentarios antiguos de


Virgilio. Baschera intenta reflejar esto mediante un esquema semejante a un rbol
genealgico (p. 214).
15. G. Ramires contina la serie de trabajos sobre el conocimiento de Servio en
poca posterior, en este caso en la literatura humanstica. Analiza desde un punto de
vista crtico-textual el Servio de Battista Guarini, de 1471, para concluir que repoVDUtDVREUHXQPDQXVFULWRGHODUDPDFRQWDPLQDGRSRU\XQ6HUYLXVDXFWXVeVWH
sera el texto usado principalmente por los humanistas posteriores.
16. La contribucin de Gregor Vogt-Spira cierra el volumen estudiando el papel
de Servio en la comparacin entre Homero y Virgilio.
Con todo el material anteriormente expuesto el lector especializado puede hacerse una idea de conjunto de por dnde circula la interpretacin del comentario
de Servio, cosa loable. No por ello, sin embargo, podemos dejar de sealar la falta
de justificacin a la hora de seleccionar el material y su organizacin, e igualmente
encontramos reprochable no haber incluido un ndice de los lugares de la obra de
Virgilio citados, de otros autores antiguos y, aun ms, un ndice de los lugares de la
obra de Servio anotados.
JUAN A. ESTVEZ SOLA
Universidad de Huelva

Dpp, Siegmar, Eva und die Schlange. Die Sndenfallschilderung des Epikers Avitus
im Rahmen der bibelexegetischen Tradition, Speyer, Kartoffeldruck-Verlag, 2009,
126 pp.
A caballo entre los siglos V y VI el obispo de Viena lcimo Ecdicio Avito escribi
un poema pico de tema bblico en cinco libros, De spiritalis historiae gestis, cuyo
libro II poetiza la historia del pecado original. El poema de Avito tuvo una notable
influencia en la literatura posterior, pero no es un experimento aislado ni espontneo.
Este breve pero interesantsimo estudio de Siegmar Dpp tiene, entre otras muchas,
la virtud de encuadrar la obra en el contexto de la pica de tema bblico, especialmente en el marco de la literatura cristiana latina tardoantigua y en la tradicin de
la exgesis bblica.
El estudio tiene una estructura clara y est escrito de manera ordenada, concisa,
muy didctica. Se organiza en diez captulos. En los primeros seis se sientan las
bases para el estudio de los tres pasajes de la obra de Avito que centran el anlisis
en los captulos finales (Hist. 2.1-139, 2.140-260 y 3.4-194). Despus de una introGXFFLyQ HQ OD TXH VH HVER]D OD ILQDOLGDG GHO OLEUR 7KHPD XQG 9RUJHKHQZHLVH 
HQHOFDStWXOR %LEHOHSLNYRQGHU$QWLNH]XU1HX]HLW VHKDFHXQUHSDVRSRUOD
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

432

RESEAS DE LIBROS

poesa pica de tema bblico desde la Antigedad hasta la poca moderna. Dpp se
detiene sobre todo en la pica bblica tardoantigua (ss. IV-VI), en cuyo contexto se
sita la obra de Avito, pero rastrea la historia del gnero en pocas posteriores. En
HOFDStWXOR ,QWHQWLRQHQGHUVSlWDQWLNHQ%LEHOHSLNHU '|SSSUHVHQWDGHPDQHUD
clara las intenciones poticas de quienes en la Antigedad tarda se aventuraron a
escribir poemas picos sobre tema bblico: comparten sobre todo su intencin didctica; en lo formal entroncan con la tradicin retrica de la laudatio; buscan hacer
ms agradable su materia recurriendo a la poesa; por ltimo, comparten un cierto
tono apologtico, pues se las tienen que ver con la contradiccin de usar un molde
pagano (el de la poesa pica hexamtrica) para un uso cristiano, adaptndolo para un
usus iustus. Pero adems de la pica clsica, la otra gran fuente de inspiracin para
estos poetas son las sagradas escrituras: en el captulo 4 (Der sptantike Bibelepiker
DOV%LEHOLQWHUSUHW HODXWRUSODQWHDODSUHJXQWDGHFyPRVHUHODFLRQDHOSRHWDpSLFR
bblico con su fuente principal, la Biblia, una fuente cuyo contenido, por tratarse de
la palabra de Dios, no puede modificar libremente atendiendo a criterios artsticos.
Al poeta cristiano le queda poco margen para la innovacin. Con todo, el sentido del
texto bblico est sujeto a interpretacin y su mensaje tiene que ser permanentemente
actualizado para seguir conservando su fuerza a pesar del paso del tiempo. El poeta
cristiano se convierte tambin en exgeta y encuentra en la exgesis bblica su tercera
fuente de inspiracin. Entre las distintas modalidades de exgesis bblica Dpp se
GHWLHQHHVSHFLDOPHQWHHQODVH[HJHWLVFKH(U]lKOXQJHQQDUUDFLRQHVRUHFUHDFLRQHV
exegticas (de poca antigua y en distintas lenguas) que la crtica moderna denomina
rewriting the Bible y que, salvando las distancias, comparten la intencin ltima de
QXHVWURSRHWD(QHOFDStWXOR $YLWXVELEOLVFKH9RUODJH HODXWRUHQWUDHQPDWHria exponiendo el asunto fundamental del poema a travs de su fuente fundamental,
Gen. 3.1-6, y su significado, para lo cual introduce el contenido del pasaje bblico,
presenta los textos (en la versin de la Tora, los Septuaginta, la Vulgata y en traduccin alemana) para terminar con la exgesis moderna del mismo. El captulo 6
(YD$GDPXQGGLH6FKODQJHLQGHU%LEHOXQGLQDQWLNHU([HJHVH HVFUXFLDOSDUD
entender qu elementos del poema de Avito estn tomados del texto bblico (del
Gnesis o de otros libros del Antiguo Testamento) y cules se han ido desarrollando
con posterioridad (en la exgesis juda, el Nuevo Testamento o la exgesis cristiana
de la Antigedad tarda).
El captulo 7 constituye una breve presentacin de la materia literaria del poema,
con un especial nfasis en sus modelos latinos clsicos y cristianos, cuya influencia
ilustra el autor con ejemplos concretos. Entre los primeros destacan Virgilio, Ovidio
y Estacio. Entre los segundos la palma se la lleva Prudencio y, especialmente, su obra
Hamartigenia, fundamental para la caracterizacin del demonio. Tras un brevsimo
captulo sobre la interpretacin bblica en el poema, llegamos a la parte fundamental
de la obra, el captulo 9 (Avitus Sndenfalldarstellung im Blick auf die exegetische
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

433

7UDGLWLRQ (QODLQWURGXFFLyQGHHVWDVHFFLyQVHUHWRPDODLGHDGHTXHODKLVWRULD
del pecado original llega hasta las manos de Avito con muchos aadidos, cuyos orgenes han sido estudiados y analizados en los captulos anteriores (entre otros, el rol
fundamental de Eva como inductora, la identificacin entre la serpiente y el demonio,
o la presentacin del demonio como ngel cado y enemigo de la humanidad). En
los tres subcaptulos subsiguientes se analizan cada una de las partes del poema que
versan sobre esta historia, en un sutil ejercicio de anlisis literario y de comparacin
con las fuentes que valora cada giro y cada aportacin del poema de Avito. La obra
resulta ser, como se seala en la conclusin, mucho ms que una simple versificacin del texto bblico, destacando sobre todo por su introspeccin psicolgica y su
perfeccin retrica.
Tal vez el nico inconveniente que he encontrado es que el autor no haya encabezado su estudio con el texto completo de los pasajes que analiza (ofrece, eso s,
algunos fragmentos en el captulo 9). Como ya se ha sealado, el libro est escrito
de forma lcida y da cumplidas cuentas de su objetivo: estudiar el poema a la luz
la tradicin exegtica. La obra est, adems, magnficamente documentada, con una
extensa bibliografa que ocupa 25 pginas (de 126), y se completa con un completo
ndice general. En definitiva, se trata de un libro muy recomendable, una magnfica
presentacin de la versin que hizo Avito de Viena del siempre atractivo relato del
pecado original.
ROSARIO MORENO SOLDEVILA
Universidad Pablo de Olavide (Sevilla)

Langslow, David y Maire, Brigitte (eds.), Body, Disease and Treatment in a


Changing World. Latin texts and contexts in ancient and medieval medicine, Lausanne, ditons BHMS, 2010, 403 pp.
Recoge este libro versiones revisadas de las contribuciones presentadas al 9th International Colloquium in Ancient Latin Medical Texts, dedicado a Language and
Context in Latin Medical Texts of the Pre.-Salernitan Period, que tuvo lugar en la
Universidad de Manchester del 5 al 8 de septiembre de 2007.
Los editores han repartido un total de veintisis trabajos en tres secciones que
tienen como hilo conductor comn el anlisis del papel mediador de hablantes, pensadores y escritores latinos en la transmisin de la medicina y de la ciencia griega.
1. La primera seccin, denominada Graeco-Roman Medicine, medical lanJXDJH DQG VRFLROLQJXLVWLFV DJUXSD VLHWH WUDEDMRV GH RWURV WDQWRV HVSHFLDOLVWDV TXH
abordan, desde diferentes perspectivas, el trasvase al latn de teoras, conceptos y
terminologa mdicos griegos, as como su desarrollo y difusin. Los dos primeros,
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

434

RESEAS DE LIBROS

H. Von Staden (How Greek was the Latin Body? The parts and the whole in Celsus
Medicina  \ ) /H %OD\ /HV SRUHV GH OD SHDX XQH HQWLWp SK\VLRORJLTXH SUREOpPDWLTXH SDUWHQGHXQDYLVLyQPiVJHQHUDO*0DUDVFRVHPXHVWUDHQGHVDFXHUGR
con la idea tradicional de que la historia de la medicina en el Imperio romano y en
la Antigedad es una mera sntesis y fijacin de la teora griega y B. Maire dirige su
atencin a un aspecto novedoso de la representacin de la biologa femenina en la
versin que hace Muscin de Sorano. Los dems trabajos de esta seccin estudian el
vocabulario y ponen de relieve el valor que para el historiador de la medicina tienen
las manifestaciones de esta ciencia en trabajos no mdicos: I. Mazzini documenta
\FRPHQWDXQDJUDQFDQWLGDGGHRFXUUHQFLDVGHOYRFDEXODULRPpGLFRSRSXODUTXH
surge, en paralelo con la lengua mdica especializada, como consecuencia del traspaso de conceptos de una comunidad lingstica a otra; M. Baldin presenta y analiza
expresiones mdicas encontradas en Plauto, Salustio y Juvenal, tres autores no mdicos, de tres pocas y de tres esferas sociolingsticas. El estudio de D. Crismani
1RQVRORPDOGDPRUH H[DPLQDODSUHVHQFLDGHODOHQJXDPpGLFDSRSXODUHQOD
novela antigua, griega y romana.
2. La segunda seccin es la ms extensa y rene, bajo el epgrafe Texts, transPLVVLRQDQGUHFHSWLRQRQFHFRQWULEXFLRQHVGHGLFDGDVDODUHFHSFLyQRWUDQVPLVLyQ
de algunos textos mdicos latinos. La mayora son traducciones de textos griegos,
aunque tambin hay trabajos redactados originalmente en latn. El tema central de
todas ellas es la importancia para los editores e historiadores de la tambin llamada
tradicin secundaria. Los dos primeros artculos adoptan enfoques complementarios
sobre la traduccin latina tarda y los comentarios de los Aforismos de Hipcrates,
son los de G. Haverling y M. E. Vzquez Bujn.
Muy estrechamente relacionadas entre s estn las contribuciones sobre la tradicin secundaria de Escribonio Largo de dos estudiosos que colaboran habitualmente,
S. Sconocchia (Lantidotos hieria di Scribonio Largo e i suoi rifacimenti attraverso
LOWHPSR \.ODXV'LHWULFK)LVFKHU 'LH$QWLGRWRVGHV=RS\URVXQGDQGHUH)XQGVWFNH]X6FULERQLXV/DUJXV 
El tercer par de trabajos concierne a otro autor mdico importante, Celio Aureliano, son los de A. M. Urso (Possibili varianti di transmissione nei margini delleditio
rovilliana GL &HOLR $XUHOLDQR  \ ) 0HVVLQD 1XRYL IUDPPHQWL GHL Gynaecia di
Celio Aureliano nelle traduzioni latine della Synopsis ad EustathiumGL2ULEDVLR 
Los siguientes trabajos versan sobre textos de farmacologa botnica, y en primer
lugar sobre las diferentes versiones latinas del De materia medica de Dioscrides:
M. Cronier encuentra nuevos e importantes fragmentos de una de las traducciones
antiguas (la traduccin B) en partes de la redaccin alfabtica, y A. Ferraces publica
dos fragmentos de partes de manuscritos de estas dos obras. Por su parte, V. Nurton
propone una conexin metodista para el desconocido autor del original griego perdido de la traduccin latina del siglo XIV de De uirtute centaureae pseudo-galnico.
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

435

Los dos ltimos trabajos de esta seccin se refieren a textos que hacen de puente
entre mundo antiguo y respectivamente la Edad Media y el Renacimiento: A. Garca
Gonzlez presenta y discute la transmisin y la lengua de este indito glosario mdico-botnico del siglo X, mientras el trabajo conjunto de P. P. Conde Parrado y M.
J. Prez Ibez demuestra la duradera influencia de Celso y la importancia otorgada
a su latn mdico en los albores de la lexicografa moderna.
3. La tercera y ltima seccin, denominada Words, meanings and lexical
fields rene ocho trabajos que competen al lxico o a la semntica: C. de la
Rosa Cubo para amo y amor y A. I. Martn Ferreira para puer e infans, tienen en
cuenta diferentes matices del significado atestiguados en el uso comn en textos
mdicos latinos desde la Antigedad hasta el Renacimiento. R. Passarella analiza,
en el vocabulario de la digestin, los cambios lxicos y semnticos desde Celso a
Casio Flix y muestra desarrollos no solo en la lengua, sino tambin en la teora
fisiolgica.
Siguen dos trabajos sobre patologa, el de M. Pardon-Labonnelie, que rene y
HVWXGLD WpUPLQRV SDUD HQIHUPHGDGHV GH ORV RMRV FRPR  HQ WH[WRV PpGLFRV
latinos y los compara con testimonios epigrficos para establecer las ocurrencias,
connotaciones y registro en contextos romanos de esos nombres griegos y el de
J. P. Barragn Nieto, que establece varios significados del trmino patolgico griego
haemorrhois en textos latinos desde Celso a Constantino el Africano, con una ligera
mirada a la Edad Media tarda y al Renacimiento. Otro uso del mismo trmino se
estudia en la contribucin sobre teraputica de P. Gaillard-Seux (Morsures, piqres
et empoisonnements dans lHistoire Naturelle GH3OLQHO$QFLHQ 8QVHJXQGRWUDbajo sobre teraputica, presentado por V. Gitton-Ripoll analiza el grupo de verbos
latinos WXQGHUHWHUHUHPROHUH, etc., atestiguados en textos latinos de veterinaria del
Imperio tardo, teniendo en cuenta los instrumentos utilizados en cada proceso para
poder distinguir entre los diferentes verbos y sugiriendo traducciones precisas al
francs de cada uno.
Cierra la seccin y el cuerpo de trabajos el de Ph. Mudry (Ratio et coniectura
GDQVOHVWH[WHVPpGLFDX[ODWLQV TXHDQDOL]DODVUHIOH[LRQHVDQWLJXDVVREUHHOSDSHO
del azar en la medicina, y en particular observaciones de Celso sobre el estatuto
epistemolgico de la medicina como ars coniecturalis.
El volumen se completa con una bibliografa general, obra de Brigitte Maire, que
rene en cuatro secciones (catlogos de manuscritos, ediciones de textos antiguos y
medievales, diccionarios, gramticas y concordancias y estudios) todas las referencias que hay al final de cada artculo y dos ndices, uno (a) de autores, obras y pasajes
que se estudian, y otro, (b), de palabras y frases.
MATILDE CONDE
CCHS-CSIC
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

436

IV.

RESEAS DE LIBROS

Historia, religin y sociedad

Knoepfler, Denis, La Patrie de Narcisse, Pars, Collge de France/Odile Jacob,


2010, 240 pp.
En la medida en que los personajes que protagonizan los mitos tienen patria pues
por definicin se sitan ms all de toda frontera, Denis Knoepfler, titular de la
ctedra de Epigrafa y de Historia de las Ciudades Griegas en el Collge de France
parisiense, ha escrito un libro que revela el nombre de la autntica patria de Narciso.
Todos conocemos la historia del muchacho que, enamorado de s mismo, intenta
besar su propia imagen reflejada en las aguas de un ro y termina ahogndose en
ellas. A caballo entre la Arqueologa, la Antropologa, la Historia de las Religiones
y la Epigrafa, el profesor Knoepfler descubre, con argumentos slidos y fehacientes
basados en determinadas inscripciones halladas en Eretria (pequea ciudad, hoy
desaparecida, de la isla de Eubea, objeto ltimamente de importantes y novedosas
excavaciones), que en dicho enclave urbano se encuentra el origen de la leyenda de
Narciso, cuya descripcin mitolgica y, sobre todo, religiosa, ya no ser la misma
despus de semejante hallazgo.
En efecto, Narciso, el jovencito imberbe del que nos hablan Pausanias y Ovidio
entre otros muchos y del que se enamoran en vano, segn la fuente que utilicemos, otro muchacho, Aminias, o la ninfa Eco, viva en Beocia, en las inmediaciones
del monte Helicn, entregado a un nico mtier: adorarse a s mismo. Con ese nico
objetivo en su punto de mira estaba lejos, como es lgico, de obtener una plena
satisfaccin sexual, por mucho que intentara aprehender su reflejo en el agua, en un
proceso de autolatra que luego los psiclogos, a partir de su nombre, denominaran
QDUFLVLVPR (O KHFKR HV TXH WDO PDQtD DFDEy FRQGXFLpQGROR D XQ VXLFLGLR LQYRluntario y a su ulterior metamorfosis en la flor homnima. Pero, al margen de esos
detalles fabulosos que tanto juego han dado en la literatura y en el arte occidentales
a travs de los siglos (me viene a la memoria, por ejemplo, el verso Que te vas a
FDHUDOUtRGHOSRHPD1DUFLVRLQVHUWRHQHOOLEURCanciones de Federico Garca
Lorca), Knoepfler, despus de arduos trabajos arqueolgicos y epigrficos, llega a la
conclusin de que Narciso fue tambin, junto con su paredro Hiacinto, una poderosa
divinidad de la vegetacin primaveral, nacida durante la protohistoria de la Hlade,
que simboliza, resume y condensa en su persona la renovacin anual de la naturaleza.
Una divinidad que surgi, como ya he dicho, en el entorno euboico de la ciudad de
Eretria, un contexto geogrfico que solo abonaban en la Antigedad dos o tres testimonios, entre ellos el de Estrabn (IX 2, 10), que se refiere a una supuesta tumba
de Narciso el Eretrio situada en Oropo, puerto beocio situado enfrente de su patria.
(OOLEURGH.QRHSIOHUYLHQHSXHVDUHIRU]DUHVDSUHFDULDHUHWULHGDGGH1DUFLVR
ya que la inmensa mayora de los testimonios antiguos lo consideraban originario de
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

437

RESEAS DE LIBROS

Beocia, concretamente de la ciudad de Tespias. Los captulos IV y V del volumen,


publicado por Odile Jacob a expensas del Collge de France, son nucleares a la hora
de esta nueva adscripcin geogrfica del personaje, pues la Epigrafa revela la existencia en Eretria de una tribu narkittis de donde derivara nuestro personaje, cuyo
nombre aparecera escrito con doble -tt- en lugar de con doble -ss-, un cambio meramente dialectal pero importante a la hora de fijar el Urname de la mtica criatura,
que sera Narkittos(VWH1DUFLWR VHJ~QXQHVFROLRGHO3VHXGR3URERDBuclicas
II 48 de Virgilio: 1DUFLVVXVIORVD1DUFLVVR$PDU\QWKLILOLRTXLIXLW(UHWULHXVH[
insula Euboea) sera, a su vez, hijo de Amarinto un hroe cazador relacionado con
la ciudad homnima de Eubea y con la gran rtemis Amarusia de los eretrios, y,
ms all de su linaje, una figura muy, muy antigua, tanto por lo menos como Hiacinto
(o Jacinto) el Laconio, su Doppelgnger.
'LFHHODXWRUHQVX&RQFOXVLRQ S TXHQRKDSHQVDGRQLXQVRORLQVWDQWH
en contester la lgitimit du mythe tel que la dvelopp et immortalis lauteur
des MtamorphosesRVHDTXH1DUFLVRGHVSXpVGHVXOLEURVLJXHVLHQGRHOPLVPR
que ha inspirado a infinidad de poetas, artistas, filsofos y psiclogos a lo largo del
tiempo. Lo nico que ha cambiado en l es, gracias a la Epigrafa, su patria, que
ahora no es la misma que antes. Un viaje interesante el de Knoepfler, fundamentado
en los hallazgos de cultura material que han ido producindose en los ltimos aos
en el Egeo. Enriquecen la obra una serie de mapas y de ilustraciones que ayudan a
navegar por ella en busca del puerto marcado de antemano por su autor: la ciudad
de Eretria, en Eubea. Lo que no entendemos es por qu, tras cada cita en griego
antiguo, aparece a continuacin su transcripcin fontica en caracteres latinos, como
si el lector de La Patrie de Narcisse no supiese leer en griego y necesitara ese tipo
de ayuda. Es la nica pega que pongo a un libro tejido con los mimbres slidos de
la ciencia y, a la vez, bien escrito y mejor contado, para facilitar una ms amplia
recepcin aquiescente de su mensaje.
LUIS ALBERTO

DE

CUENCA
CSIC

Soares, Lucas, Platn y la poltica. Coleccin Biblioteca de Historia y Pensamiento


Poltico, Madrid, Tecnos, 2010, 258 pp.
Este libro de Lucas Soares, profesor de Historia de la Filosofa de la Universidad
de Buenos Aires, se propone mostrar la larga y compleja maduracin de la filosofa
poltica de Platn desde sus inicios (no se limita a los tres dilogos polticos por
H[FHOHQFLDRepblica, Poltico y Leyes \HQSDUWLFXODUGHVPLWLILFDUODVXSXHVWD
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

438

RESEAS DE LIBROS

oposicin entre el idealismo utpico de la Repblica y el realismo desengaado de


las Leyes (p. 10).
La interpretacin de los dilogos platnicos que nos propone Soares es, en general (con unas pocas reservas menores, que en seguida habr de sealar), rigurosa,
convincente y bien documentada. El autor se muestra en todo momento muy bien
informado del ms reciente status quaestionis sobre cada uno de los puntos que va
tratando, a lo menos en lo que toca propiamente a la materia de su estudio. No puede
GHFLUVHWDQWRGHODEUHYH$SUR[LPDFLyQELRJUiILFD SS TXHSUHVHQWDFRPR
hechos ciertos algunas noticias ms bien dudosas: que Platn se llamaba Aristocles1,
el viaje a Egipto2. Otro reparo merece la utilizacin de las cartas supuestamente
platnicas: aunque el autor advierte que la autenticidad de las Cartas VII y VIII es
KR\PD\RULWDULDPHQWHDFHSWDGDSRUODFUtWLFD S QDGDGLFHGHODVVHULDVGXGDV
que siguen pesando sobre las otras, que cita como dndolas por genuinas. Con todo,
acierta este resumen biogrfico al poner de relieve el empeo poltico que Platn
mantuvo a lo largo de su vida, as como la finalidad esencialmente poltica de las
enseanzas de la Academia.
/DSULPHUDSDUWH +DFLDXQDIXQGDPHQWDFLyQHSLVWpPLFDGHODSROtWLFDSS
101) ofrece un cuidado estudio de los dilogos anteriores a la Repblica. A juicio
del autor, aparecen ya en la Apologa VL ELHQ GH IRUPD HPEULRQDULD ORV WHPDV
esenciales del pensamiento poltico de Platn: la crtica de la poltica ateniense y
del presunto saber de los hombres polticos; la contraposicin entre vida pblica y
privada; la vinculacin entre conocimiento y tica como fundamento del obrar poltico. Quiz convendra aadir que, para el Scrates de la Apologa, ese conocimiento
parece ser el (meramente negativo) saber que uno no sabe lo que no sabe (23b), que
HVODVDELGXUtDKXPDQD G 
En cuanto al Protgoras, quiz sea algo exagerado ver en este dilogo temprano
XQDDQWLFLSDFLyQGHOSULQFLSLRGHHVSHFLDOL]DFLyQGHODVIXQFLRQHVLQFOXLGDODGHOD
WpFQLFDSROtWLFDGHODRepblica (p. 60). Acerca de lo que cita Soares (p. 60 n. 76)
como muestras tempranas del desprecio de Platn por el juicio de la mayora (frente
al juicio superior del experto), es de notar que no se refieren a los procedimientos de
decisin poltica, sino a la eleccin moral (Crit. 48a), la educacin (Laq. 184e; Eutid.
307a-b), al conocimiento de la verdad (Hip. 284e) o a la indagacin dialctica misma
1
 9pDVH-$1RWRSRXORV7KH1DPHRI3ODWRCP 34 (1939), pp. 135-145, y A. Swift
Riginos, Platonica. The Anecdotes Concerning the Life and Writings of Plato, Leiden, 1976,
pp. 35-38.
2
Cf. Swift Riginos, PlatonicaSS/%ULVVRQ/(J\SWHGH3ODWRQLes tudes
Philosophiques, 1987, pp. 153-168, en las pp. 153-154, y sobre todo el minucioso examen
de las fuentes en H. Drrie, Der Platonismus in der Antike, vol. 2, Stuttgart-Bad Cannstatt,
1990, pp. 425-453.

Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

439

(Gor. 473e-474b), asuntos que poco se prestan a la votacin mayoritaria; y para la


declaracin, ciertamente poco democrtica, de Prot. 317a (los muchos no entienden
nada, slo corean lo que dicen los que mandan), convendra tener en cuenta que es,
ms bien sorprendentemente, Protgoras quien lo dice. Soares, empeado en hallar
\D HQ ORV GLiORJRV WHPSUDQRV HO HPEULyQ GHO SHQVDPLHQWR SROtWLFR PDGXUR GH
Platn (p. 101), me parece subestimar a veces la profundidad de la ruptura que separa
DO3ODWyQPDGXURGHODDFWLWXGVRFUiWLFDVLELHQDSURSyVLWRGHOMenn (100a1-2)
seala acertadamente (p. 97) el paso del cuestionamiento socrtico al ideal, ya propiamente platnico, de que la virtud llegue a ser alguna vez conocimiento en sentido
estricto y pueda ser enseada.
El anlisis de la Repblica /DPHWDSROtWLFDSODWyQLFDSS HVH[DFWR
y cuidadoso, aunque tal vez se poda haber prestado algo mayor atencin a la forma
dialgica del texto: por ejemplo, cuando el autor atribuye VLQ PiV D 3ODWyQ HO
FDOLILFDWLYR FLXGDG GH FHUGRV GH *ODXFyQ S   &UHH 3ODWyQ SRVLEOH OOHYDU D
la realidad la utopa de la Repblica? Soares juzga, razonablemente, que esa construccin cumple una funcin esencialmente regulativa: aunque sea irrealizable en los
mismos trminos de su formulacin terica, hay que aproximarse a su realizacin
dentro de lo posible.
La tercera parte (Del orden poltico ideal a la conservacin del mejor orden posiEOHSS DEDUFDHOPoltico y las Leyes. En el Poltico, Platn describe un
UpJLPHQSROtWLFRDOWHUQDWLYRIUHQWHDODDXVHQFLDGHORUGHQLGHDO S (OUpJLPHQ
ms perfecto sigue siendo el del filsofo-rey; slo a modo de mal menor o segunda
QDYHJDFLyQ VH DFHSWD HO GRPLQLR GH OD OH\ SHUR FRQ HVR VXUJHWDPELpQ XQD QXHYD
SUHJXQWDHQFXiOGHORVUHJtPHQHVLPSHUIHFWRVHVPHQRVGLItFLOYLYLU"$HVDSUHgunta responden las Leyes, con un proyecto poltico concebido en circunstancias ya
no ideales, sino reales. En conclusin, Platn mantiene siempre una firme voluntad
de elaboracin de un proyecto poltico alternativo que llegue alguna vez a consuPDUVH S GHDKtTXHHORUGHQLGHDOFHGDDODQRPRFUDFLDUpJLPHQTXHPiVVH
le aproxima entre los que son de inmediato posibles. Lo cual no equivale a oponer
LGHDOLVPRDUHDOLVPRQLKD\HQODRepblica una confianza ciega en el ideal, ni
el programa de las Leyes se reduce a un desesperanzado realismo; ms bien expresa
XQYLJRURVRSUR\HFWRRSWLPLVWD /LVL XQWpUPLQRPHGLRHQWUHORLGHDO\ORSRVLEOH
En conjunto, es una interpretacin sensata y aceptable, aunque tampoco es muy
original ni novedosa, ni pretende serlo. Soares no polemiza, no finge hiptesis, no
aventura comparaciones con las ideologas polticas de nuestro tiempo: todo lo cual
es de agradecer. En resumidas cuentas, el libro cumple plenamente su propsito de
ofrecer una introduccin general al pensamiento poltico de Platn, a la vez que una
bien documentada puesta al da de los estudios sobre el tema.
LUIS ANDRS BREDLOW
Universidad de Barcelona
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

440

RESEAS DE LIBROS

Barcel, Pedro (ed.), Religiser Fundamentalismus in der rmischen Kaiserzeit.


Postdamer Altertumswissenschaftliche Beitrge 29, Stuttgart, Franz Steiner
Verlag, 2010, 250 pp.
Contenidos: 1. J. Rpke, Radikale im ffentlichen Dienst. Status und IndividualiVLHUXQJ U|PLVFKHQ 3ULHVWHUQ UHSXEOLNDQLVFKHU =HLW  &KU .XQVW 'LH 3ULHVWHU GHU
.\EHOH-$OYDU+HQRWKHLVPXVXQG(VVHQWLDOLVPXVLQGHQ.XOWHQGHURULHQWDOLVFKHQ*|WWHU3+HU]*DEHVHLQHUHOLJL|VH*UXQGEHU]HXJXQJ"%(GHOPDQQ
:LHNRPPWGHU.DLVHU]XGHQ*|WWHUQ"3(LFK7KHLVPXVXQG)DQDWLVPXV
P. Barcel Fundametalistische Tendenzen in Heidentum und Christentum des vierten
-DKUKXQGHUWV  0 &ODXVV 'HU :HJ ]XU :DKUKHLW NRVWHW /HEHQ =XP IUKFKULVWOLFKHQ 6HOEVWYHUVWlQGQLV  -(Y +DIQHU 9RP /HKUKDXV ]XP /HKUDPW +lUHVLH
%HJULIIXQG*ODXEHQVUHJHODOV8UVSUQJHGHVFKULVWOLFKHQ)XQGDPHQWDOLVPXV%
Blum Die Unvereinbarkeit von Fundamentalismus und Christetum. Anmerkungen
DXV WKHRORJLVFKSUDNWLVFKHU 6LFKW  ( )DEHU $UPXW DOV ,GHDO 'HU )XQGDPHQWDOLVPXV GHU :RKOKDEHQGHQ $ /RW] 5HOLJLRVH ,QWROHUDQ] XQG *HZDOW LQ GHU
6SlWDQWLNH-+DKQ$XVJHPHU]WZHUGHQPXVVGHU,UUJODXEH=XU,GHRORJLHXQG
3UD[LVFKULVWOLFKHU*HZDOWJHJHQSDJDQH.XOWH

Este libro recoge las contribuciones presentadas los das 20-21 de octubre del 2008
en unas jornadas de la Universidad de Postdam sobre el fundamentalismo en poca
romana. Como indica el editor en el prlogo, el objetivo era plantearse, a raz de los
diversos sucesos considerados fundamentalistas que comenzaron el 11 de septiembre
del 2001, el concepto de fundamentalismo y sus caractersticas en la Antigedad con
la intencin de comprender sus orgenes y evolucin y evitar trivializar o confundir
conceptos y problemas. Tanto la diversidad de los temas tratados en el libro como la
diversidad de los enfoques, que hacen que el libro adolezca de falta de unidad y de
claridad en el objetivo, son en realidad la mejor expresin de las dificultades inherentes al concepto de fundamentalismo, de la variedad de sus formas, y de los problemas
que entraa la comparacin del fundamentalismo actual con el de poca romana. Sin
embargo hay a lo largo del libro una serie de elementos constantes o reincidentes que
sin duda aportan un mayor conocimiento de los aspectos centrales de este fenmeno.
En primer lugar destaca la relacin del fundamentalismo con el cristianismo en
poca imperial (se echa en falta al menos un captulo sobre el judasmo en relacin
con este tema). La mayor parte de los captulos tratan el tema en el enfrentamiento
cristiano-pagano o dentro del propio cristianismo. Los que lo hacen referido al mundo pagano muestran cmo los aspectos susceptibles de ser considerados fundamentalistas (desde un punto de vista a veces muy vago o discutible) estn motivados por
cuestiones de poder y poltica, no por contenido religioso (cf. los artculos de Rupke,
Kunst, Herz, Edelmann, Alvar). Los casos analizados en estos estudios motivan un
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

441

acercamiento al fenmeno del fundamentalismo desde lo que, siendo susceptible de


ser considerado fundamentalista, no lo es.
Algunos autores analizan otros fenmenos susceptibles de ser confundidos con
fundamentalismo y que por sus diferencias ayudan a concretar este concepto. El
henotesmo, el esencialismo, las religiones mistricas orientales (cf. Alvar, Eich) no
conllevan fundamentalismo porque no son religiones monotestas (cf. Eich frente a la
idea de algunos investigadores actuales sobre un monotesmo pagano) basadas en un
dogma y que intentan imponerse mediante la intolerancia hacia otras manifestaciones
religiosas. A su vez, las reacciones de marginacin o exclusin que a veces provocan
en la administracin romana no se deben a cuestiones de creencia sino polticas. Herz
reconoce la existencia de un convencimiento bsico religioso en el hombre no asociado a una creencia especial definida teolgicamente ni a un contexto cultural fijo,
un esencialismo que se encuentra en los ritos, prcticas y lugares religiosas, del que
hay buenas muestras en los cuentos populares, y que no conlleva fundamentalismo.
Cercano a la bsqueda de una definicin es el anlisis de Clauss sobre los elePHQWRVHQORVTXHVHIXQGDPHQWDHOIXQGDPHQWDOLVPRTXHUHGXFHDODRSRVLFLyQ
Verdad/Error. (cf. la importancia de la Verdad en el surgimiento de una secta nacida
en 1909 en Estados Unidos con una serie: The Fundamentals. A Testimony to the
Truth, de donde procede el trmino fundamentalista Edelmann, Blum). Un acercamiento similar al tema es el que propone Hafner, que establece el origen del fundamentalismo en el cristianismo de poca romana cuando en el siglo II d. C. este opta
por la versin dogmtica y radical de Ireneo en vez de por la filosfica y dialogante
de Justino. En esta oposicin se basan los casos ms claros de fundamentalismo, que
se producen significativamente dentro del propio cristianismo.
Es de destacar que los captulos del libro que claramente hablan de fundamentalismo son los que tratan casos relacionados con el cristianismo sobre todo en la
Antigedad tarda. En un captulo bastante terico, Barcel establece los orgenes
del fundamentalismo en poca postconstantina, en la que cuestiones por primera vez
de contenido religioso marcan la diferencia entre ortodoxia y hereja. El papel de
los ascetas como grupo fundamentalista se pone de relieve en los artculos de Faber,
Lotz y Hahn, aunque, mientras para Faber, que considera a los ascetas continuadores
de los antiguos mrtires, el fundamentalismo asceta es un tipo de fundamentalismo
basado en la renuncia de todo lo terrestre como expresin de fe, Lotz y Hahn destacan la violencia generada por este grupo, visible en el asesinato de Hipatia (Lotz), y
en la destruccin material del paganismo por parte de los ascetas del desierto sirio y
egipcio, fenmeno fundamentalista al que Hahn aade en la misma poca del imperio
tardo, tambin como fundamentalista, la imposicin religiosa a travs de la institucin jurdica como una forma muy clara de agresin. La idea de violencia como
elemento que subyace al fundamentalismo se recoge en el artculo de Edelmann
cuando se plantea si la imposicin del culto imperial como forma de expresin activa
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

442

RESEAS DE LIBROS

de la creencia en una verdad, la del emperador divinizado y apotesico, se realiza


recurriendo a la violencia, si del fundamento se pasa al fundamentalismo, planteamiento que segn este autor tiene diferentes respuestas en los autores antiguos. Esta
posibilidad de un fundamentalismo pagano se plantea tambin en el captulo de Eich,
que establece como base del fundamentalismo la existencia de libros que crean un
modelo, un canon, un dogma, tanto entre los paganos como entre los cristianos, y
que destaca la influencia de los filsofos paganos en la decisin de Diocleciano de
perseguir a los cristianos.
Como lnea central de su anlisis, los captulos de Lotz y Hahn destacan los
intereses personales o de grupo relacionados con el poder como fondo que subyace
a las manifestaciones de fundamentalismo. Este es, a mi juicio, el punto que da ms
unidad a todo el libro. Aunque solo en estos captulos se analice como tema central
la cuestin del fundamentalismo religioso relacionado con problemas polticos, esa
relacin est detrs de todos los casos de fundamentalismo analizados en el libro y
detrs del fundamentalismo actual que ha motivado el tema de las jornadas. Como
VHxDOD +HU] IXQGDPHQWDOLVPR HV DFWXDOPHQWH XQ WpUPLQR PX\ FDUJDGR SROtWLFDmente. Bajo un aparente fundamentalismo religioso se esconden otros muchos problemas e ideologas.
Un captulo aparte es el de Blum sobre la incompatibilidad del cristianismo con
el fundamentalismo, que pretende demostrar que el fundamentalismo est en el tratamiento de diversas religiones cristianas en determinados momentos, no en la doctrina cristiana, completamente alejada del fundamentalismo al promulgar la libertad
y diversidad. La particularidad del planteamiento de este captulo es en s misma un
acercamiento a la definicin de fundamentalismo Puede decirse realmente que un
dogma religioso se presenta a s mismo desde su nacimiento como fundamentalista?
O hay que decir ms bien que fundamentalismo es el comportamiento social, poltico, econmico etc., que se apoya y justifica mediante un dogma religioso?
Los diversos aspectos recurrentes en el libro aparecen aunados o en parte en las
definiciones de fundamentalismo proporcionadas por algunos autores, aunque hay
variaciones de grado. Segn Barcel, por fundamentalismo se entiende la primaca
de una religin, exenta de cualquier tipo de discusin crtica, sobre el comportamiento poltico, econmico y social. Segn Lotz, los fundamentalistas se consideran
una minora elitista enfrentada a una masa enemiga, su ideal es una teocracia donde
iglesia y estado coincidan. El extremo del fundamentalismo religioso se da cuando se
produce intolerancia respecto a creyentes de otras religiones, manifestada en violencia contra objetos cultuales, lugares sagrados o personas. Los movimientos agresores
se deben no solo a diferencias religiosas, sino a problemas en el proceso de cambio
en la cultura, organizacin social y vida econmica, y son importantes las motivaciones personales o grupales de aquellos que promueven la intolerancia. Segn Faber,
el fundamentalismo tal y como se entiende hoy da es el que por medios violentos y
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

443

fanticamente propaga la imposicin general, obligatoria y completa de sus propios


objetivos. La base del fundamentalismo en un libro sagrado o dogma es destacada
por Clauss, Alvar y Eich. Cf. la definicin de Lactancio (Inst.div. 4.28.11; 16) citada
por Edelmann: Religin es la adoracin de aquello que es verdad, y supersticin de
lo que es falso ... supersticiosos son por tanto aquellos que adoran a muchos y falsos
GLRVHVUHOLJLRVRVVRPRVQRVRWURVTXHDGRUDPRVDO~QLFR\YHUGDGHURGLRV+DKQ
presenta el fundamentalismo como destruccin de las tradiciones, valores e identiGDGGHORVGHPiVIUDVHTXHH[SOLFDQRVRORORVFDVRVGHIXQGDPHQWDOLVPRFULVWLDQR
frente al pagano, sino tambin el supuesto fundamentalismo del gobierno romano
cuando no acepta las nuevas religiones llegadas de Oriente o cuando las adapta como
instrumento del poder poltico. Podra decirse que la poltica cultual romana es en
este sentido una defensa contra el fundamentalismo, motivada por el miedo a perder
las tradiciones, valores e identidad romanas, un miedo que al final result justificado
con la imposicin del cristianismo, en muchos casos de manera violenta? Esto nos
llevara a otra cuestin no planteada en este libro pero que servira igualmente para
entender el fundamentalismo actual El fundamentalismo puede nacer como defensa,
como miedo a perder las tradiciones, valores e identidad?
A pesar de la falta de un hilo conductor claro, este libro ofrece respuestas abundantes y variadas a los muy diversos aspectos que entraa el fundamentalismo, y, en
muchos casos con la propia disparidad de opiniones, plantea preguntas importantes
que aun no tienen una respuesta unnime Hay realmente casos de fundamentalismo pagano?, el fundamentalismo va siempre unido a la intolerancia y la agresin?
Quiz la respuesta ms clara a las muchas preguntas planteadas sea que no existe
un fundamentalismo estrictamente religioso, esto es, no condicionado por cuestiones
polticas, sociales o econmicas.
MARA PAZ DE HOZ GARCA-BELLIDO
Universidad de Salamanca

Barnes, Timothy, Constantine: Dynasty, Religion and Power in the Later Roman
Empire, Chichester, Wiley-Blackwell, 2011, xiv + 266 pp.
/D QRYHQD PRQRJUDItD GH OD VHULH %ODFNZHOO $QFLHQW /LYHV HV HVWH QRYHGRVR
trabajo sobre el emperador Constantino, escrito brillantemente por Timothy Barnes,
emrito de Clsicas de la Universidad de Toronto. El profesor britnico ha propuesto, a lo largo de ms cuarenta aos de investigacin, controvertidas revisiones sobre
la Antigedad tarda basadas siempre en el meticuloso anlisis de las fuentes. Un
ejemplo expresivo es su Athanasius and Constantius: Theology and Politics in the
Constantinian Empire (Cambridge, Mass.-Londres, Harvard University Press, 1993),
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

444

RESEAS DE LIBROS

en el que ofrece una slida y poco hagiogrfica reconstruccin de la carrera del santo
obispo de Alejandra.
En su ltimo libro Barnes vuelve a la interpretacin del emperador Constantino,
que ya haba abordado en una de sus primeras obras (Constantine and Eusebius,
Cambridge, Mass.-Londres, Harvard University Press, 1981): de acuerdo con su
anlisis, Constantino no habra puesto en prctica una poltica de tolerancia religiosa, sino de agresivo fomento del cristianismo. En el trabajo que nos ocupa, la
argumentacin cobra mayor peso gracias al descubrimiento reciente de Kevin WilNLQVRQ 3DOODGDVDQGWKH$JHRI&RQVWDQWLQHJournal of Roman Studies 99 [2009],
pp. 36-60) relativo a la datacin de los epigramas de Pladas, que la crtica considera
generalmente obra de un pagano que deplora la irrupcin del cristianismo. El descubrimiento por parte de Wilkinson de fragmentos de este epigramatista en un papiro
de la primera mitad del siglo IV (Biblioteca de la Universidad de Yale) supone adelantar la datacin de los epigramas de Pladas, anteriormente asignados al imperio
de Teodosio (379-395), al imperio de Constantino (306-337). Cuando escribo estas
lneas est todava pendiente de publicacin la obra en la que, segn informa Barnes
(pp. 13-16), Wilkinson presentar la edicin y comentario de dichos fragmentos.
El grueso de la obra consta de ocho captulos y siete apndices (pp. 1-200). Lo
novedoso de sus contenidos requiere un resumen un tanto pormenorizado.
(O SULPHU FDStWXOR ,QWURGXFWLRQ SS   HQXPHUD YDULDV GH ODV PHQWLUDV
RILFLDOHVHPLWLGDVSRUHODSDUDWRSURSDJDQGtVWLFRGH&RQVWDQWLQRTXHWRGDYtDKR\
de acuerdo con el autor, engaan a buena parte de la crtica. Barnes trata aqu tambin
de las fuentes principales en las que basa su reconstruccin de la vida de Constantino: Sobre las muertes de los perseguidores de Lactancio, la Vida de Constantino de
Eusebio de Cesarea y los mencionados epigramas de Pladas, adems de la documentacin conservada en el Cdigo Teodosiano.
(OVHJXQGRFDStWXOR 7KH6ROGLHUDQGWKH6WDEOH*LUOSS VHRFXSDGHO
nacimiento y de los padres de Constantino. Barnes concluye que el emperador naci
el 27 de febrero del ao 273, a partir de la combinacin de los datos de la carrera militar de su padre, Constancio, con el dato de su lugar de nacimiento (Naissus, actual
Ni, en Serbia). El razonamiento lo lleva a abordar tambin la cuestin del estatus
social de Helena, la madre de Constantino, a quien Ambrosio llama stabularia, as
como la debatida cuestin de si los padres del emperador contrajeron matrimonio
legal o no, las segundas nupcias de Constancio con Teodora (hija del augusto Maximiano), la poco documentada vida posterior de Helena y la conversin de sta al
cristianismo.
En el tercer captulo (Contantine, the Ruins of Babylon and the Court of PhaUDRK SS   HO DXWRU DQDOL]D OD SRVLFLyQ GH &RQVWDQWLQR HQ OD WHWUDUTXtD GLRcleciana, de la que formaba parte su padre Constancio (como csar del augusto
Maximiano en Occidente, mientras que en Oriente era augusto Diocleciano y csar
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

445

Galerio). Barnes infiere convincentemente que Constantino particip en las campaas del csar Galerio antes del ao 305; asimismo, plantea la sugerente hiptesis de
que la primera esposa de Constantino pudiera ser hija o pariente muy cercana de
Diocleciano. Ambos hechos subrayan la estrecha vinculacin de Constantino con
la corte de Diocleciano, una vinculacin que posteriormente el emperador cristiano
KDEUtDLQWHQWDGRRVFXUHFHU(QHVWHFRQWH[WR%DUQHVSUHVHQWDODJUDQSHUVHFXFLyQ
ordenada a finales de febrero del ao 303, como parte de una maniobra de Galerio
para dejar fuera de la sucesin a Constantino y Majencio, favorables ambos al cristianismo. Esta religin, como recuerda el autor, ya gozaba de pleno reconocimiento
legal desde el ao 260 bajo el emperador Galieno.
(OUHVWRGHOFDStWXOR\HOVLJXLHQWH 7KH5RDGWR5RPHSS VHRFXSDQ
GHOJROSHGLQiVWLFRGH*DOHULRHQODSURFODPDFLyQGH&RQVWDQWLQRFRPRDXgusto en York a la muerte de su padre en 306 y la guerra civil que sigui (306-313)
entre Severo, Galerio, Maximiano, Majencio, Maximino, Licinio y el propio Constantino. Entre otras cuestiones, Barnes subraya cmo la propaganda constantiniana
convirti al usurpador Majencio en el prototipo de perseguidor tirnico, pese a que de
hecho haba puesto en prctica en sus territorios (Italia y frica) una poltica de tolerancia a los cristianos al mismo tiempo que Constantino en los suyos (Britania, Galia
H+LVSDQLD 7DPELpQHQHVWHFDStWXORVHDERUGDODFpOHEUHYLVLyQGH&RQVWDQWLQR
que se produjo en 310 en una batalla contra Maximiano y a la que el emperador no
dara una interpretacin cristiana hasta dos aos despus, a raz de un sueo antes de
la clebre batalla del puente Milvio (312). El autor insiste en distinguir claramente
las dos ocasiones, a menudo confundidas, e interpreta como un halo solar la cruz
en el cielo vista por Constantino y por todo su ejrcito en el ao 310; en ello sigue
expresamente a Peter Weiss, cuya teora, segn denuncia Barnes, fue acogida en su
momento con inmerecida frialdad.
(O TXLQWR FDStWXOR %URWKHUVLQ/DZ SS   VH DEUH FRQ ORV DFXHUGRV
tomados por Constantino y Licinio en Miln en febrero de 313, cuando ambos
sellaron su alianza contra Maximino, quien an tena bajo su control Asia Menor,
6LULD \ (JLSWR %DUQHV QLHJD FRQ pQIDVLV TXH VH SURPXOJDUD XQ HGLFWR GH 0LOiQ
simplemente, Licinio acord con Constantino extender a sus territorios (los Balcanes
y Grecia) la libertad de culto para los cristianos y la restauracin de sus propiedades
FRQILVFDGDVGXUDQWHODJUDQSHUVHFXFLyQXQRVEHQHILFLRVGHORVTXH\DGLVIUXWDEDQ
los sbditos cristianos de Constantino en Occidente desde 306, y que tambin habran
de extenderse a los habitantes cristianos de los territorios de Maximino una vez derrotado ste. Barnes recuerda que la inexistencia de un edicto de Miln ya fue seaODGDSRU2WWR6HHFNHQ\HVFULEHTXHHOORVXSRQHXQWULVWHFRPHQWDULRVREUH
la crtica constantiniana posterior (p. 95). A continuacin se ocupa de la siguiente
guerra con Licinio, en realidad dos guerras breves (316 y 324), que se explican en
relacin directa con las ambiciones dinsticas de Constantino.
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

446

RESEAS DE LIBROS

(O FDStWXOR VH[WR 7KH 7UDQVIRUPDWLRQ RI WKH (DVW SS   DERUGD ODV
medidas tomadas por Constantino en Oriente tras derrotar a Licinio. Dado que gobernaba como nico seor del imperio romano, la poltica religiosa de Constantino
en Oriente fue, segn propone Barnes, mucho ms agresiva de lo que haba sido en
Occidente. Se enumeran once medidas legales destinadas a favorecer al cristianismo,
desde la concesin de privilegios a obispos y clrigos hasta la restriccin del divorcio
y la promulgacin de leyes hostiles a los judos.
En este contexto se enmarca la trascendental fundacin de Constantinopla, que
Constantino concibi como una ciudad plenamente cristiana. Para su ubicacin escogi la de la antigua Bizancio: esta ciudad, segn una nueva y convincente hiptesis
de Barnes, habra sido fortificada en tiempos recientes por Licinio; Constantino la
destruy hasta los cimientos para edificar sobre ella su nueva capital.
El emperador tom parte activa en la poltica eclesistica oriental: presidi el
Concilio de Nicea (verano de 325) y probablemente fue su sugerencia directa la que
motiv las decisiones de dicho concilio referentes a la celebracin de la Pascua. Se
defiende la autenticidad del Discurso ante la asamblea de los santos (conservado al
final de la Vida de Constantino de Eusebio) y se propone para su pronunciacin real
la Pascua del ao 325, en Nicomedia. Al final del captulo se sealan las dificultades
que encuentra el historiador a la hora de narrar los hechos eclesisticos siguientes
al Concilio de Nicea y determinar el papel desempeado en ellos por el emperador:
estas dificultades se deben a la escasez de fuentes (se conserva muy poco aparte de la
narrativa interesada de Atanasio de Alejandra) y a prejuicios ideolgicos (suficientes
LQGLFLRVDSXQWDQDTXH&RQVWDQWLQRHUDDUULDQR 
(O VpSWLPR \ ~OWLPR FDStWXOR '\QDVWLF 3ROLWLFV DIWHU WKH &RXQFLO RI 1LFDHD
pp. 144-172) se ocupa en primer lugar de la muerte violenta de Crispo, el hijo mayor
de Constantino (hijo de su primera esposa), y de Fausta, la mujer del emperador,
acaecidas las dos en 326. Barnes construye cuidadosamente una sugerente hiptesis
segn la cual Crispo habra sido ejecutado por alta traicin, debido a una acusacin
falsa emitida o apoyada por Fausta, quien se habra suicidado al descubrir Constantino el engao poco despus. En estos momentos se produjo la famosa peregrinacin
a Tierra Santa de Helena, que Barnes no duda en considerar una maniobra de su hijo
Constantino para desviar la atencin del escndalo.
En un intento por restablecer el sistema tetrrquico, Constantino nombr csares
a los tres hijos que haba tenido con Fausta (Constantino II, Constancio y Constante) y a Dalmacio, hijo de Flavio Dalmacio (su hermano por parte de padre). Pero
le sorprendi la muerte sin haber nombrado augusto a ninguno de ellos, en el ao
337, cuando se encontraba sumido en los preparativos para una inminente invasin
de Persia. Debido a esta falta de previsin, la sucesin no pudo producirse de forma
SDFtILFD&RQVWDQFLRWRPyODLQLFLDWLYDHQHOYHUDQRGHVDQJUHGHTXHGHMyD
los tres hijos de Fausta como nicos herederos del imperio.
Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

RESEAS DE LIBROS

447

8QEUHYHHStORJRSUHVHQWDGRFRPRFDStWXORRFWDYR (SLORJXHSS 
ofrece un til resumen de la carrera de Constantino segn la reconstruccin expuesta.
Siguen siete apndices (pp. 176-200): una reconstruccin de la carrera de Lactancio;
una cronologa de las victorias de Galerio en Sarmacia; unas observaciones sobre la
relacin entre los Doce panegricos latinos y Constantino; una traduccin inglesa del
texto Sobre la Pascua de Eusebio de Cesarea; unas observaciones sobre un ateniense
de la aristocracia pagana que goz del favor de Constantino (Nicgoras) y sobre otro
aristcrata ateniense (Praxgoras) que escribi una historia panegrica del emperador,
y finalmente el anlisis de un panegrico griego fragmentario, que Barnes considera
dirigido a Constantino en desacuerdo con el editor del texto, que lo considera dirigido a Juliano (Augusto Guida, Un anonimo panegirico per limperatore Giuliano,
Florencia, Olschki, 1990). En las sesenta y seis pginas finales se encuentran las
abundantes notas (pp. 201-225), la copiosa bibliografa citada (pp. 226-253) y un
ndice general selectivo (pp. 254-266).
El tono de Barnes es caractersticamente tajante. El libro se abre con una cita
GH /XFLDQR /D ~QLFD WDUHD GHO KLVWRULDGRU HV GHFLU FyPR RFXUULy Cmo debe
escribirse la historia, 39), y a modo de conclusin se lee un prrafo que resume
perfectamente el espritu de la obra (p. 175):
Modern historians of the fourth century have too often interpreted the ancient evidence
for Constantine and his age on the basis of anachronistic assumptions and misconceptions, and they have too often denied the validity or distorted the meaning of ancient
evidence that has not conformed to their own predilections. In this book I have tried
to set the record straight.

El texto se desarrolla con agilidad y se lee con placer. La solidez de la argumentacin descansa sobre un minucioso anlisis de las fuentes primarias, a las que el
autor se refiere con admirable profusin. Como corresponde al rigor filolgico, la
referencia a los textos antiguos es continua y estos constituyen la base sobre la que
se desarrolla el discurso; los datos epigrficos y arqueolgicos se utilizan de forma
subordinada a las fuentes literarias.
Las referencias bibliogrficas son exhaustivas y su discusin se incorpora hbilmente en el propio texto. Podra juzgarse que el lenguaje de Barnes es excesivamente duro a la hora de criticar el trabajo de otros estudiosos (as me parece en
particular en alguna ocasin en la que lo censurado no es estrictamente acadmico,
como en la p. 74). En todo caso, sin duda, lo extraordinariamente exigente y riguroso de su propio trabajo le otorga el derecho de juzgar con exigencia el trabajo
de otros.
De las compactas doscientas pginas de texto apenas se encuentra una sola que
no contenga una propuesta de interpretacin iluminadora y bien fundada; cada una de
ellas es una elocuente muestra del mejor rigor cientfico. El ltimo libro del profesor
Emerita LXXX 2, 2012, pp. 411-448

ISSN 0013-6662

448

RESEAS DE LIBROS

Timothy Barnes supone una contribucin mayor a los estudios de Antigedad tarda;
su lectura es inexcusable para los especialistas, muy recomendable para cualquier
persona interesada en el mundo antiguo y muy instructiva para cualquier investigador
en ciencias humanas.
PABLO TORIBIO PREZ
CSIC

Emerita LXXX 2, 2012, pp.

411-448

ISSN 0013-6662

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 1, 2012, pp. 449-450
ISSN 0013-6662

Relacin de libros recibidos


durante el segundo semestre de

2012

ANGLADA ANFRUNS, NGEL, In Paciani episcopi barcinonensis opera silva studiorum.


Instrumena Patristica et Mediaevalia 52, Turnhout, Brepols, 2012, 477 pp.
ANGLADA ANFRUNS, NGEL, Paciani Barcinonensis. Opera quae extant, Corpus
Christianorum Series Latina LXIX B, Turnhout, Brepols, 2012, LIX + 171 pp.
ARISTTELES, Acerca del alma. De anima. Traduccin, notas, prlogo e introduccin:
Marcelo D. Boeri, Buenos Aires, Colihue, 2010, CCXXXIV + 183 pp.
BIVILLE, FRDRIQUE, LHOMM, MARIE-KARINE Y VALLAT, DANIEL, Latin vulgaire Latin tardif IX. Actes du IXe colloque international sur le latin vulgaire et tardif.
Lyon, 2-6 septembre 2009&ROOHFWLRQGHOD0DLVRQGHO2ULHQWHWGHOD0pGLWHUUDQpH6pULHOLQJXLVWLTXHHWSKLORORJLTXH/\RQ0DLVRQGHO
2ULHQWHW
GHOD0pGLWHUUDQpHSS
CERRA, GABRIELA, Linguistic Questions in Cicero's Poetic Translations, Baha Blanca, Editorial de la Universidad Nacional del Sur, 2009, 262 pp.
CITRONI, MARIO (ed.), Letteratura e civitas. Transizioni dalla Repubblica all'Impero.
In ricordo di Emanuele Narducci, Testi e studi di cultura classica 53, Pisa,
Edizioni ETS, 2012, 454 pp.
DENIZOT, CAMILLE Y DUPRAZ, EMMANUEL (eds.), Anaphore et anaphoriques: varits
des langues, varit des emplois&DKLHUVGHO
(5,$&02QW6DLQW$LJQDQ
3XEOLFDWLRQVGHV8QLYHUVLWpVGH5RXHQHWGX+DYUHSS
DIGENES LAERCIO, Vidas y opiniones de los filsofos ilustres. Traducidas y comentaGDVSRU/XLV$QGUpV%UHGORZ=DPRUD/XFLQDSS
FERNNDEZ MARCOS, NATALIO, Filologa bblica y humanismo, Madrid, CSIC, 2012,
413 pp.
FRASSINETTI, PAOLO, Pagine sull'Octavia%LEOLRJUDILDGHOO
DXWRUHDFXUDGL/XFLD'L
Salvo, Genova, Tilgher-Genova, 2012, 114 pp.
HIDALGO DE LA VEGA, MARA JOS, Las emperatrices romanas. Sueos de prpura y
poder oculto, Salamanca, Ediciones Universidad de Salamanca, 2012, 238 pp.
HOWIE, J.GORDON, Exemplum and Myth, Criticism and Creation. Papers on Early
Greek Literature, Collected Classical Papers 3, Prenton, Francis Cairns, 2012,
XVIII + 443 pp.
LUQUE MORENO, JESS, Horacio lrico. Notas de clase, Granada, Universidad de Granada, 2012, XCI + 203 pp.

450

5(/$&,1'(/,%5265(&,%,'26

MARTNEZ, JAVIER (ed.), Mundus vult decipi. Estudios interdisciplinares sobre falsificacin textual y literaria, Madrid, Ediciones Clsicas, 2012, 442 pp.
NIETO IBEZ, JESS M. (coord.), Pedro de Valencia. Obras completas VI. Escritos
varios&ROHFFLyQ+XPDQLVWDVHVSDxROHV/HyQ8QLYHUVLGDGGH/HyQ
661 pp.
PIERO, ANTONIO Y CERRO, GONZALO DEL, Hechos Apcrifos de los Apstoles. III,
Biblioteca de Autores Cristianos, Madrid, Biblioteca de Autores Cristianos,
2011, XX + 1223 pp.
PUBLIO VIRGILIO MARONE, Le Bucoliche. Introduzione e commento di Andrea Cucchiarelli. Traduzione di Alfonso Traina, Roma, Carocci editore, 2012, 533 pp.
SALANITRO, MARIA, L'arguzia di Marziale, Urbino, QuattroVenti, 2011, 322 pp.
SNCHEZ DE LA TORRE, NGEL, Hesodo (siglo VIII a.C.), Biblioteca filosfica 145,
0DGULG(GLFLRQHVGHO2UWRSS
SNCHEZ DE LA TORRE, NGEL, Hesodo: caos y cosmos, Madrid, Ediciones Clsicas,
2012, 438 pp.
SUREZ MARTNEZ, PEDRO MANUEL, Catgories gramaticales, systmes grammaticaux
et autres questions de linguistique $OWHUWXPVZLVVHQVFKDIWOLFKH7H[WH XQG 6WXGLHQ  +LOGHVKHLP=~ULFK1XHYD <RUN *HRUJ 2OPV 9HUODJ  ;;,9 
433 pp.

Emerita LXXX 2, 2012, pp. 449-450

ISSN 0013-6662

EMERITA, Revista de Lingstica y Filologa Clsica


LXXX 2, 2012, pp. 451-455
ISSN 0013-6662

NDICE DEL TOMO LXXX (2012)

Pgs.

ARTCULOS
FRANCISCO R. ADRADOS: Teatros griego antiguo e indio: su origen en danzas corales que miman antiguos mitos
Ancient Greek and Indian theatres: their origin in choral dances, which represent myths by means of an old mimesis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

1-12

JAVIER AGUIRRE: La crtica de Aristteles y Teofrasto a la concepcin gnea


del ojo
Aristotles and Theophrastus critique to the igneous conception of the eye . .

89-106

MARCOS CARMIGNANI: Ille quidem totam gemebundus obambulat Aetnen: el


Cclope ovidiano como inspiracin pardica en Petronio, Sat. 100.3-5
Ille quidem totam gemebundus obambulat Aetnen: Parodic allusions to Ovidian Cyclops in Petronius, Sat. 100.3-5. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

355-370

LUZ CONTI/RVDGYHUELRVFRQMXQWLYRVHQJULHJRDQWLJXR$QiOLVLVGH
en Homero, Platn y Jenofonte
7KH FRQMXQFWLYH DGYHUEV LQ DQFLHQW *UHHN DQDO\VLV RI  LQ +RPHU 3ODWR
and Xenophon. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

45-68

SYLVAIN JEAN GABRIEL SANCHEZ: Les priscillianistes ou les autres Gnostiques


Priscillianists or the other Gnostics
Los priscilianistas o los otros gnsticos . . . . . . . . . . . . . . . . . . . . . . . . . . . .

125-148

M. P. GARCA RUIZ 6LJQLILFDGR GH   HQ HO Encomio a


Eusebia de Juliano
 LQ-XOLDQVPanegyric in honour to Eusebia, a depiction in
context . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

69-87

PILAR GMEZ: El aprendiz de rapsoda, o de cuando Homero cruz la laguQD(VWLJLD /XFLDQXVCont


7KHUKDSVRGHDSSUHQWLFHRUDV+RPHUFURVVHGWKH6W\[ /XFLDQXVCont. .

13-29

452

1',&( '(/ 7202 /;;; 

Pgs.

CARLOS JORDN CLERA: La interpretacin morfolgica de la tsera celtibrica K.0.6 y los derivados de temas en nasal en celtibrico
The morphological interpretation of the Celtiberian tessera K.0.6 and the nasal
stem derivatives in Celtiberian language . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

31-43

JUAN LUIS LPEZ CRUCES: Crcidas y la Antope de Eurpides


Cercidas and Euripides Antiope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

275-294

JULIN MNDEZ DOSUNA: 6REUHHOVLJQLILFDGRGHHQTLocri 15.15:


qu es la pez spera?
$ERXWWKHPHDQLQJRILQ7/RFULZKDWLVURXJKSLWFK" . . . . .

245-256

JANA MIKULOV: Ablativo de gerundio anterior en la Crnica mozrabe


Anterior ablative gerunds in the Mozarabic Chronicle . . . . . . . . . . . . . . . . . . .

371-385

VIRGINIA MUOZ LLAMOSAS: Y busqu su alma como a mi otro yo: Comentarios a Himerio 10. 86-90
And I searched for his soul as my alter ego: On Himerius 10.86-90. . . . . .

321-339

JOAN PAGS CEBRIN: Brireo-Egen: notas a Ilada I 401-406


Briareus-Aigaion: notes to Iliad I 401-406 . . . . . . . . . . . . . . . . . . . . . . . . . . . .

107-123

MARCOS ANTONIO PREZ ALONSO: Fusin de estilo directo e indirecto en la


transmisin de doctrina en el Ars grammatica de Carisio
Direct and indirect speech fusion in Charisius Ars Grammatica . . . . . . . . . . .

149-170

MILAGROS QUIJADA SAGREDO: Intriga cmica versus intriga trgica en Tesmoforiantes de Aristfanes
Comic intrigue versus tragic intrigue in Aristophanes Thesmophoriazousae .

257-294

KRZYSZTOF RZEPKOWSKI: Isidore of Seville and comici ueteres. Ad Isid.,


Orig. VIII 7.7
Isidoro de Sevilla y los comici ueteres. Ad Isid., Orig. VIII 7.7 . . . . . . . . . . .

341-353

TOM VTEK: +HUDFOLWXV'.% IUJ0DUFRYLFK


+HUiFOLWR'.% IUJ0DUFRYLFK . . . . . . . . . . . . . . . . . . . . . . . . . .

NOTAS

295-320

E INFORMACIN

SARA MACAS OTERO: Dioniso y el vino en el Cclope de Eurpides


Dionysus and wine in Euripides Cyclops . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

401-410

ANTONIO RO TORRES-MURCIANO: El canto de Quirn y el ethos de la msica. A propsito de Silio Itlico XI 453-458
The song of Chiron and the ethos of music. Note on Silius Italicus XI 453458 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Emerita LXXX 2, 2012, pp. 451-455

387-399

ISSN 0013-6662

453

1',&( '(/ 7202 /;;; 

Pgs.

CSAR SIERRA MARTN: Notas sobre Temstocles en Naxos


Notes on Themistocles at Naxos . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

179-190

CLIFFORD WEBER: Discrepancy by Design in Virg., Aen. VI 562-600


Discrepancia ex profeso en Virg., Aen. VI 562-600 . . . . . . . . . . . . . . . . . . . . .

RESEA

171-178

DE LIBROS

AELIANUS, De Natura Animalium. Ediderunt M. Garca Valds, L. A. Llera


)XH\R/5RGUtJXH]1RULHJD*XLOOpQ GIUSEPPE GIANGRANDE . . . . . .

191-195

BARCEL, PEDRO HG  Religiser Fundamentalismus in der rmischen


Kaiserzeit MARA PAZ DE HOZ GARCA-BELLIDO . . . . . . . . . . . . . . . . . .

440-443

BARNES, TIMOTHY, Constantine: Dynasty, Religion and Power in the Later


Roman Empire PABLO TORIBIO PREZ). . . . . . . . . . . . . . . . . . . . . . . . . .

443-448

BERNAB, ALBERTO, Manual de crtica textual y edicin de textos griegos


NGEL ESCOBAR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

202-204

CALLIMACO, Aitia, libro terzo e quarto MAXIMO

..............

195-198

CASALI, SERGIO y STOK, FABIO HGV  Servio: stratificazioni esegetiche e


modelli culturali / Servius: Exegetical Stratifications and Cultural
Models JUAN A. ESTVEZ SOLA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

428-431

CUARTERO I IBORRA, FRANCESC J., Pseudo-Apollodor. Bibliotheca. I; PAPATHOMOPOULUS, MANOLIS, Apollodori Bibliotheca post Richard Wagnerum recognita JOS B. TORRES). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

199-202

DE HOZ, JAVIER, Historia lingstica de la Pennsula Ibrica en la Antigedad. I. Preliminares y mundo meridional prerromano JOS ANTONIO
CORREA RODRGUEZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

206-209

DENIZOT, CAMILLE, Donner des ordres en grec ancien: tude linguistique


des formes de linjonction M. DOLORES JIMNEZ LPEZ . . . . . . . . . . .

418-422

DPP, SIEGMAR, Eva und die Schlange. Die Sndenfallschilderung des


Epikers Avitus im Rahmen der bibelexegetischen Tradition ROSARIO
MORENO SOLDEVILA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

431-433

HERRERO DE JUREGUI, MIGUEL, JIMNEZ SAN CRISTBAL, ANA ISABEL, LUJN


MARTNEZ, EUGENIO, MARTN HERNNDEZ, RAQUEL, SANTAMARA LVAREZ, MARCO ANTONIO y TORALLAS TOVAR, SOFA HGV  Tracing Orpheus: Studies in Orphic Fragments. In Honour of Alberto Bernab
FRANCISCO DIEZ DE VELASCO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

233-235

Emerita LXXX 2, 2012, pp. 451-455

BRIOSO)

ISSN 0013-6662

454

1',&( '(/ 7202 /;;; 

Pgs.

Historia de los monjes egipcios. D. ROMERO GONZLEZ e I. MUOZ GALLARTE WUDGV  MARA JESS ALBARRN MARTNEZ . . . . . . . . . . . . . . . . . . .

239-241

IGLESIAS ZOIDO, JUAN CARLOS, El libro en Grecia y Roma. Soportes y formatos CARMEN GARCA BUENO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

235-236

KNOEPFLER, DENIS, La Patrie de Narcisse (LUIS ALBERTO DE CUENCA) . . . .

436-437

LANGSLOW, DAVID Y MAIRE, BRIGITTE (EDS.), Body, Disease and Treatment


in a Changing World. Latin texts and contexts in ancient and medieval
medicine (MATILDE CONDE). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

433-435

MANZANO VENTURA, M. VICTORIA, Los discursos de exhortacin militar en


la Farsalia de Lucano ANTONIO RO TORRES-MURCIANO . . . . . . . . . . .

426-428

MORZADEC, FRANOISE, Les Images du Monde. Structure, criture et esthtique du paysage dans les uvres de Stace et Silius Italicus ANTONIO
RO TORRES-MURCIANO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

226-228

MOUTSOPOULOS, EVNGELOS Y PROTOPAPAS-MARNELI, MARIA (EDS.), 


7KH1RWLRQRI&LWL]HQVKLS
in Ancient Greek Philosophy INS CALERO SECALL . . . . . . . . . . . . . . . 216-219
NIETO IBEZ, JESS M., Cristianismo y profecas de Apolo: Los orculos
paganos en la Patrstica griega (siglos II-V) MIGUEL HERRERO DE
JUREGUI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

237-238

PAGANO, V., LAndromeda di Euripide SARA MACAS . . . . . . . . . . . . . . . .

414-416

RAMOS JURADO, ENRIQUE NGEL HG Cuatro estudios sobre exgesis mtica, mitografa y novela griegas MARA PAZ LPEZ MARTNEZ . . . . .

220-222

RIEDLBERGER, PETER, Philologischer, historischer und liturgischer Kommentar zum 8. Buch der Johannis des Goripp nebst kritischer Edition
und bersetzung LUIS ALBERTO DE CUENCA . . . . . . . . . . . . . . . . . . . . .

205-206

ROTSTEIN, ANDREA, The Idea of Iambos FRANCISCO R. ADRADOS . . . . . . .

425-426

RUIZ DARASSE, COLINE y LUJN, EUGENIO5 HGV Contacts linguistiques


dans lOccident Mditerranen antique JOS A. CORREA . . . . . . . . . .

423-425

SALEMME, CARMELO, Le possibilit del reale. Lucrezio, De rerum natura 6,


96-534 RODRIGO VERANO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

223-226

Simonides lyricus. Testimonia und Fragmente. Einleitung, kritische Ausgabe,


bersetzung und Kommentar von ORLANDO POLTERA HELENA RODRGUEZ
SOMOLINOS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

411-414

Emerita LXXX 2, 2012, pp. 451-455

ISSN 0013-6662

455

1',&( '(/ 7202 /;;; 

Pgs.

SMOLENAARS, J. J. L, VAN DAM, H.-J. Y NAUTA, R. R. HGV The Poetry of


Statius CECILIA CRIADO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

228-232

SOARES, LUCAS, Platn y la poltica (LUIS ANDRS BREDLOW). . . . . . . . . . .

437-439

SPEVAK, OLGA, Constituent Order in Classical Latin Prose CONCEPCIN


CABRILLANA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

209-214

VALCRCEL MARTNEZ, VITALINO HG Las biografas griega y latina como


gnero literario. De la Antigedad al Renacimiento. Algunas calas
FRANCISCO R. ADRADOS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

215-216

, 
 PEDRO REDONDO REYES . . . 416-418

Emerita LXXX 2, 2012, pp. 451-455

ISSN 0013-6662

NORMAS DE PRESENTACIN DE ORIGINALES

Los originales de la revista EMERITA, publicados en papel y en versin electrnica, son


propiedad del Consejo Superior de Investigaciones Cientficas, siendo necesario citar la
procedencia en cualquier reproduccin total o parcial.
Los artculos podrn remitirse a la redaccin de EMERITA por correo electrnico
(emerita.cchs@cchs.csic.es) o por correo postal (Jos A. Berenguer, EMERITA, Revista
de Lingstica y Filologa Clsica, Centro de Ciencias Humanas y Sociales del CSIC, c/
Albasanz, 26-28, E-28014 Madrid Espaa). Las normas a las que deben ajustarse
los originales de los artculos, de las que aqu se proporciona una versin reducida, se
encuentran disponibles en forma detallada en la pgina web de su versin electrnica:
http://emerita.revistas.csic.es/index.php/emerita/about/submissions#authorGuidelines.
En los envos deber incluirse una versin electrnica en formato de programa de
tratamiento de textos, as como una versin impresa o en formato PDF. En estas versiones
se incluir el ttulo del artculo en espaol (o en la lengua de origen) e ingls, as como un
resumen (abstract) y una breve relacin de palabras clave (keywords) en ambas lenguas.
Se har constar en hoja aparte adems el nombre del autor o los autores del trabajo, su
afiliacin institucional y una direccin de correo electrnico, que es la va por la que
regular y preferentemente se comunicar Emerita con sus colaboradores.
A fin de facilitar la preparacin de los materiales, y de evitar en lo posible las erratas,
se recomienda vivamente a los autores que, al componer sus originales en soporte informtico, procuren emplear el tipo Times New Roman, que se distribuye como complemento de los sistemas operativos Windows, o, en su defecto, algn otro tipo similar (CG
Times, Palatino, etc.). Para el alfabeto griego es preferible el empleo de la codificacin
universal Unicode en el mismo tipo Times New Roman o en cualquier otro semejante.
El uso de otros sistemas de codificacin puede dar lugar a demoras en la preparacin de
originales o incluso a la solicitud, por parte de la redaccin, de una nueva versin con
tipos o codificaciones diferentes a las originales.
Las citas bibliogrficas se atendrn a las siguientes formas:
a) Referencias a textos antiguos: Autor, Obra canto o libro (en nmeros romanos),
captulo y pargrafo (en nmeros rabes, separados entre s por punto).
b) Referencias a obras modernas: se utilizar preferiblemente al sistema abreviado de
Autor + fecha, + pginas que remita a una bibliografa final. En sta se adoptarn
las siguientes normas bsicas:
Libros: Autor + ao de edicin: Ttulo del libro, Lugar de edicin.
Colaboraciones en obras colectivas: Autor + ao de edicin: Ttulo del captulo, en Editores o Compiladores, Nombre de la obra, Lugar de edicin.
Artculos en publicaciones peridicas: Autor + ao de edicin: Ttulo del
artculo, Revista volumen, fascculo, pginas.
Los originales sern revisados por evaluadores externos, cuyas sugerencias se enviarn a los autores para que realicen las modificaciones pertinentes. Ser el Consejo de
Redaccin el que emita la decisin final de acuerdo con los criterios de calidad cientfica,
a la vista de los informes recibidos. El mtodo de evaluacin empleado es doble ciego
por pares (double blind peer review), manteniendo el anonimato tanto del autor como
de los evaluadores. La revista publicar con periodicidad trienal la lista de evaluadores
externos.

GUIDELINES FOR SUBMITTING ORIGINALS

The originals of the journal EMERITA, published in both printed and electronic version,
are the property of the Consejo Superior de Investigaciones Cientficas, being necessary
to quote the origin in any partial or total reproduction.
The articles may be sent to the editorial staff of EMERITA by e-mail (emerita.cchs@
cchs.csic.es) or by post (Jos A. Berenguer, EMERITA, Revista de Lingstica y Filologa
Clsica, Centro de Ciencias Humanas y Sociales del CSIC, c/ Albasanz, 26-28, E-28014
Madrid Spain). We have hereby summarised the guidelines the original articles
should comply with; however, a more complete version may be found on: http://emerita.
revistas.csic.es/index.php/emerita/about/submissions#authorGuidelines.
The articles should be sent in electronic version in a word processing format as
well as in printed version or PDF format. These versions should include the title of the
article in Spanish (or in the original language) and in English, as well as an abstract and
keywords, in both languages. The following details should be included in a separate sheet:
the name of the author(s) of the article, the name of the institution which they belong
to and an e-mail address. Emeritas normal way of communication with its contributors
will be by e-mail.
In order to facilitate the preparation of material and avoid misprints as far as possible,
authors are highly encouraged to type Times New Roman use when writing their originals in the computer. This typeface is distributed as a complement of Windows operating
system. As an alternative, other similar types may be used, such as CG Times, Palatino,
etc. For Greek alphabet, it is recommended to use Unicode universal encoding with Times
New Roman or similar. The use of other encoding systems may cause possible delays in
the preparation of originals or may even prompt the editorial staff to request a new version with facetypes or encodings different from the originals.
Bibliographic quotations should comply with the following guidelines:
a) References to ancient texts: Author, Work book or rhapsody (in Roman numerals),
chapter and paragraph (in Arabic numerals, separated with a dot).
b) References to modern works: use preferably the abbreviated system: Author +
date, + pages referring to a final bibliography. The following basic guidelines will
be adopted:
Books: Author + year of publishing: Title of the book, place of publishing.
Contributions in collective works: Author + year of publishing: Title of the
chapter, in Publishers or Compilers, Name of the work, place of publishing.
Articles in journals: Author + year of publishing: Title of the article, Journal
volume, issue, pages.
The originals are reviewed by external assessors, whose suggestions will be sent to
the authors so that they may include the appropriate modifications. According to the
reports received, the Editorial Board will decide whether the works should be published,
based on scientific quality criteria. The method of assessment used is double blind peer
review, as both the author and the assessors remain anonymous. The journal will publish
triennially the list of external assessors.

SUSCRIPCIN Y PEDIDOS / SUBSCRIPTION AND ORDERS


DATOS DEL PETICIONARIO / CUSTOMER DETAILS:
Nombre y apellidos / Full Name: ________________________________________________________
_
Razn social / Institution, Company name: _________________________________________________
NIF/CIF / Tax number: _____________ Direccin / Adress: __________________________________
CP / Postal Code: _________ Localidad / City: ____________ Provincia / Province: _____________
Pas-Estado / Country-State: __________________________ Telfono / Telephone: _______________
Fax: _____________ E-mail:___________________ Fecha de la solicitud / Order date: __ /__ / ____
Suscripcin / Subscription:

Precios de suscripcin 2012 / Annual subscription


Price 2012:
 Espaa / Spain: 41,35 euros
 Extranjero / Other countries: 68,27 euros

Precios de suscripcin 2013 / Annual subscription


Price 2013:
 Espaa / Spain: 41,35 euros
 Extranjero / Other countries: 75,10 euros

Nmeros sueltos / Single issues:


Cantidad /
Amount

REVISTA / JOURNAL

Precios de nmero suelto 2012 / Single issue price


2012:
 Espaa / Spain: 25,97 euros
 Extranjero / Other countries: 40,39 euros

Ao / Year

Volumen / Fascculo /
Volume
Issue

Precios de nmero suelto 2013 / Single issue price


2013:
 Espaa / Spain: 25,97 euros
 Extranjero / Other countries: 40,39 euros

A estos precios se les aadir el 4% (21% en soporte electrnico) de IVA. Solamente para residentes en la
Unin Europea / 4% VAT will be charged to these prices, 21% VAT for electronic format. Additional for UE
residents

Forma de Pago / Payment method:


Factura pro forma / Pro forma invoice
Transferencia bancaria / Bank transfer
Cheque / Check
Tarjeta de crdito / Credit card: Visa - Master Card - Eurocard - 4B
Reembolso (solamente para nmeros sueltos, en Espaa / single issues only, in Spain)
Distribucin y venta / Distribution and sales:
Editorial CSIC / Press CSIC
C/Vitruvio, 8. 28006-Madrid
Tel.: +34 915 612 833, 915 681 619/620/640
Fax: +34 915 629 634
e-mail: publ@csic.es
editorial.csic.es
Firma _______________________________________________________________________________

Volumen LXXX

N 2

julio-diciembre 2012

224 pgs.

ISSN: 0013-6662

Sumario

MINISTERIO
DE ECONOMA
Y COMPETITIVIDAD

http://emerita.revistas.csic.es

editorial.csic.es

20122
9 770013 666005

GOBIERNO
DE ESPAA

ISSN 0013-6662

JULIN MNDEZ DOSUNA: Sobre el significado de en TLocri 15.15: qu es la pez spera?


MILAGROS QUIJADA SAGREDO: Intriga cmica versus intriga trgica en Tesmoforiantes de Aristfanes
JUAN LUIS LPEZ CRUCES: Crcidas y la Antope de Eurpides
TOM VTEK: Heraclitus, DK 22 B 44 (frg. 103, Marcovich)
VIRGINIA MUOZ LLAMOSAS: Y busqu su alma como a mi otro yo: comentarios a Himerio 10.86-90
KRZYSZTOF RZEPKOWSKI: Isidore of Seville and comici ueteres. Ad Isid., Orig. VIII 7.7
MARCOS CARMIGNANI: Ille quidem totam gemebundus obambulat Aetnen: el Cclope ovidiano como
inspiracin pardica en Petronio, Sat. 100.3-5
JANA MIKULOV: Ablativo de gerundio anterior en la Crnica mozrabe

Похожие интересы