Dictionary of Nyaya Terms - V.N. Jha - Part2

Dictionary of Nyaya Terms wera (pratyavaya) unhappiness ware SH, Nya Kan 678:1, 346:14, 248:10-11 Tat Ci Sab, 232.2. Nya@ Mahi, 322:26 Tar Di Pra , 372:9 wearara (pratyamndya) restatement of a proposition, i a wai Recarrened yitera: Grdat sears: Pra Pa Bhd, 239:17 waa (pratyayaka) causing to know Nya Mai 103.6, aeareent (pratydyakatva) the state of causing to know, Nya Mat, 597:9; Tat Ci Sab. 99:3; Tat Ci Ga, 631:23 (pratyasannatva) i) the state of being related wage Nya Ko ii) Tefrraardiererafeamas fea frat fayacty, Nyd Ko iii) the state of existing near by Nya Ko wearer (pratyasatti) relation p= OE: 287 ( Nya Si Muk Kir, 83:21, 209:34, Nyda Bhi, 492:5, Nya Maft 1024: 10,11, Ta t Ci Di, 779:4., 864:15; Tat Ci Pra. 858:1 wearer (pratyasattitva) state of being a relation, Tat Ci 645: 16 Wa (pratydsanna) related Nyd Maji, 124:10,11; Kir Va, 72:8 Wat (pratydsannatva) thestate of being related Tar Bha, 26:8 Weare (pratyahara) restraining ea: TTA Sra wea: Ny@ Bhit, 588;23 ST (prathamajnana) first knowledge Vi Va 3:6 waa (prathama) nominative suffix, marca ad a veeeka det a arat fanfr a, Sa Sak Pra, 286:10 weteargiirea Sab Sak Pra 343:5 Taree ay288 WAATATTATA (prathamdantapadabhava) ansence of word ending in nominative case ending. Akhya Va, 12:6 Weare (prathamdntapada) word ending with nominative case ending Akhya Va, 12:6 meres (prathamartha) meaning of nominative termination Vyu Va, 90. Pad Va Rat, 474:7-8 wear (pradesa) i) place, region Pra Pa Bhd, 148:15, 112:4. 90:21, 262:7; Tar Di Ra Ru, 200:7 ii) causal substance BRU veg reaP TAT, Nya Sa 2.2.17 wart (pradhana) principal, main chief, Tat Ci, 40,47,48, 87 60-61, 87.88 marae (pradhdnakarmatva) the state of being the accusative, the state of possessing the result on the delimitor of the state of being the direct root-meaning, wareradaaeareMio Nya Ko weraeat (pradhanakriya) principal verb. Sab Sak Pra 344:9 Dictionary of Nyéya Terms wartat (pradhdnata) superiority, the state of being principal or primary, the state of what causes to know the object al waar ? frrameccry Nyd Su Bha, 193:1-2 wear (pradhanatva) the state of being principal or primary Tat Ci, 14,26 Tarafatea (pradhanavidhi) primary or principal injuction Tat Ci, 41, 50 Tea (pradhand$raya) substratum of a principal flase knowledge, saferattt a aaa: yer: aged envi yoo sft Saar: @ wae: Nya Sa Bha 304:10 meta (pradhvarnsa) i) destruction, fermi: wea Sap Pada. 97:9; Nyd Sid Di, 13:13. 13:15. Tar Sam, 6 ii) that has beginning but no end. 2 ee: Tar Sar, 62 it is a relation absence of the effect in the material cause after it is produced sete: Tar Kau, 57:9Dictionary of Nyaya Terms 289 wea (pradhvamsatva) the state of being a destruction Nya Si Di, 18:20 weal (pradhvamsabhava) absence called distruction, i) which has beginning, but no end. ener: SEAT: Sap Pada, 86:5 ii) it is absence in the cause of what is produced SIT STS Ta: weARTATA: Tar Bhd, 185:4 iii) it is a deviation from its own form of what is produced, SAL : TTA: Nyda kan , 556:8 iv) it is an absence which has production , 556:8 SqahAAry, STATE: Nya pra, 83:12 war (prama) true knowledge valid cognition i) true apprehension amaigua: 3 Tar Kau, 15:10 weary: WAI, Sap Pada. 101:19 ii) knowledge as different from illusion. waht g area ser, Nya Si Muk, 430 iii) it is a correct apprehension which has that (potness)) as a qulifier in that (pot) where (potness) does exist. aga THRAISTAA Vere: Ter wT es writ ary a wa wager, Tar Sam 26:1 want (praména) means or source of valid knowledge . 1) that by which something is known is called pramana ‘asennad awn aT HATO, Nya Bhd (Nya Dens)24:2 2) the cause of knowledge is called wa, Guat: FATT on Nya Var (Nya Dens)15:6 i 3) instrumental cause of valid knowledge is known as 70 ATT Nya Var Tat Ti (Nya Dan)16:7 saree THT, Tar Bhd, 7:24 ¥) STIR VAHL ATT Tar kau, 15:11 5) instrumental cause of true apprehension iscalled as SAM WENTGHTAEY HAT Nya $a 11:1 6) is that which is never unconnected with the true cognition aT afer wa Sap Pad, 105:6 7) it is a collection of factors and non- knowledge nature of knowledge and non-knowledge which causes the knowledge of an object that must be correct and not doubtful Satratoirateatratrote facet aatereerar ari wary Nya mai 31:9 TATA (pramanabhava) absence of means of valid knowledge, not arising of perception 5: STOTT Nib(Ratn) 104:16290 Warat (pramata) knower, one who knows, i) one who has a desire either to reject or acepet (the object) wafer: @ sara, Nyd SaBha, 1.1.1; Pra Pa Bha, 191:24 ii) one who knows sfrotrcifer sara safer, Nya Mai, 1.34.7 WATT (pramatrtva) the state of being a knower, the state of being one who is related with the valid knowledge by the relation of inherence. waged et rerrerranfeiccry, Nya Ko, 557.7; Nyd Ku (Pra), 4.5 : 476 Tear (pramavaijatya) different kind of valid cognition, Tat Ci Di, 1237:7 (pramustajatitva) the state of having no universal, Sak Va, 103:6 (pramustabuddhivisayata) the state of being the content of no knowledge, Sak Va, 102:2 ma (prameya) object, content of knowledge Dictionary of Nyaya Terms i) content of knowledge. SREY Ta aisdgeantiet @ ware: Nyd Bhut, 62:12 ii) that which is known is called as 9474 seftaa sft a aaa, Nya Mai, 134;7 iii) the object which is known as true is called 324 asd: crac: eh serra Nya Ko. Tar Sami, 64:9, Pra Pa Bhd, 91:24. wa (prameyatva) objectness, contentness of knowledge, i) the state of being the content of knowledge wad Tat Ci (Anu), 1356 ii) it is the state of being delimited by true cognition regularly, acasria fraaar arias waa Sapta pada, 134:3 ; Nya Li Pra., 550:22 TTT (prameyasdmanya) object or content in general; AVA Nir Ja, 19:5; Tat Ci Ga, 149:6 was (prayatna) effort, volition i) effort, Sale: Fae: Tar Bhd, 174:1 wat: aH sare ef vata: Pra P@Bha,251:11 ii) volition, fa: waet: Tar Sam 5-8Dictionary of Nyaya Terms iii) it is an uncommon cause of the usage of aC is the possesser of universal FIT, VIMSTaAPSa PACT ASST wat, Sapta Pada, 78:16). iy) it is in the form of volition and is the possessor of universal WaTira, TIAA aE TAST:, Tar Kau, 51:4-5. v) that which possesses the universal as pervaded by qualityness which exists in the content of knowledge such as ‘Iam doing’ is called 7at 1 WaT: Nyd Pra 75:4 mgt (prayukta) employed Kar Ca. 30:36 wrt (prayuktatva) the state of being associated, i) a self linking relation that causes a cognition such as because of the absence of cause there is an absence of effect wamrd FT BreoararcHrafara: fa” schferenfarn: ear eraratagrs:, Tar Di Pra, 255:18; Nya Ko ii) the state of being caused 3araay, Nya ko. iii) the state of being a pervader, aahery ATTY Nya Ko; Tat Ci Ga, 1616:3, Nyda Si Di,13:12 iv) warrior, Nya Ko 291 q wart (Prayoga) application; use; employment i) use Tat Ci Upa, 10:20, Kar Ca, 12:12 25:16, 16:18, 21:24, 22:24, 23:26 30:37, 37:46, 31:39, 37:45, ii) inference STAT (@4.3.19.3.9) Nya Ko) iii) example, Saree] Nya Ko iv) utterance of word Nya Ko weraRo, (Prayogavidhi) injuction for application i) a particular intermediary function of sainffing aude wat veka ef ort altartaata araefiite =f Nya Mai, 325:8 mareat (prayogavisayatva) the state of being the object of application Abha Va, 183:5 (prayogasadhutva) the state of being a good application; use, Akhyd Va, 13:5, 34:1 wari (prayogopadhi) qaaracaa ys TAMA TATA, es a vewT, Tat Ci Sab Vol 4. Part-2; 506:4292 wars (prayojaka) causing Tat Ci, 51, 1307, 722:4, Tat Ci Roh, 317, 52:7, Sak Va, 95:2, 54:2, Nya Rat 37:7, 80:13, 208:10, 114:3, Nya Li, 117:2; Pada; Tat Nir, 41:1; Tar Bhd, 80:3; Tar Di Ra Ru, 196:10 (prayojakatavacchedaka) delimitor of promoterness or causeness. NSL, 38 ware (prayojakatva) the state of being a cause i) adelimitor of causeness etc. in general a Tat Ci Gada, 1579:19 ii) a delimitor of causeness of cause in general, Nya Si Muk Ra, 231:38, waracts srpmaeaeareaery, Ta, Ci Gada 1579:19, iii) being in the form of self linking relation that which causes knowledge, is called wana, wavered 7 aera werg sere St sree era, Nya Si Muk Ra, 80:34 iv) favourableness is called wasrery, Tar Di Pra 225:7 v) it is the state of being the cause of an effect indirectly. UR (FG Aa) Bree Nya Ko, vi) the state of being a probans or cause ®ie NyaKo Dictionary of Nyaya Terms (prayojaksambandha) causal relation Sak Va, 42:4 wat (prayojana) i) purpose, motive, amdaiga wade corde Nya Sit, 1.1.24 amdatig yeu vada ad seer Nyd Mai, 332:27; Nya Pra, 43:20; Nya Si Bhd, 3:14 Nya@ Ko ar wgm: sada ceri , Nya Sit Bha, 3:14 Nya Ko (ARET, 9.99, 7H AT. Uwe, en an). a Tar Bhd, 198:1 ii) itis the instrumental cause of that which leads one either to accept what is good or to reject what is bad, >) Tee a rer Nyd Mafi, 18:3 andere’ ered a caaara cartes erirafacata, story, ag, afer, waft, Nya SuBha 40:1-3 iii) it is the object of desire as to be established , :, Nydko) wis (prayojanatva) the state of being a purpose, Nya Si Di, 33:1 went aret (prayojika) causing, effecting. Nyd Rat, 232:12 Pad Vak Rat, 154293 q Dictionary of Nyaya Terms wart (prayojya) (prayojyavrddha) to be caused an elder person who is to be appointed or Kar Ca, 34:43, Nya RAt, 80:14; employed, Tat Ci, 353 Tat iSCi Gada, 59:3 wart weer (prayojyata) (Prayojyavyapara) the state of being caused. the intermediary function of what is to be Pad Vak Rat, 49:1-3 promoted, Tat Ci, 2000:1 (prayojyatavacchedaka) wea delimitor of the state of being caused. (pralaya) NSL, 38:22 final delusion, end of the creation final destruction. warat : Wea eft BRT | (prayojyatva) Kir 61:5 the state of being caused or produced. aduiea aninareaspaatia wea at A particular self linking relation that causes Nya Li Kan, 228:7 knowledge. a watered a wfterumacad erature sft wiftrentare: ereueraratadre: Tat Ci Ga, 644:20 waa (prayojyatvasambandha) a (self-linking) relation called as yaa Kar Ca, 82:108, NSL, 68:17 ATA (prayojya-prayojakabhava) a relation between what causes and what is caused, i) a self linking relation that causes knowledge waft, Tat Ci, Gam 651:7, 716:21, 716;23, 21:8; Nyda Mafi, 138:32(second Vol) et Serena: ears FATT Tat Ci Di, 163:32; Tar Sari Tar Di, 10:8; Manka, 74:12 neared (pralayapurvotpannakarma) the actionwhich is propuced before the fnal delusion Ava Ni Ja, 112:5 Tearatey (pralaydvadhi) upto the time of the final delusion Kir, 35:14 (pratinamanaska) absent-mainded Pra Pa Bha, 179:22294 Waa (pravarapaksa) principal or most important side (of a state, etc.) Nya Maii, 232:8 mates (pravartaka) inducer, that which causes to generate an act, ues ftom’ art rater Tat Ci, Sabdavidhi, 268. Faken’ verdes fares | Tar Ka, 46 Tat Ci, 37 (pravartkajfana) knowledge of an inducer, prompter Tat Ci, 1960:3; Tat Ci Sabda, Vol 4, pt.2; 2:1; Sakvd, 99:6 watat (pravartana) cause of an action, the prompting factor of an action, Nya Bhd. 1.1.18 wad @ St wore : Ag Refer enifadre: a ua fesfeaaa eng: | Mani ka 78:7 sratetert (pravartikd) prompting, inducing. Vyu Va, 210 Dictionary of Nyaya Terms wale (pravada) expression, discourse, conversation, Taal grefrwansaderca safa ftir waratsft ayaa | Sak Va, 116:5; Vi Va, 8:15; Nyd Sa. 80:4; Tat Ci Ga, 1707:11 (pravahaviccheda) breaking the continuity Tat Ci Ga, 731:27 wares (pravahaSakti) a continuous relationship between a word and its meaning, an unbroken relationship. Tar Sarh Di Ra Ra, 224:5 wateaat (pravahitatva) the state of carrying down on bearing along. Nya Li Kan, 225:12 @ravrtti) inclination or desire to do something effort, activity, commencement of an action, or of arule. Sarena Nya Sa Bhé 1:4-5; Nya Mat 332:29 Sacto wate: at oarorerenPe serene Nya Maii, 70:19 aifaeara aaa: srafateter | Nya Bhi, 440:16 fathaisret act: waft: | Tar Kau, 51:50 wert a: waft: | Nya Pra, 75:6 fafaer area orerer waft: stsit wai ata afi! Tare Bha, 6:2 aa!Dictionary of Nyaya Terms 295 (pravrttikrama) order of the function or source order of the manifestation. Nya Rat, 155 Nyd Rat, 209:13 Nya Rat, 208:12; (pravrttijanaka) the agent of producing the desire etc. in one’s mind, that which generates an inclination in one’s mind. Tat Ci, 443 (pravrttijanakatva) the state of being an agent or producer of an inclination vafafrrasatracaia | Nya Bhit, 54:21; Tar Bhd, 117:3 (pravrttinimitta) ground for application of a linguistic term steamsaeenans fatqeraaifaatert aeuana fairer | Sak Va. 134:3 aadevarat gat ofa cresghatadrerrat ay Prana fadeot ar reat cere wert aafava ei: vafatitrar | Pa Va Ra, 77.5-7 aace-araata araghraatt araitafeata- wares vefatfracamrgared | Nyda Si Mu Kir, 294:28 (pravrttinimittakatva) the state of being having or possessing the reason of a word that denotes a sense for which it stands for through a relationship Tat Ci Upa, 14:16; Pada Va RA, 418, 3373-77. (pravrttinimittata) the state of being that which stands for the reason of a word its menaing which is denoted through a relationship which expresses that sense, The state of being a cause to generate an understanding of that sense which is conveyed by a word. Sak Va, 171:3 (pravrttinimittatva) the state of being a cause of an understanding that arises from a word through a relationship. Tat Ci Ga, 634:11 aT (pravrttinimittalaksana) definition of the cause of an understaning of a word through which it expresses its sense. Sak Va, 59:4 (pravrttinimitta- samanddhikaranya) the relationship of having/ one and the same locus of both pravrttinimittas Nya Li Pra, 730:16 aT (pravrttinivrttisvabhdva) of the nature of inclination and rejection Pramé Var, 334:4296 (pravrttinivrttyajanakatva) the state of being the non-producer of an inclination or rejection of any action Tat Ci Di, 77:26 (pravrttinivrttyanujfia) toallow or premit an inclination or rejection in a course of action Pramd Var, 201:8 (pravrttivisaya) an object of the inclination Tat Ci 942-943; Tat Ci (Upa) 16:10 (pravrttivisayatva) the state of being an object of the inclination Tat Ci 432, 437-38 (pravrttilaghava) brevity of an inclination Pa Va Ra, 333-334. (pravrttivijfiana) knowledge of the things belonging to the external world in Buddhist philosophy feet fart afer Tard we WaSSHM ... Nya Si Mu Di, 159:17 warrerrest (pravrttivyapadesa) mentioning or naming an inclination to act. Nya Li Vi K, 429:11 Dictionary of Nyaya Terms (pravrttihetu) cause or reason of an inclination to act Nya Li Vi pra, 440:19; Tat Ci, 434 (pravrttyanupapatti) inapplicability of the inclination Nyd Si Di, 35:2, 35:6; Tar Sart Tar Di Ra Ru, 84:10 (pravrttyaupayika) cause of inducement involved it fe smermdsercaisreray | Tat Ci, 365 Tae (praveSanatva) the state of being an entrance is the state of being an action which is produced by the contact of something inside. Nyd Li Pra, 679:19 Tate (prasarisa) praise, eulogy, Ta | Nya Prea, 109:8 ates (prasithilamila) the base hardly perceptible, the root which is very feeble. Nya Rat, 40. Nya RAt, 240:22 wa (prasna) a question, inquiry NyaKoDictionary of Nyaya Terms 297 aaa (praSrutamaya) yogic perceptual knowledge Nya Bhat, 171:13 wet (prasaktatva) the state of being supplied by a prescription of Vedic sentence. Nai Va, 191:18, 191:19 mrapafereet (prasaktapratisedha) prohibition of that which has been prescribed by the vedic sentence. Kir V, 87:14; Nya Man, 350:6; Tar Bhd, 144:3 mrafer (prasakti) contingency, applicability Kir V, 87:13 (prasanga) contingency, BU eR SPAT | WaT: | Tar Bhd, 202:4; Nyda Li Kan, 78:5 waged ae wee wePrerrener | Nya Mai, 266:4 arctan wag: | Nya Si Mu Ra, 141.23 wage (prasangatva) the state of being connected with the context., staakirre aft soniscaraad wagery! = Nya SiMu Kir, 218:31 meget | Nya Si Mu Kir, 182:12 (prasangaviparyaya) change of topic of discussion. 4 an alle, adele oreresdtasamet orard fea sft amenrsqueter: vegierda efat Kir Va, 95;19 (prasangasangati) coMhection with the context being discussed different from an introduction. i TeRGAT: | Nya Prea, 163:20 (prasangasama) atype of jati, SR Te Sea sage: afer: | Nya Mai, 178:29 TTR: TAFT: | TarSarh Di Prea, 343:18; Nya Prea, 157:20 mera fee (prasajyapratisedha) a type of negative statement prohibition of that which has already occured or discussed(through a vedic injuction) Pramé Var, 522:4; Nya Mat, 154:23; Tat Ci Sabda) , 790:1 Tat (prasafijana) act of connection on applying, Sena TIT | Sap pada, 124:6; Nya Rat, 25:2; Tar Bhd, 202:4298 wae (prasadhaka) accomplisher, purifier. Pra pa Bhd, 84:17; Prama Var, 72:6; Kir V, 85:23 ware (prasadhyata) the state of being accomplishable. Nya Rat, 89:1 that which is TART (prasarana) one type of Karman (action, spreading out, expansion that action which causes connections with a distant place is called expansion arapedintg: ef verry | Tar Kau, 54-55, 8,1 Sara TERT asa safer | Tar Sarn, 60; Preapa Bhai, 15:3; Tar Sari,5 aagariaed vara: | Tar Sarit, Tar Di, 60 Serr Baa eh TART Sapta Pada, 84:1 mk peesntarrgga Ara: Ta] | Nyda Si Mu Kir, 41:21 fragmenta a wary Nyd Prea, 77:13 (prasiddha) established, well known Tat Ci, 261; Tar Sarn Di Ra Ru, 282:14 Dictionary of Nyaya Terms atta (prasiddhatva) the state of being estblished or well known. Vyu, Va, 23 after (prasiddhasamaya) an established relationship Pra Pa Bha, 197:4 airy (prasiddhasambandha) an established relationship Nya prea Su, 3:4 (prasiddhasadhya) an established probandum Prea Pa Bhd, 204:7 uftamers (prasiddhasadhyaka) that having an established probandum Va Va, 74:18 (prasiddhanumana) an established inference [where the relationship i.e. invaribale cocomitance is established.] Nya RAt, 108:2; Ni ba, 18:11, 4:11 Tea (prasyanda) flowing forth; a constant flow, an action continued without any break Ta FFAS: ePeTeaTART ara: | Nya Ku Prakasika, 9:15Dictionary of Nyaya Terms aeereaaeiatea frat | Nya Ku Pra, 8:12 were: + Wale - SAMERISTTE: | Nya Ku prea. 9:8 Wet (prakatya) manifestation of an object of knowledge. Pa Va Ra, 566:1 ure (ref) prak (praci) the Eastern direction which comes in contact with the rising sun. fea wl | Tar Kau, 8:3 ara (pragabhava) one type of absence pre-absence of an effect which has no beginning but has an end. amrasrafaa: : aera wear arise TasarTaala arate: Ara: WETATA: | SETA: i arier | Tar Sam, 6; Saptda Rada) 85:16 srrarat fangeora: | Tar Ka Mr, 63 aryere: @reity BeeaTa: SeTATA: | Nya Kan, 556:3; Tar Bhd, 185:1 eae: HTT SAT SAAT: TAT: | Tar Kau, 57:7 aan a wire Prorreas are: UPTATa: | Nya Li Kan, 568:6 gfaatrarqafattade earatraariaa Waal i; STATA: | Nyd Li Pra, 568:11 safer eta: Teirarara: PTT: | Nyd Li Pra, 567:16 299 watarafirenra: wera: | Nya Li, 567:2 wea (pragabhavatva) the state of being a pxe-absence. pre-absenceness. Rrnsarracd array | Ny Si Mu, 61:1 seated a edearatesPre fcc ‘aft orrracafife | Ny Si Mu Kir, 62:2 THe STATA | Nyd Si Di 14:9 a are Tears aferepraTA- Tae SETT | Nya Si Di, 124:25 aed (praci) eastern direction where the sun rises, i fear | Tar Sari Nya Bo, 12:7 i fee wei Tar Sari Di Pra, 91 yaterat s Gea: ara Nya Li Pra, 295:23 uate Galearawataed at fer: ar ater wratl Nya@LiKan,298:9 agora ceafhitat tea ar ea ar cea wet Nyd Si Mu, 155:5 mifeatees (pratipadika) astem vefataer-mferaiis emg | Pa Va Ra, 405:1-2; Tat Ci Nafi Va, 193. Akhya Va, 3:5; Sab Sak Pra, 68:3300 Dictionary of Nyaya Terms art (prana) (pratisvikarapa) the vital lifeforce ‘breath’ which moves inside the body which gets different names by moving into different places in the body. atria ag: am: | a dats Fersrorera ai ora i Tar Sam,9; Nya Pra, 56:18; Tar Sart Tar Di9 weriirerat Pressure aro: | Nya Si MuDi, 141:8; Kir V, 60:3; Tar DiPra, 83 Toran (pranayama) the breath control wler aat: varansaravanernfaete: ‘SOTTaTA: | Ny@ Bhi, 558:15 siteaieact (pratipadikatva) stemness. the state of being a stem. Pada Man, 13:6, 13:10 miferafeert (pratipadikartha) the meaning of a stem. Vyu Va, 4 snfeonters (pratibhasika) one type of sattd in vedantic philosophy, Nya Ko fetes (pratisvika) uncommon, peculiar Tat Ci Ga, 740:20 uncommon nature, peculiar form. Ava Ni Di, 154:4; Tat Ci Ga, 526:5 sitet (pratisviki) uncommon (property), peculiar, AtmaVi, 11:27 meatier (pratyaksika) concerning perceptible knowledge. Tar Sar Tar Di R@ Rit, 250:6, 253:8; Tar Sart Nya Bo, 49:9 mratiestea (pratyaksikani$caya) having a confirmation of a perceptible knowledge, a confirmed, determinate perceptual knowledge. Tar Sart Tar Di R& Rit, 263:15 mates (prathamika) primary, initial, first. Tat Ci, 863:5 matreirencaa (prathamikavisistapratyaksa) primary qualified perceptual knowledge Va Va, 74:16 Tamar (prathamikaviSistajfana) primary non qualified knowledge Tat Ci, 863:8301 q Dictionary of Nyaya Terms marriage meet | athamikai (prapaniya) primary non-qualified knowledge. that which is fit to be obtained Va Va, 76:15 yd Bi Ti, 71:1 mera (prathamya) (praptapratisedha) primariness, that which is prohibited which is previously Nya Li Vi, 402:5; prescribed Nya Si Di, 41:6 Nya Rat, 208:8 mrafereryorst safer (pradeSikagunatva) (prap the state of being a quality having limited significance. Nya Ko arafarenca (pradeSikatva) the state of being with a limited space/place, the state of having a limited coverage. KirVa, 112:7; Ta t Ci, 825:1; Di, 851:12; Nya Si Di, 27:12; Nya Ku, 316:6 wert (pradhanya) predominance, supremacy. Sab Sak Pra. 194:2 ar (prapaka) conveying or establishing the word meaning aaifterarers fe srrafiregary, Nya Bi Ti, 24:1 id srearreresiod aT | n 23:3 acquisition, attainment, obtainin; agra emibianrsran: wf: Tar Sari Di Ra Ri, 197:14; Tar Sart Di pra, 94:5 safer (praptisama) a jati Sree weet sR: | Nya Sia Bha,5. 1.7 wre area at aah: oreenfafireeca, STATE ATET SAP: | Nya Sit, 5.1.7 SURAT aR | Tar Di Pra. 342:12; Nya pra, 157:14 ra (arta) (prapya karman) that which is to be achived, obtained feapeaierrams weary | ae aagestr afr | Nya Pra 125:20; Kar Ca, 35:44; Kar Ca 36:45; Kar Ca 39:48 wer des eh wer! Pad Va Ra, 513:10302 WIEDER (prapyaprakaSakaritva) the state of being the illuminator of a particular thing which is obtained if 1 Nya Ko arenes (pramanika) ‘one who accepts or establishes proof on the basis of his arguments which are valid; an authentic proof for an argument Va Va, 101:22; Sak Va. 175:6; Kir Va, 5:13; Pad man, 5:5 rarforest (pramaniki) based on authority or evidence Pada Va Ra, 731:1, 735:7 aTAaTey (pramanya) authoritativeness, validity, authenticity, sre era sean afin: | Nib 97:11 waft doeraerct aah cared at sand aaa eayerrarrn yar ar aaEr | Tat Ci, 180-181; Nya Ra. 18:2; Tar Bhd, 109:1; Tar Bha 116.2; Tat Ci Rah, 376: Manka, 4:9 wraToasTE (pramanyagraha) knowledge of validity of knowledge Tat Ci, 111; Tat Ci 1203:10; Tat Ci 1882.9; Tar Bhd, 113:2; Tar Ka, 70 Dictionary of Nyaya Terms Wreaaearasht (pramanyagrahaka samagri) the collection of factors which generaters the knowledge of validity (of a knowledge) Tar Sam Di Ra Rit, 362:12 wrrrvatsstrat (pramanyajijfiasa) inquiry of the validity or authenticity of @ knowledge. Tat Ci, 563 WA aSTT (pramanyajhiana) knowledge of the validity (of a knowledge) Tar Sart Di Ra Rit, 255:7 area ert (pramanyaniscaya) ascertainment or confirmation of the validity of determinate knowledge. Sara: Saat romraahere: | Tat Ci Rah, 281:12; Man Ka, 8:3 mrreaigra, (pramanyasarhSaya) doubt in the validity of a knowledge. Man Ka, 6:15 (pramanyasandeha) same as WraTvaigTa Nyé Li Vi Pra, 433:15 (pramanyasadhaka) that which helps to prove the validity of a proof of a knowledge. Tat Ci, 886:15Dictionary of Nyéya Terms mrad (prayascita) expiation, a religious act which removes sin. Tat Ci, 833:9; Tat Ci, 2061 :2; Kir V, 34:14; Kir V, 7:2 wikeres (prayika) usual, common, normal Kar Ca, 87:14; Pa Va Ra, 235, 424 wiferrct (prayikatva) commonness, usualness, Tat Ci Di, 1377:1 (preksaparvakarin) one who acts after considering the pros & cons. Nya Maii, 105:7; Nya Bhit, 11:16 w (preksavatpravrtti) effort of a learned or considerate person Tat Ci, 115 aaa (pretyabhava) the condition after death; the state of soul after death of an individual Nya Su 1.1.19; Tare Bha.] 93:1 sere Wet a yremf: @ weaara: | era ya gaia Nya Sa Bha on 1.1.19, P.31:3-8 yaerik fear okerarert terra sft Nyda Su Bha 254:5-8 303 qrecafateqara: | gat graardieafeake- arrearage & errs gfe | Nya Su BhaVar. 86:4-5 Rena wry | Tar Sarit Di, 64:12. Br (prerana) inspiring, instigating, impelling Nya Ko iinet (preryaprerakalaksana) of the form of sending and which causes to send (something), impeller and impelled. Nya Mafi 330:4 site (praudha) full-grown; fully-developed Tar Sari Di Pra, 24:15 mea (praudhatva) the state of being full-grown; the state of being fully matured. Tar Sark Di Pra. 406:20 the relation of prior and posterior Nya Ku, 120:1; Nyd Man. 30:2, 74:14 B wieeat (phakkika) an earlier statement on logical exposition to be maintained (now in the present exposition) Tat Ci Ga, 598:4; Tat Ci Ga 923.26304 Dictionary of Nyaya Terms we a (phala) Result, effect, ay two types of result (bandha) 1) main, primary a tie, cofining, bond 2) secondary or subsidiary. asd selqeriniagirasav sates ar WS GES aaeCHR || NyaPra, 154:13 we garras Fer | Tar Kau, 50:11; Nya Si Mu Kir 8:4 oe fatter qermguee | Nya Pra, 102:3; Tat Ci Pra, 62:2 (phalamukhagaurava) a kind of fault which causes cumber- someness while producing result. Tat Cim 1229:3 wore (phalamukhatva) the state of attaining a result Nyd Si Mu Di, 156:17; Nya Si Mu Da 326:7; Nya Si Mu Di 326:24 OTT (phalopadhayaka) prodncing result. Nyd Si Mu Ra, 325:24 (phalopadhayakatva) the state of produncing result weed arafaafeang amradea arkemnireconan arent | Padva Git Di, 644:14 wae | Nya Bhi, 571:5 orermhiTdrasasirprasream: qari ar: (Fea. aT 9.¥.99) Nya Bhit, 554:11-12. ar (bandhana) bondage Nya Pra, 109:18 (bandhaviccheda) break in the tie or bond or connection Nya Kan, 6:13 aw (bala) might, power, strength Tat Ci, 1784, 1787, 1878 (balavadanistananubandhitva) the state of not causing unwanted consequence more than necessary Tat Ci Sabda) (II), 196:; Tat Ci Sabda (1)107:3; manka, 76:1; Tar Sarh Di Ra Ra, 84:11 (bahirindriya) external sense-organ Pad Man, 20:10; Tat Ci, 648:24305 ( Dictionary of Nyaya Terms area Te AT: | (bahirdravya) Tar Ka, 76. | qage SPRATT | external substance ey Nya Ko. Tat Ci GOrnda, 1881:7 , arg 9 rearrange Wey (bahirvriti) Nya Si Mu,272:1,286:3 external existence, ‘area aparafafarah ah Aum Vi, 386:1 mr Man Ka, 52:5 S eRe aTaSATHaT yeaa | (ahutra) Nya Rat, 163:4 manifoldness; many, the number three Vai Upa Nya Ko (bahuvrihi) acompound aesite erratcterateres tere: | Freee ara igen || SaSa Pra, 244:4, 258:10; Man Ka, 84:4 (bahuvyakopa) much contradiction (in a logical statement or exposition) Tat Ci Di, 566:4 area (badha) 1) condradiction, obstruction, Nya Rat, 210:15, 183:9 FAROE TIT STE: | Nya Maii, 476:18 He ACHE: ATE: | Nya Maii, 453:!0 2) a fallacy, a subject having absence of probandum coftgefakaaania cue ereareraat ae: Nya Rat, 182:5 se arated VA wa aera Saleh: tare eeareiat are: | Tat Ci, 1126:3 aT (badhaka) troubling or opposing factor which opposes or obstructs Nyé Rat, 19:4; Nya Rat 10: Nyd Rat 62:5; Tar Sart Di Ra Rit, 15:3; Nyd Maii, 431:13; Tat Ci, 222; Nyd Li, 213:1; Nya Si ; MU Ra Rui, 57:15; Nyd Sa, 41:9; Nya Bha, 317:2 Tea (badhakatva) the state of being an obstructor Tat Ci, 340 ATTRA (badhakamana) proof of an obstructor Nya Ko306 ae (badhatva) the state of being an opposition or obstruction arret ATTA | Nya Kau, 330:9 aE (badhasankara) mixture of obstruction blending together with opposition Tat €7, 1164:5 ara (badhita) contradicted hetu or reason which is obstructed, akind of a fallacy. ae tt: ararra: oa ATR Pad: a wafer ek: | Tar Sarh Nya Bo, 49:9 aeafrarfrssectarafreatea: ver Rare: | ea area: ATO PP: a vatfera: | Tar Sari, 44, 48; Nya Rat, 210:15, 190-6 worfrrateratir: at are: wary afer: | Man Ka, 52:5 mrearrreracrerat afer: | Tar Kau, 40:8 arfereret (badhitata) obstructedness Nya Si Di, 34:15 ara (bddhitatva) the state of being an obstructed reason which does not allow an inference ereararaaarar PParaaetened Seitalerreary | Nya Rat, 182:6 Dictionary of Nyaya Terms cat a frafirafanicaemniaietedtaie fetisa arrarqueter: afer | Nya Rat, 202:2 arfererad (badhitartha) obstructed meaning Tar Sam Di Ra Rit, 85:8; Tar Sar Di Ra Rut 89:4; Tat Ci, 1200:8 (badhitavakyartha) obstructed sentence meaning Sak Va, 123:14 (badhitasadhyaviparyaya) opposing or contrary probandum which is obstructed Tat Ci, 1072.9 aa (badhya) that is obstructed or opposite. Nya Bhi, 317:1 TAMA (bddhya-badhakabhava) the relationship of obstructor and obstructed Nya Mai, 36:12; Tea-a BTM (badhya- badhakavyavastha) the settling relationship of obstructer and obstructed. Tat Ci, 339; Tat Ci , 432.Dictionary of Nyaya Terms 307 < ae wiaaertqgfestrs | (bala) Tar Sara, 21 f. person who can grasp and retain 3, That which unfolds or reveals the true nemsorgai: | 4g RAR! nature of an object or thing. Tar Sam Di, 2:10 ores af: | Ny@ Li, 760:3; Tar Bha, 171:1 arena wenisit gfe | are fieftrer - frerenfaen a (bahyapratyaksa) Nya Li Vi, 408:1 external perception afararraat ores: seit af | Man Ka, 26:8 Sap Pada, 76:14 ait at gfe | (bahyaikaikendriyagrahyagunatva) Tar Kau, 15:1 the state of being a quality known through e ‘aft only on of the extenenal senses x Pra, 74:5 Nya Ko gfasteferat] wer genie fr: ) valareaistiniad a gfe | r advert at gfe: | Dia thrasthallyanavastha) Tar Bha, 187:3 the fault of infinite resgress in the stage of —- feoreferatafiemebay| sprouting of a seed. Nya St, 1.1.15 Tat Ci Ga, 646:23 8 (buddhitva) (buddhi) the state of being a cognition 1. One of the qualities of the Soul. srdifreconetafreaurcaredrereguratirad: | afentt afvaarataarery: | Nya Li Kan, 760:9; Vi Va, 11 Pa Va Ra, 95-96 arareritiemrenngaay earner, gegen eet gost aaferteeorersrafastia aon: | (buddhidhara) Tar Sari, 5, Pra Pa Bha, 14:13 chain of cognitions, continuous know- afeqas: Gear RUMI ledge f ome Tat Ci Abha Va, 180:19 Tar KG 28. afzie 2. Knowledge fei! (buddhibheda) Nya Si Mu Mine 11:23; Di, 13:10 difference in knowledges; discrimination afeati, afateed eroraguaer| in knowledges Tar Ka, 44 Nya Mai, 101:27308 (buddhimatparvaka) having an earlier knowledge. Kir Va, 65:18 afawarrt (buddhilaksanatva) the state of being of the form of knowledge. ghecanreay - gfarrarriist very WHY, Kir Va, 21:11; Pra PaBha, 21:8 Saetdavvisayatd) contentness of knowledge Akhya Va, 23:1; Sak Va, 122:2; Sak Va, 99:9; Sak Va, 96:7; Sak Va, 90:3 Guddhivisayatva) the state of beging a content of knowledge. Akhya Va, 24:4; Pa Va Ra, 80:4-5 Guddhivrtti) function of the intellect Nya Mah, 69:10 (buddhisamakala) simultaneous with the intellect. Pra Pa bh, 13:11 qaaten (buddhyapeksa) depending upon the intellect or knowledge. Pra Pa Bhd, 108:22 gare (waft) (buddhyarambha) (pravrtti) the effort which starts with the intellect. Dictionary of Nyaya Terms Uaeahrt aot Gee: | Ny Pra, 154:8 ater (bodha) understanding. Kar Ca, 71:9 ates (bodhaka) having an understanding, possessing this type of understanding. Kar Ca, 31:39 aaa (bodhakatva) the state of being the generator or cause of an understaning. Kar Ca, 34:42; Kar Ca 15:16; Kar Ca 32:40; Tar Sam Di Ra, 90:15 ae (bodhana) instruction, denoting, signifying, Kar Ca,34:42 aafaaa (bodhavisaya) content of understanding. Tar Sam Di RG Ri, 317:19 atatarrreat (bodhavisayata) contentness of an understanding Sak Va, 48:2; Sak Va, 86:3; Sak Va, 93:3 aeraara (bodhasvabhava) nature of the understanding. Nyd Bhai, 62:8; Nyd Bhat, 139.14Dictionary of Nyaya Terms (bodhasvarapa) nature of understanding. NyaMai, 41:6 aa (bauddha) relating to the understanding; the doctrine taught by Buddha. Tat Ci, 109 (brahmacarya) celibacy, studentship or studenthood Pra Pa Bhé, 260:6 (brahmadina) one day of lord Brahma Nya Kan, 124.2 wert (brahmadharmatva) the state of possessing the quality of Brahman. Nya Si Di, 34:15 wer (brahmabheda) difference with Brahma i, 34 Nya Si Di, 34:3 (brahmabhedapratipatti) apprehension or observation of the difference of Brahma. Nya Si Di, 34:13; Nya Si Di, 34:14 309 ( (brahmavadin) follower of vedanta philosophy who does not differentiate between jiva and Brahman, one school of vedanta philosophy. Tar Sarh Di Pra, 239:4. wera (brahmasarhvedana) knowledge of Brahma, perception of Brahmi, sensation of Brahma. Ny Rat, 19:5 TET (brahmanatva) brahminhood. Nya Li Kan, 227:14 q aie (bhakti) figurative usage, immediate sequence, ergitd aft? areed aft | Ny Sit BRL, 248:3 afta ormaryeea carafe: arae, oH asad sft aft: cer ade a TTA areteat HFEF | Nya Sit Bha Var (Nya. Dar); 504:13-15; (Nya Dar); 245:9-11; Vai Upa, on VS.7.2.6.; P. 402; Kir, 301; Pa Va Ra, 435 Te (bhagavajjfana) knowledge of God Man Ka, 54:10310 (bhagavatsanketa) desire of God to establish the word- mean- ing relationship. Sak Va, 80:8; Sak Va, 90:7; Sak Va, 45:3; Sak Va, 8:3 (bhagavadiccha) desire of God that establishes the word meaning relationship. Sak Va, 41:7; 52:13 wart (bhagavan) god, the supreme lord of the Unirerse, Manika, 72:10 (bhadantasiddhanta) bauddha doctrine, Nya Mafi, 28:21 wa (bhaya) fear waa Wes Preeeert | Nya Pra, 133:18 wa (bhavana) creative function eae: | according to the vaiyakaranas Nya Ko. (bhavisyat) future (time) That is called future (time) of that which Dictionary of Nyaya Terms delimits the time by the pre-absence of that. Formas a: aerated a ary afeearcere: | Vai upa, 2.2.8. aire (bhavisyatva) the state of being a future is the state of being a counter-positive of the pre absence of present. SeaarraTaata rea afer | Nyd Pra, 59:16; Tar Sant Di Pra, 90 ae (bhakta) secondary usage (of a word) Nya Si Bha Var, 245:7-12; Akhd Va, 25:2 Secondary usage of a word, Nya Pra, 70:17 ART (bhagavattva) the state of a portion possessing amaed waaay | Nya Li kan, 266:8 (bhagasiddha) partially unestablished fallacious reason. crmfatstt wemnfirg wa 1 Tar Bhd, 208:1. Sat: vaetengfeas arnfire: | Nya Pra, 98:16; Nya Bhi, 311:16; Nya Sa, 27:1 See Svartipasiddha (bhagasiddhatva) the state of being a fallacious ground Nya Li Vi, 107:4Dictionary of Nyaya Terms a fallacy partially non-existent reason on the subject. Tat Ci Ga, 545: 23; Tat Ci Ga Di, 105:11; Tat Ci, 540 qaaaenerirmMaaway FUT: | (Nya Ko) at (Ghana) knowledge, wari eae Nya Si Mu Di, 207:19; Vyit Va, 31; Vyai Va, 35; Tat Ci, 865:8; :6; Sak Va, 35:9; Tat Sari Di Pra, 208:19; Tar Sari Di Pra, 226:3 ae (bhava) 1) Positive (entity), There are 6 types of positve entities. aq vert fafa: sratseraer| Nyd Si Mu Kir, 24:24; Tar Ka 3 2) Relationship, notion, nature, mat = rt: weer sf aaa Nya Si Mu Kir, 66:20 3) Strong internal desire ara | Pra Pa bh, 250:8. 4) Action (according to the grammarians.) aaa: fear | Pa Va Ra, 609:5 rage SrerTaT oie | Pa Va Ra, 543:1 rarer (bhavakarya) positive effect 311 Tat Ci, 1963:15; Tat Ci, 2023; Padé Ta Ni,39:1; Padé Man, 2:13 Waa (bhavakrta) caused by bhava Akhya Va, 19:2 wae (bhavakta) Secondary Sa Sa Pra, 351:14 WaT (bhavatva) The state of being a positive entity. waeaa, oa aarateyatt afeftraraere: | Nyd Si Mu Di, 60:8; Nyd Si Mu, 24:1 werrerds - qrararaftesrnreafara Hera TeaeTaReTrT aaa errata (Sertearer) edtworarrrerefiscrea Wakieaeaaracreay saat: | Nya Si Mu Kir, 25:6 the state of being existent is the state of being related to that which has existence. i Hac | Nya Si Di, 125:16 Saarraaita Hae, Nya@LiKan, 780:8 Aaa ERT AT | Nya Li Pra, 795:7 j MTacay, Nya Li Pra,795:10 TenaERasarad way, Nya Li Kanm 752:12; Ny@Si Di, 5:8, 8:12, 9:14312 (bhavatvabuddhi) knowledge of the state of being existent. Nya Li Pra, 566:13; Nya Li, 566:3 eT (bhavana) impression 1) One of the Sartskaras dearfeiaea: | ait rear ferret, Tar Sar, 59; Tar Ka, 28 2) One of the qualities. Pra Pa Bhd, 106: Tar Sari Nya Bo, 11:16 3) An efficient cause that promotes remembrance produced by experience, agrara eprequicncrragte: | Tar Sam, 59 aera, deer oneraragheegyars: whe: | Tar Bha, 176:3 aarara aft Bead Aaa Ser | Tar Sari Nya Bo, 60:4; Tar Kau, 54:4; Nyda Pra, 76:18; Tar Ka, 28,52; Nya Maii, 309-6; 308:32 That sarh kara produced by aknowledge. 4) aR: Beat ATT Saptapada, 129:14 5) Action (mental) anadienar ua Hreadieaeat fafa exafegaet | Pa Va Ra,497:1 are & Akhya Va, 14:4 TARTANA | WATTS (bhavanabala) strength of the manifested thought of amen- tal action. Nib (Ratna), 17:21 Dictionary of Nyaya Terms (bha@vandparinispatti) terminating in bhavana Nib (Ratna), 10:8 (bhavanaprakarsa) excellence in mental action Nib (Ratna), 10:19 wea (bhavanapracaya) collection of the mental action or thought to be manifested. Nya Kan, 7:2 aaa (bhavanavisesya) the mental action as the qualificand. Akhyd Va, 12:1; Akhya Va, 15:1; Akhya Va, 15:5 arama (bhavapadartha) positive entitiy, Pada Man, 36:12 waar (bhavapratiyogitva) the state of being a counter-relatum of a positive entity. Tat Ci Abha VG, 178:16 Wa (bhavapratyaya) knowledge of positive entity. Abha Va, 30:4; Tar Ka, 94 TT (bhavapradhanatva) the state of having bhava as prominent Ta Ci Ga 938: 25Dictionary of Nyaya Terms 313 arama aaa (bhavapradhananirdesa) (bhavotpatti) mention of bhava as prominent Tar Sarit Di Pra, 212:15; Kir Va, 118:1 arererfat (bhavarasi) collection of the mental action or thoughts to be manifested Nib (Ratna), 44:3 (bhavavikara) change in the action. changing action (which manifests step by step) Sy Bergacror safiertvaared sraferart wa Tora: | Pa Va Rat, 520:14 ararasrt (bhavaviSesa) special mention of the action of covering (that refers to the knowledge of avidya) Pa VaRa, 503:9 arate (bhavasakti) the existent power. Pra Ma Var, 556:2 arta (bhavi) future, to happen in future. Tat Ci, 77:2 atte (bhavitva) the state of happening in future. Sa Sa Pra, 436:8 production of an efficient cause that manifests on promotes or brings about (some- | thing) Nya Su, 4.1.22 weal (bhavya) to be accomplished, to be performed to be determined or proved. Pa Va Ra, 562:4 oat (bhasa) language of communication. Speech, talk SabSak Pra.275:10 aA (bhasamana) appearing, shining, Pa Va Ra,504:10; Vyu Va, 33 ARAM (bhasamanatva) the state of being revealed Akhya Va, 16:4 ART (bhasvaratva) the state of being bright, the state of being luminous TOTAL, Vai Upa, 2.1.3 Tee (bhasvararitpasitnyatva) the state of the luminous or bright not possessing of colour. Tat Ci Di, 104:6314 Dictionary of Nyaya Terms tr VACA (bhinna) (bhatatvasankara) different, Kar Ca, 31:39; Kar Ca, 23:26; Tat Ci (Upa), 16:10; Tat Ci (Upa), 660:1 Raa (bhinnatva) the state of being different Kar Ca, 23:27; Kar Ca, 24:28 Bae one of the five natural elements. yeerttiararaaers yqrearery | Tar Sam Nya Bo. 11:19; Pada Tat Ni, 10:3 ERTS (bhatakala) past, that time in which something hap- pened already. aerate a: arérafesad a dead ae: | Vai Upa, 2.2.8 fremretasterartcasry | Tar Ka, 4.11; (Nya Ko). Srararve) the state of being bhita ered aT UTAH | Tar Sara Nya Bo, 11:18; Nya Si Mu Kir, 47:9 Nya Pra, 79:5 ieig ereerareroraraebeet sfefaare:, yaaa aa | PadaTa Ni, 26:1 a mixture of the properties of bhiitas Tar Di Pra, 57:1 aaa (bhiuitadha@rakatva) Tat Ci Ga, 3:20 ef Brevi) poritive entity Ya: aaa: | Nya Bi Tr, 67:3 ears inanavadey statement of facts Cems TayMTETGE: eT yea: | Nya Pra, 101:20 Fara (bhitaveSanyaya) the maxim of entering into a living being of a ghost. Tat Ci, 1999:3 oe (bhatyodarsana) perceptual knowledge of probans and probandum residing in one locus again and again. Tat Ci Ga, 635:1; Tat Ci Ga, 635:12; Tat Ci, 648:26; Tat Ci, 722:3 a (bheda) difference, relation of difference. Kar Ca, 25:30; Kar Ca, 51:66; Tat Ci, Upa, 5:4315 q Dictionary of Nyaya Terms yerlaresar fatter Fee, Pa Va Ra, 233 (bhedabhedavada) fears a afedifrerri | the doctrine of simultaneous dualism and Nya Pra, 49:4 non dualism, the theory of difference and non-difference, Res Pa Va Ra, 567:3; Tat Ci, 67:8, 67% (bhedaka) Ot Ch OTT B68 Fe that which causes a difference, that which indicates difference. Nya Ko (bhedakatva) the state of being the indicator ofadifference Tat ci, 1092:6 aes (bhedagrahaka) that which reveals the difference. Nya Li Vi, 113.3 aa (bhedatva) the state of being different Va Va, 74:26; Vyu Va, 35; Vyu Va, 32 Te (bhedasambandha) the relationship of difference. Tar Sam Di Ra, 344-4 Fame (bheddgraha) the non-knowledge of difference are Nya Si Mu Ra, 168:28; Nya Si Di, 9. Nya Si Di, 93: Tat Ci, 530 Tat Ci Abha Va, 178: 1; TatCi Upa, 6:22 a (bhoga) 1, enjoyment PeSaraaceTae AT: | Nyd Pra, 51:20; Tar SariDi, 7:10; Tar Kau, 6:10; Tar Bhd, 125:3 a1 Sapta Padé, 91:15 2) fruition we At Tar Sari Di, 64:12 ate (bhogadhara) basis or locus of enjoyment. Tat Ci, 1424:11 aera (bhogayatana) locus of enjoyment Nya Ko itm (bhogaSraya) substratum or locus of enjoyment. Tar Sart Di Ra, 197:7 a (bhauma) related to bhiimi; a type of fire cufteraert ta: sty zen ef, Ny Pra, 55:7; Sapta, 94:6316 Dictionary of Nyaya Terms wa waa (bhrama) (bhréntatva) misapprehension, a mistake, erroneous _ the state of being a bhranta knowledge. Nya Si Di, 9:9; Nya Si Di, 9:14; TERS SFE A: | Man ka, 74:3 Nyd Si Mu, 421:8; Ny@ Si Mu, 423:3-5 FaadaProat ra: 1 sa NydTar Kau, 15:8 (bhranti) farce arr rt gE! Tar Sari, 57:9 weerieret wa: | Tat Ci, Sabda, 129:5 wet (bhramatva) the state of being an erroneous knowledge. Tat Ci, 107; Va Va, 132:33; Ara Nija, 43:6; Ara Nija 154:9 WaT (bhramana) movement, action in circular way. wor, -afreAeaerARU, Nyd si Mu Kir, 41:27; Pra Pa Bha, 15:4; Tar Sat Di, 5; Tar Sarh Pra, 62 WT (bhramanatva) the state of being movement oe: area STA | Nya Li Kan, 680:9 Rs i iw A! Nya Li Pra, 679:15 Wa (bhranta) cone who has misaprehension, one who has wrong or erroneous knowledge Tat Ci, 647:; Sak Va, 121:1 error, a wrong notion. Tar Sara NyaBo, 5:6; Kir Va, 12:9 witaast (bhrantidarsana) seeing or knowing an erroneous knowledge. Nya Ko q (mangala) benediction, an auspicious beginning which causes the completion of a text. were fireerart- afagitdiimetacmieecarme real HES frrafrend fiend mend oferta, Tar Sara, 1 Pe Ss Te a Tae ARE fread! Tar Sart Tar Di Ra, 84:8 afiraaatcerana edenitaprn: freer Reread | wa aes aah ofa aro Man Ka, 2:3 Rend arora | Tat Ci Rah, 41:17 Were eedagRecraRTeTHy | Ny Si Mu Kir, 6:22 rater’ ate safer (ore) Farereerserarar ITTY | Nya Si Mu Kir, 7:10Dictionary of Nyaya Terms Aol (mangalatva) the state of being an auspicious beginning which removes difficulties while starting any work (to be accomplished) ud fersiicareons: ata areata Nya Si Di, 3:21 om Nya Si Mukir, 7:14 aaftastaratyaghatatuedaeacar a aecrerafirfe | Nya Si Mu Kir, 7:15 faffeanized ufvaaraaa eft @rraar Aafafeacry | Tat Ci (Nya Ko) st (mandana) the act of decorating or ornamenting one- self. sinnfasiraferiesty | Nya Pra, 109:10 TATA | (mandukavasdiijanadosa) a kind of defect Tat Ci, 321 (matanujiia) akind of nigrahasthana in which one does not quote one’s fault but of others. aaa TMQ WIA aera AAT, Nya Sti, 5.2.20 anes Sate eemaragar eer wars, Tar Bhd, 221:7 QOUGea SICTAR FATA, Nya Ra, 239:5 aa wifaradtarararcarata eareatdifa, 317 ( watargarh Fels: aa sarge | Nya Ra, 240:21 (mati) intellect, understanding, judgement. Nya Ko. AT (matsara) jealousy, greediness. weasel faeaafe aq orem daa aaafeartest AT: | Nya Maii, 71:2 (madhura) pleasant, sweet, attractive, agreeable, one type of rasa. Tar Sarn, 15; Pad Man, 16:4 (madhyamaparimana) middle size. Tar Sarit Di Pra, 94:3; Tar Sarit Di Ra,198:7 HeTATe (madhyamavrddha) the middle person in action performed. Tar Sari Di Pra, 235:3 aaa (madhyamd) a kind of speech. Ny@ Mai, 343:20 Fae (madhyastha) being in the middle, the middleman. Tat Ci, 1530:20; Tat Ci Ga, 1552:13318 wt (manana) logical thinking process, meditation, reflec- tion. Taare Tree eee a PTT 4, Nya Pra, 46:11 1 OAH, Tar Sam Di Pra, 388, 3; Tat Ci, 1088:7 (manas) mind; understanding, an instrument which helps generating the knowledge of pleasure etc., the inner sense organ, a substance. at BAL Nya Sit, 3.2.56 a 7, Nya Sui, 3.2.59 fal Nya Sti Bh Var, 40:10-14 1 A: | Nyd Li, 328:2 TAT eT TEATS TIGA wt geal: | Nya Li Pra, 329:7 wa gent ofeadsirararmanrefrerifer al Tar Sam, 3; Tar Ka, 3; Pra Pa Bhd, 10:8 qemvemranmttisd w:, wa search meer weHped Pred a Tar Sara, 13; Tar bha, 129: Nyd Pra 64:8 7A: TEST | Tar Ka, 6 mace gare ai a Te | Nya So Mu, 360:1 Dictionary of Nyaya Terms spreconicanhr eagigel franfterzot aa: | Sapta pada, 68:22 FRAGT: | Tar Kau, 9:5 arated aa: | Tar Bhd, 191:4 washed aft Graracd aah war | Tar Sam Di, 13 Wie (manastva) the state of being an internal instrument of knowledge. The class of mind as an inner sense-organ. red a el ofa shearer fare: Ferra GerTererarraaeay | Nya Li, 802:4; Nya Si Di, 26:1 (manograhyagunatva) the state of being a quality which is known through mind, Nya Ko. Tia (manovijana) mental perception. (Buddhist) ae aid drier | Nya Bin, 1.9; Ny@ Bi, 179:4 PRATT wa (mantra) vedic invocations to God meme ae AAT: | Atmvi, 435:1 werner Hefei ae wa AEM: | Atm Vi(comm.1)435:9Dictionary of Nyaya Terms A mantra is that type of Vedic sentence which causes torecollect the meaning of the offerings to be given as oblations to Devata of asacrifice. Nya Pra, 101:14 AT (marana) death, 1. The ultimate destruction of the contact between the body and the breath is called death. aeaannaarreaa: FTL | Nya Si Mu Di, 31:11; Nya Si Mu Kar, 26:10; Tar Sart Di Pra, 31:16; Nya Pra, 154:12 Separation of body and mind, x Vai Upa, 6.2.15 Destruction of the invisible merit i.e. adrsta (both dharma & adharma). dramrecrta: | ae eaten Vai Upa, 6.2.15 4. erat A Tar Sara Di, 64:12 w (maryada) limit or boundary of time and space. aafer dra Ieee Bere TI Nya Pra, 127:2; Pa Va Ra, 780:1-2 Fed (mahattva) the state of being a big size. afehePracirererercne seyrerstacl af Hera, Nya Si Di, 43:17; Nya Si Di, 42:16; Nya Si Di, 43:22 319 « sagieviaarara area. was ' TET | Man Ka, 14:11 (mahatparimana) big size, large size. One type of quantity. urag oat area aed seeralt aa weet Sea: | Nya Kan, 318:7; Tar Sara, 18; Pra Pa Bha, 136:17 Tecaitrea et (mahatvadhikarana) locus of mahattva Nya Li, 267:4 Hees (mahadanda) the big egg Pra Pa Bha, 64:7; Nya Kan, 130:1-3 (mahaddravyarambhakatva) the state of being (a cause) of the substance which is of a big size. Kir Va, 36:16 TETAS (mahakala) universal time which has no limit & which is indivisible Man Ka, 34:1; Ava Ni Ja, 119:4; Tat Ci Ga, 246:1; Tat Ci Ga, 276:26; Nyd Si Mu Ra, 66:20; Tat Ci Di, 166:35320 Aeraet (mahakalatva) the state of being the Universal time having no limit & which is indivisible. Ava Ni Ja, 24:3; Ava Ni Ja,117:1; Man Ka, 34:1; Tat Ci Ga, 246:1 TESA (mahapralaya) final delusion, positive effects. wd sreearcesel Herre aft Fae: | Tar Sari Di, 10:10 destruction of all the aide (mahabhita) the primary element of creation. Pra Pa Bha, 60:5 Fea (mahavakya) a discourse principal sentence, . Sa Sa Pra, 189:2 onelaterds ary Sa Sa Pra (Nya Ko) aerated (mahavakyartha) meaning of the primary or principal sentence. Sa Va, 120:1; Sa Va, 162. Tat Ci Di, 55:19; Tat Ci Di, 31:5; Tat Ci Di 61:25 (mahavyapti) the principal invariable concomitance. Tat Ci Di, 1222:14 Dictionary of Nyaya Terms ATT (mahesvareccha) desire of the lord Siva (MaheSvara) Pra Pa Bha, 60:10 (mahodaya) honour, great achievement like attainment of purusartha, Nya Kan, 6:6; Nyd Kan, 6:10; Nya Kan, 7:2 wre werd (matrapadartha) the meaning of the word matra, Tar Sara Di Ra, 279:9 wi (mana) measure, means of knowledge. APL ~ STO Nya Si Mu Kir, 33:31 aenatgaat ary Tat Ci Rah, 366:12; Tat Ci, 67:5; Ny@ Li, 42:1 are (after) (manasa) (Saktigraha) mental grasp of the word - meaning relationship. Sak Va, 98:6; Sak Va 98:8 Aas (manasajfiana) mental knowledge. Tat Ci Ga, 632:2. aa (m@nasatva) the state of being mental. Pad Man, 5:1; Man Ka, 28:4; Va Va, 72:27; Tat Ci Ga, 729:4Dictionary of Nyaya Terms Aaa (mdnasapratyaksa) mental Perception. Tar Sari Nya Bo, 33:15; Tar Sari Nya Bo, 30:16 wa: dare rarer area | Man Ka, 14:7; Pra Ma Samu, 1.6, 92.9; Tar Bha, 123:2 (manasavyaptigraha) mental grasp of invariable concomitance. Tat ci Ga, 315:22 (manasikatva) the state of being related to manas arated snfafaary va Tat Ci Rah, 105:20 areata (manasopanita) that which is revealed by mind, presented by mind. Va Va, 72:9 Ara (maya) false knowledge, wrong knowledge. yarefaaed @ see weTarave fremexaard self at AT Nya Sit Bhd, 305:5 are (masa) a month having two fortnights. @ vait art Nyd Kan, 123:4 321 Tater (miti) knowledge. Tat Ci, 558 Rena (mithyajfana) false knowledge; wrong knowledge. Rent fea: | er gente craft, Tar Sari, 56 fe qrafrerarny? Nya Sit Bhd, 288;1-2 arent Reaarqea | Ny@ Bhii, 581:12 i aM Rear! Nya Mai, 71:9 fa baer: | Nya Li Pra, 761:16 Premera deta act ag setae ar Dha Pra, 33:12 Rammed (mithyajfanadhvarisatva) the state of being destruction of a false knowledge. Nya Si Di, 37:19 (mithyajnananivrtti) avoiding or dropping out the false knowledge. Nya Si Di, 31:19 Pree (mithydtva) the state of being false. Nib (Rat), 112:9322 Reamer (mithydpratyaya) false knowledge, false cognition. aftrernfirre archer fart freanreaa: | Nya Sit Bha Var, 25:9-10; Pra Pa Bha, 176:21; Nya Li Vi, 456:4 frente (mithyabuddhi) false intellect, false understanding, false knowledge. Nya Su, 4.2.37 fretaeter (mithyopalabdhi) false apprehension. Nya Si, 4.2.35 wit youtsatift aaa freatvefer: wafticatat ara | NydSii Bhd, 304:17 (mukta) liberated. eratrict a eq | Nya Bhit, 571:7 wea (muktatva) the state of being free (from bondage) the state of being liberated Tat Ci, 2064:17; Nya Si Di, 36:10; Nya SiDi, 36:15; Nya Si Di 37:16 (mukti) liberation, freedom from bondage ; absolute absence of unhappiness and misery. wee gerard va afrucaadt Dictionary of Nyaya Terms gargs wea fated! Nya Si Di, 37:23 atl dereraimagagae: deere srrguaerat ar afta: | Tat Ci, 2058:5 Waa aanaeralqudiedaaieritatanea fecmtafecrrerca 1 Tat Ci, 2074 aariReongrgersragasdar yf: | Nya Li Kan, 588:8 parerafatine g-acrafessrcaanrat af: | Ny Li kan, 598:11 mea wa yf: a gaede sft arerqoait: | Nya Si Mu Ra, 33:29 ae Ug aU TATA THTSTAS AAT: afte | Nyd Pra, 47:9 (muktitva) the state of being completely free from misery. Nya Si Di, 36:11; Nya Si Di, 37:17 qa (mukhya) primary or principal svirrentara: per, | Nya Pra, 43:21; Kar Ca, 36:45; Kar Ca, 16:17; Kar Ca, 53; Kar Ca, 20:23 Wer (7) (Gnukhya [pada]) a primary word which is used in a primary sense through the primary relationship. credquenrate, a Fer Tar Kau, 44:9Dictionary of Nyaya Terms yeaa (mukhyata) primaryness. Sak Va, 59:10 Gmukhyatva) the state of being a primary action or primary object of knowledge Nya Si Di. 25:6 Gnukhyaphala) primey effect or main result or principal result airengerivarnceatrethy ae yet wet! Nya Si Mu Kir, 8:5 (mukhyaphalajanakatva) the state of not being a producer of the primary result. Nya Va 192:7 aa (Gnukhyavisesya) prime qualificand Va Va, 73:17; Va Va, 73:31; Pa Va Ra, 590:3 TAT Gnukhyavisesyatva) the state of being a prime qualificand. Sak Va, 48:4 (mukhyavrtti) primary relationship between a word and its meaning primary function between a 323 q word and its meaning. Nya Rat, 190:5, 191:5 ef (mukhyartha) primary meaning of a word. Sak Va, 15:2; Sak Va 189:11; Tat Ci Ga, 108:21; Pa Va Ra, 435 (mukhyamukhyavrtti) primary & secondary function of a word and its meaning. Nya Ra, 236:2 W (rumuksu) one who is desirous of liberation Tar Sart Di Pra, 388:3; Tar Ka, 2; Tat Ci, 1089:8 (muhirtta) moment, a measure of time having thirty kalas. Fisreeret ag: | Nya Kan, 123:3 (mirchana) producing insensibility, a particular type of contact. TAT: Tara arate Refer: ahrara: earned: | Nyd Ko. Bao having limited size. Pra Pa Bha, 237: '; Kar Ca, 77:102324 (martaguna) quality of a gross substance re ATT: | (martagunatva) the state of being quality of a substance having limited size Nyd Si Mu Ra, 346:17 ae (martatva) the state of having limited size 9. Iperratasrataorttrery | Nya Kan, 57:2 ; Sapta Pada 136:15 2. aed @ Bravery | Tar Sart Nya Bo, 11:18 Pra Pa Bhd, 24:3 3. aRfescraRamad Reasaaed a airy | Nya Pra, 58:10 wane aiery, crafesrrafeaoress | Nya@LiPra,291:14 aie wre wifasciamraaa, 4 I Srarrrarecbaacntra safes: | Nyd Si Mu Ra, 348:33 - \ Nyd Si Mu Kir, 47:12 eae - qrada aageckarracaae wee | Nyd Si Mu Kir, 94:27 a] Nya@ Si Mu, 95:1-2 qaded g aearantrerorarerdaa snfefagre: | Pada Ni, 25:4 fravrecrendtad aie onfatecata afta! Dictionary of Nyaya Terms Nyda Si Mu Di, 95:13 aot ¢ yerteraaeaPneoye ay | Nya Pra, 79:6 (martatvajati) the universal residing in mitrta Pada Man, 8:20 (martavrttiy existing in mitra / dravya. Nya Se Mu Ra, 346-18; Tat Ci, 824:5 area (murtamirtagunatva) being the quality of mirta and amuirta- dravya areairaferpraaracnterecsy | Nya Ko (murtimat) corporeal, material Nya Su, 4.2.23 (mirtetaradravyatva) the state of being a substance other than corporeal or material Pada Man, 1:10 (mrtprakdra) of the type of earth. Pra Pa Bhé, 42:10 ag (mrdu) soft, tender, delicate Tar Sart Di Ra, 140:5Dictionary of Nyaya Terms (mrdutva) softness, tenderness, the state of being soft or delicate. Softness is the contact between loose parts of a substance. faieraaadart: Yarra | Tar Sam Di Ra, 140. Tar Sar Di Ra 141:2; Tar Sarit Di, 5 aq (meya) fit to be known, measurable Nya Li, 26:1 (meyatva) | the state of being fit to beknown or cognizable. Tar Sarit Di Ra, 294:6 (meyaripata) the state of being in the form of that fit to be known or cognizable (object of knowledge). Nya Bhit, 49:12 wae (mlecchavyavahara) usage of the uncultured Tar Sari Di Pra, 235:11 alert (moksa) liberation or final emancipation which is the absolute cessation of misery. orang aaa Aer: | Tar Kau, 60:1; Nya Si Mu Kir, 26:12 325 sreardét geahrafateter aieettan: | Nyd Si Di, 33:7 fed Serer ws Aer | Nyd Kau,424:18 Tenn sakedmfatien fitters ga Ter Rafetreamrereancat aft drarararsrgera4ey eairRroTeer geierkiegaa a weg aeiaeait Feit aaa | Tar Sari Di, 67:1 ore Hyer: | Tar Sari Di, 64:12 ordered Fret: | Where there is no birth is liberation Nya Kan, 683:6-9 ATARI, Sareea ITTY eA: | Tat Ci, 2065 ‘a afergtcar ater sft Ny@ Bhat, 583211 PERTAIN: PATI Ae: | Nya Bhit, 594:3 safsingae wa safareRrar Tear, aera Aer shar gar Nib, 138:27 AUNT Taare | Tar Bha, 4:3 Wes (moksajanaka) producer of final emancipation. Nya Kau. 442:13 Ferree (moksavastha) State of liberation, state of final emancipation. Nya Kan, 691:10,692:1-2326 Dictionary of Nyaya Terms mera ast (moksopaya) (yananta) a means of liberation, Nya Mai, 91:23 Aira (moksopayatva) the state of being a means of liberation. Tat Ci, 1089:8 are (mocana) releasing, freeing from. Releasing is the action which is the producer of disjunction. Are Nya Pra, 109:20 (moha) insensibility, delusion, error, apprechension. RareTataaesenn Peqeara ae: | Nya Mai, 70:30 renal Fre fa! Nya Bhit, 586:8 Aer Frere! Nyd Pra, 154:9 aie: STE: | Tar Sarh Di, 64:7; Nya Su, 4.1.6 false q a Gari) a grammatical suffix used for reduplication. zash tags! Tar Ka, 100 a finished form ended with the reduplicative suffix yan. Sa Sa Pra, 406:4 we (ar) 1) asuffix. 2) To attempt, to strive for, endeavour, try. Nya Ko. ata (ati) restraint, control, a striver, an ascetic. Nya Bhit, 587:23 at (yatna) an effort, attempt, trial. Pa ta ni, 79:4; Nya@ Si Di, 37:7; Man Ka,86:7; Nyd Si Mu, 491:1-3; Kar Ca, 15:16; Kar Ca, 21:24; $a $a Pra, 3955; Akhya Va, 2:2; Akhya Va, 6:7 aera (yatnavacakatva) the state of being the expressing agent of the effort or endeavour. Akhya Va, 6:1 (yatndnumana) inference of the effort or trial undertaken. Akhya Va, 7:3; Akhya Va, 7:1; Akhya Va, 6:7 award (yathartha) 1) One type of experience (i.e. true experience) out of two types of experiences. @ (agra) fafeeit genseeneive |Dictionary of Nyaya Terms 327 2) Fact oriented apprehension or confirmable to truth is that which is the experience of that thing having a qualifier as possessing that qualifier (This is called valid knowledge). Sarat ware: | Tar Sani, 23:1 aan a cafes - Tererergyacd aarat- qyaet wary | Tar Sari Di Pra, 115-16 3) Try or valid experience. arorafa fafad aaierrrenda, aale aera aera | Tar Ka, 44; Tat Ci, 325; Tat Ci, 735:3; Nya Li Vi, 456:7; Man Ka, 4:3 (yatharthaji true or valid knowledge. Tar Sar Di Pra, 116; Nya Li Vi, 420-4; Nya Ra, 24:4; Tar Sark Di Ra, 292:13; Tar Sart Di RA, 292:14, 313:16 aat . (yatharthajnanavisaya) content of the valid knowledge. Tat sarit Di Ra, 292:10 aad (yatharthatva) the state of being valid ia carder | Tar Kau, 15:11; Tar Bha, 17:1; TAt Ci, 366 gardai (yathartha buddhi) valid knowledge. wala dormers ary! Nya Ko, See aaa ara! (sameas gent am) aa (atharthavaktr) one who speaks truth. (Same as apta) Nya Ko. aa (yatharthavaktrtva) the state of being the speaker of truthful speech. Tar Sant Di Ra, 349:3; Tar Sart Di RG, 315:8 aeratgya (vatharthdnubhava) valid or true experience “aera wake ofa Toreacd aaelgaae way Tar Sarit Ny@ Bo, 23:15; Tar Bha, 188:3 men (yatharthanumiti) valid/true inference. Tat Ci, 1200:7 a (vama) restraining, self control. A yogic concept, the first of the eight arigas of patafijala Yoga. frgiteeon oar: | Nyd Bhi, 588:6,8 isafemer at: | Ibid Ta treated: gers afe-afeent a: | Nya Bhit, 587:16 aa: warrantee | Nya Sti Bhai, 309:4-5328 art (aga) a sacrifice arm: Nya Pra, 109:15 areared (yatharthya) the state of being valid which is capable or fit for producing a volition which generates a result. Eager aes | Tar Kar (Nya Ko) (see 44147) aaa 7 catrecrrasnateoen ar om Pear Teer | (Nya Ko) artefact (yavaccharirabhavitva) the state of existing as long as the body exists. Nya Sit, 3.2.47 (ydvaddravyabhavitva) existing so long as the substance exists. The state of being a counterpositive of the destruction which is produced by the destruction of its locus. SERPS PTTATATT | Nya Ko aad (yavat) as much as, as many as, as great, as large. wraferedat arama: | Vyu Va, 15 Dictionary of Nyaya Terms aa (yavatva) the state of being that which refers to as many as, as much as, as large, the state of being that which encompasses. SIAL Nyd Ko. ae (afr) (yukta) 1) proper, 2) that which is joined. One who has joined his individual self with the Absolute (a yogin) Nva Kan, 465.9, 466:1-3 aed (yuktatva) the state of being yukra Va Va, 74:12 aera (yuktdvastha) proper time, proper stage on situation Nya Sa, 12:8 yr Quga) an age of the universe (world) long time span, time having a long duration. Pra Pa Bhd, 78:19 (Qugapatpratyasanna) those having simultaneous occurence. Tat Ci Ga, 640:1 Great Qugapadavavasthana) simultaneous existance Pra Pa Bha, 135:26Dictionary of Nyaya Terms (Qu tasiddha) that which can exist separately Pra Pa Bhd, 148:17 Qutasiddhi) both the relata having independent existence. qafate: yaafate: yrakatrerart water reereaERa, Nya Kan, 37:1-2 ererrateery | water ar paereneherrera- area gafefee: | Nya Kan, 379:3-4 : aaa SarahS: | Sapta Pada, 152:1 ap 4 Nyd Li Kan, 341:14 ceeded gatas: year a Aa: | Upa, 7.2.13.; P. 426 gag (Qusmad) you, second personal pronoun. NyaKo. gaara (yusmadasmadarthatva) the state of being the content of the words ‘you’ and ‘I’ (second & first personal peronoun). Sak Va ,126:1 a Qiisa) aa fe ae sara seat 329 wrofatere aft saradgerai wasted a: aan a ae fi a ae: eft w aera feat cera | Nya Sit Bhd Var, 79:2-5 am Qoga) a type of primary relationship between a word and its meaning. 1. The expressive relationship which ex- Presses the meaning through its component parts. rama: | Tar Sami Di, 51:18 ureters aaardPretiaatat | Nya Si Mu Kir, 315:9 coferaie: | ae arate | Nya Pra, 102:16 . Samadhi in yoga system BRE | Nya Kan, 464:5; Ny@ Bhit, 586:2 afeenttr Pastner: weareca eRe a: weer nN Tar Sah Di Pra, 38:12 arta (yogaksema) welfare, well-being , aquisition and preser- vation, Vyu Va, 37; Pra Va, 326: Pa Va Ra, 211 apage again | Nya Ko amar (ogaksematva) the state of being an aquisition and preser- vation. Kir Va, 57:16 fait Va, 189.6;330 arm (aired) (yogaja) (sannikarsa) yogic contact or relationship (of the knowledge), extraordinary contact, uncommon relationship. Pra Pa Bhd, 189:11; Man Ka, 28:8 aieert (yogajadharma) merit produced by you Tar Sari Di Pra, 143:13; Tat Ci, 545; Tat Ci, 853:8 (yogartidha) a type of primary word which expresses its meaning through the relationship of yogariidhi (having) both avayavasakti and samudayasakti) anh ve ffi - dred ad dif a drred uesiferes | Man Ka, 80:10; Tar Sam Di Pra, 248:19; S$ aSa Pra, 72:3 feat arred - ererafrarsaaarats iar Ramsden aft: arrefe:, oF ve arrectirad: | Nya Si Mu Kir, 315:12 crageerdaterh arrest, agente | Nyd Pra, 103:3 aa a aaaatafasd aqcrnfecaes werreey | Nya Si Mu, 316:1 b (yogaridhi) one type of primary relationship where the word is used in a conventional sense to which the etymological sense also is appli- Dictionary of Nyaya Terms cable aifterd - aferrenterntatarerdtrenrancd we: arreect4 | Nya Si Di, 59:22 vafragualsaaargaarsi aay aa) Tat Ci Sabda, 635; (Vol.4.pt.3) qrerairasaaarats Faatasrengars area safe: arrefe: | Nyda Si Mu Kir, 315:12; Nya Si Di, 16:15; Tat Ci, Vol.4.pt.3: 739:7; Pa Va Ra, 310 arretea (yoga-ruidhi-tva) the state of being conventional and etymological Tat Cin Di633.16 afar (voga-vibhdga) a technique by which a sira/unit is dissolved into parts for the convience of interpretation Prama Var 39.3 (yoga-sadhu) proper to be used (in a sentence) fagranfasttrg array: | Naii Va P. 190.19 aPTeaTe (yogacara) follower of a particular Buddhist ect. Nyd Li Kan 461.14 apres (yogaruidha) a type of yogin who has attained the yoga. Tar Mr 88Dictionary of Nyaya Terms ater (vogijfiana) knowledge of a yogin ‘yar atari ata! Nya Bin 1.11; Ny@ Li Pra 476.7 ar (yogin) a person who has attained yogic powers, who has supernormal powers. 1. sifercar ara afer: | Powers of a yogin are beyond imagination. 2. The argument put forward to establish existence of yogin is as follows - fe qralfreqra way? Seat TeHToTa: weafrarat: ACI FEAT | Tar Bha 170.4; Pad Tat Nir 31.3 eh (yoginam-drk) intuition of a yogin 9. attri gordereitirnciara a, Pramd samu 16 ‘Tr. the yogin’s intuition of a thing in itself unassociated with the teachers instruction is also a type of perception. air (yogi-pratyaksa) perception of a yogin. A yogin perceives 4 thing not in a@nofihial way as other humans perceive, Therfore it is called supernormal perception or yogic perception. It does not involve contact between the object and the sensé organ. afi g trnrecafperineay | Nya Sa 21.1 Yogic perception is a means to know 331 ‘objects far away in space, time, state Nya Bhit 87.10, 172.15; Tat Cin P. 545 ara (ogya) compatible Tat Bhd 56.2; Pad Man 20.13; Tat Cin P. 372, 857.9 areaat (Qogyata) compatibility, one of the factors facilitating understanding of sentence meaning. 4. It is a relation between two objects wanaisoererinaer draan | gar ae feafa | or cee eure Sats | Nya Pra 114.19; Nya Si Muk 346-474 2. arerasrnfereel deere | aa afer Peete se araaatisaraand | Tar Ka P.85 3. Uanadsarerident draa | Tar Kau 45.11 %. wernt area | Tar San Nya Bo. 53.8 4. arated aia areaedarea: | safer area | Tar San P. 52 &. Teawafael aaa! at aaz yard det somrerifrorerarantratting ~ senfergtercarra: | Tat Din Sab.262.1 ‘9. Meera ssaafadt fesse aT area | Tat Cin 1459.15 aba a aragearet aanfaiead araaeahcarrraggrar | TatDip Ram Rud, 281.19 8. aagag aemateri & draar! Tat Cin Pra. P. 347 S332 90. aRpagemtates-mataattrererenresrarat aera starters wafer at erat | Sak Va 141.4 so.umaetsucardard diva sft aa aaahaaeae TassAcaTa feo srecieg: | araPaanaat araer sf aaa g merada dram aaaheie fee! Tar Dip Pra 255.20 9 .orraaraarRel area gare: | Tat Cin. P. 1885 93. 7a arenichfmerda: werdantarcit area sf Ste) waved arozuarhiet ua dram, Tear: aaraereent at rere wart! Man Kan 704 98. SrA AAT | Nya Li Pra 528.9 94, Saat a TOU TATA: | Tar Bhé& 25.2; Tat Cin 857.10; Nya Rat 11.12, 115.6, 10.3; Tar Bha 88.2; Nya Li 410.2, 192.2; Sak Sak Pra. 11.4 ahaa (ogyatajndna) cognition of compatibility, Pad Man 29.10; Tar Di Ra Ru 342.2, 342.6; Sak Va 73.1 ara (ogyata-tva) the state of being yogyata Tat Cin P.1359./818.5 (yogyatd-viraha) absence of compatibility Nya Rat 154.3; NyG Kus 242.2; Tar Dip Ra Rud 341.3; Sak Va 145.8 Dictionary of Nyaya Terms arat (ogyatva) 1. The state of being compatible 2. In the context of perception it is defined as- vifarraratcH re faa hats arr rae, ontifaoniteraed art NyaSi Mu Kir. 99.18; Din 98.9 areata (vogyadharmin) a compatible object Tat Cin 458 aratag (vogya-visesa-guna) a particular quality to be compatible of something (perception ete.) Nya Li 186.3 arerdiradt (yogya-sannikarsa) relation (ifr) with a compatible object. iPreait araferateoct ewuie | Tat Cin Rah 580.10 (yogyanupalabdhi) non-cognition of a thing which is compatible to be perceived. Naiyayikas do not accept erpyefea as an independent means of perception. How- ever, the mimannisakas accept it as such - 9. SrTareeTar Naren fear eT: | (Nya Ko) Tar Dip Pra. z x 7 faftreenfteiequerina: | (Nya Ko) 2. AL eared: garoraecaragtat aerefecarai Teuareaanae:, HA Ay gfDictionary of Nyaya Terms Sea MTARTTa, aaa AT ongagt oieférd: drarqued: sf weaken Pate: afiterrned + auata | Tar Dip Pra 142.2 ‘Mima rhsakas view is expressed in the following argument. cron! Afar, Bra ara aquest: aenrarrerd | Tat Cin P. 673; Nya Rat 51.2; Tat Cin 684.4; Abha Va 185.4 y, SPAISEAIS AT: HRT: | Tar Ka 63.20; Kir 57.15; Tat Cin 856.2, 107, 733.4; Tat Cin Gada 674.15; Tat Cin Di 540.10; Rat Kir Nib 108.23 arate Gogyopadhi) a compatible condition Tat Cin 107. (yogyanupalambha) non apprehension of an object which is fit to be perceived. ; ears Se BRU, + TESTA sree ara: | Nya Li Kan 415.5; Kir 67.21 ‘A compatible condition Tat Cin 107. art (yonija) born out of womb, akind of body, produced by mixing of sperm & blood. gant: weer, | Nya Pra, 52.11 (Nya) Tar Sam Din; (Nyd Ko) Si Ca 333 q ahr Qaugapadya) simultaneity 9. Sra Te are | Sapta Pada 95.3 Relation of many with same moment Nya 2. Uaareghiey | NyaKo, 3. Crater | Tar Bhd 30.2; Nya Li 198.2; Pad Va Ra 744.9; Man Ka 70-72.13; Pra Pa Bhd 135.20, 76.6; Nya Rat 178.13; Tar Dip Ram Rud 312.9; Kir 116.6 aifrs (augika) a word which denotes meaning expressed by its coustituents, showing coustituent meaning. 9. ud erage airs, Tex, dre, aiffrmsd aft dm: areca lie wera oer | ae urea Fez Tar Dip Pra 248.17 urease arn great ore | Tar Ka88 . Bee wamde dred a are wagat wt waite washer | Sak Sak Pra 72.3 ¥. Grader | Delimitor of the meaning objtained through constitueuts. Tat Cin Gada. 634.9 4, arrears dere arm aire | Sak Sak Pra 187.5 &. Gauarafic afters, aralfe Nya Pra 103.2334 9. wa saad wa gerd aeifirey, aa areata | Nya Si Muk 315.2 ¢. sraafersarandtretaa aferatt: | aiPrarss vay arene: | Nya Sid Muk Kir 315.9 8. dts gufecetaateer| ext, Mani Ka 82.4 qo, saaaaiaraT astra | Tar San Ni. gaa abiferani area grearkaraaatd oft &q: Terr ares aires | Nya Ko alfred (yaugikartha) meaning of a word denoted by its constituents. Tat Cin. Sab. 593.2 aitrerca (yaugika-tva) the state of being yaugika. Tat Cin Gada 631:1 (yaugikaraidha) a word which denotes its constituent meanings as well as its colloquial meaning independent of each other e.g. the word 3f%4 denotes trees etc by its constituent meaninge ic. 3% + f4%. It also denotes a particular kind of sacrifice by convention. 9. aa ¢ afterdacia: areca ae:, Taitreeaq| sat seftrarierey | Nyd Si Muk 318-3193 Dictionary of Nyaya Terms 2. Sefraad afd: aeyen:, ee amnfadreer ary! Tar Las9 are ayaa a oeerrAeTaT fafterdotraes wget | den safrasey ar TeRA:, sem g amare ara | Tar Dip Pra 248.20 *. Serra ere alae airy eahafeaie gare sen safes arrafa | Nya Pra 103.12 4. Meriemsrcaad ayant: caer: aitrste:, aired vd ditraeciicae: | Nya Si Muk Kir 315, 13 oe Tift a agé a ofa apafereqddar (Nya Ko) Ni. ©. TM Beat a Teeraeartoy arelaferareat | Nya Ko Nya Si Muk; Nil. o (yaugika-ritdhi) the state of denoting constituent as well as conventional meaning. srermfert - oremardaqarndd: carafe: “anftrarete: | Nyd Si Muk Kir 315.13 amd (yogartha) meaning of the constituents. Sab Sak Pra 185.5, 173.4; Pad Vak Rat 257; Tar Dip Ram 335.8 x Tat (rakta) red, One of the colours (ea) g afeeriarg aafeery | Tar San 14; Sab Sak Pra 452.5; Pad Man 13.19Dictionary of Nyaya Terms 335 (rajas) one of the properties of the world. gard Tt | Nya Matt wa (rasa) taste one of the twenty four qualities, that which is perceived by tongue is called 7. It is of six types. Itresides in the earth with all six varieties. In water only sweet taste resides. 9. Tea YoU Wa) A a HELeS-wao ag eae Fara vefa: | oR srefe: | Tar San 15 9. zaakeemr ar: | ydtoregte: | Tar Bhd 155.1 3. cement ash: FT (Nya Ko) Prapa Bha Upa on 3.1.1 6, TEAPTAMEALTE: | Tar Kau 9.12 . cg, CARS THAT HEMT AEET | Nya Sid Muk 388.3-4 eg. Tea heaaregferyrerareeT fr, TE: | Nya Pra 66.3 co. CagferureTeTaTaT TAL | Upa on 7.1.6 c. te: Tafel aeeTe | Pra Pa Bhd 32.2.12 eta: vara: «6 yfeeqae git sferry feet! carraeare | HERP eeA MTHS HTT ACT: | Pra Pa Bhd 1168 go. waenerarhy caamret gt Ta: | Sab Sak Pra 70.22; Pad Man 16.4; Tat Dip Pra 104.3; Nya Li Pra 472.15 TATE (rasagrahaka) the sense organ perceiving taste, ie. tounge. Tar Dip Pra 71.11 wat (rasatva) the state of being taste vas Peanraaraarare eiasaanta: | Terres Ter! Tae aes Ta | Upa on Nya Si 7.1.6 It is the state of being an object perceivable only by the tongue, Pad Man 16.17 a (rasana) tongue, one of the sense organs 9. Taree ed vei Prenat ward wracamaael a eaey wasAe THT afrasaran wea! Tar San, Tar Bhd 127.5 3. US Bae ea: She TaTTATATTT HPOL! (Nya Ko) Tar Kau 3. Tees Heer | Nya Mafi (Nya Ko) TT (rasand) tongue femi. of TT Same as 74 Pad Man 22.18 wT (raga) attachment, it is one of obstacles in the true understanding of the universe. It originates because of false desires,336 9. doctitrcara wre | Nya Sa 4.1.68 2. Renee verte aera tet oe aude: serra |... gataetiiira a wrdiarsete: | ad frearasacarat eR: | Nyd Si Bhd 285.5 onward, 286.4 a. uF fe Preaqaretacstartatea afar areraerfaaeaTg: | PraVar 51.9 vy. aenferearoit TT: | Nyd Bin 586.8 , There are three types of dosas, namely, a, ay, Ae agpeatation wavit a: | ‘WT is that which is desire to posses the desired thing. Nya Mafi 70.29 &. Tagawa UW: | Pra Pa Bhé 250.5 19. UT: Fe | Tar Dip 64.11 Itis desire 6. Nya Pra 154.9 8. SHEVT TT: | Nya Pra 74.18 90. fermenter a7: | Nya Pra 110.5 99. arefeteait ere: | Vat. 4.1.3 wrt (rdgaprapta) obtained by attachment /desire Tar Dip R& Rud 93.6 ua (ratri) night 3. Preetadivatziaeiaans: pretest Dictionary of Nyaya Terms lahat | Kir 13.13 Itis a particular segment of time, in which the rays of the sun on the earth are set a side. Tea (rdsana-pratyaksa) perception of taste by tounge Pad Man 22.18 ofa (riti) convention, custom Akhyd Va 32.4; Pad Tat Nir 79.7; Tat Cin. 879.2 fa (rici) liking Sifter! NyaKo ee (radha) conventional 9. Bie: aaeaafee: | aTBwTsaR ee | ae rater | Tar Dip Pra248 The word which denotes a particular meaning collectively i.e. It does not expect meaning of its constitutents. . Tarkass fasnieud sear areorarerny | 3. waaaraafie Ge) gar fesnfaaay | Nya Pra 102.20 %. Tamaatatea ayer get Wee! gar Thavserfeaey | Ny@ Si Muk 315,2-3 4. Ceres arena Taerndtetimataa: fe, afer oe weftadl: | Nya SiMuKir315.10Dictionary of Nyaya Terms &. Sealer orlafraed wy | (Nyd Ko) Ni 19 ©. aa sem asaiadta a g area TES! Nya@Ko ¢. seperti agerasacrelateary | Mani Ka82.1 (radhayaugika) sameas . Fe wedi Fens hry | Sab Sak Pra72.4 wes (ritdhalaksana) same as FRRECT ward (radhartha) conventional meaning Pramda Var 598.4 ats (rahi) convention 9. ayaragrnt fe: | Tar Dip 51:18 Nya Pra 102.16 2. reper aqarariPretiaartaa: ae: | Nya Si Mu Kir 315.10 wea (radhika) sameas riidha,ie. conventional 337 qarifraahrrs frelon y | care gaat arg hae oer, Prater aaa, aera | Nya Rat 231.8 (ritdhiparvika) sameas Sewer wa weed waft oer area a wfé offer veer ameaning related with conventional meaning. Tat Cin Sab 712.12 Sewer (ritdhilaksana) same as Freceamt Nya Ko ead (ridhyartha) meaning of ri#dhi, conventional meaning. Sab Sak Pra 173.4; Pad Vak Rat 257 wet (ritdhyartha-ta-vacchedaka-td) the state of being delimitor of the state of being convention all meaning. Same as ae Tat Cin Gada 634.1 wa (riipa) one of the twenty four gunas, form or colour.It exists until the substance exists. It is pereceived only through eyes, 9. a ar Tar Kau 98-9 2. Caplel wagd sentoTeRTET | agU: weahe aregeeearae | | Nya Si Muk 380.1-2 (338 Dictionary of Nyaya Terms 2. RRR TTT STF | Nya Pra 654 %. Tree ngUeTy | Nya Si3.2.47 MIFST I SF BRIA! Pad Man 20.7 ereonirreetamal api er Sab Sak Pra 708 ©. agriamret fader: | yPrentaaafe Tar Bhd 154.1 It is a special/particular quality perceived by eyes, which resides Prihivi, ap & tejas, ¢. aaptament asd: aga | Upa on 3.1.1; Tat Cin 823.3, 603; Tat Dip Ram Rud 113.3, 106.3; Tar Ka 26; Pra Pa Bha 14.12; Tar San. PS. £ s (vipa-grahaka-sapeksa-indriya) Nya Li Kan 478.20 wt (riipa-tva) colourness, 9. a | SITY | Upa on 7.1.6; Tar Dip Ram Rud 202.5, 225.4; Ava Nir Jag. 5.6-2, 105.8, 105.4, 105.1, 105.7 STMT (riipa-naga) destruction of colour. It takes place because of the heat. Naiyayikas opine that FH occurs in the product level. Whereas the Vaisesikas say it occurs at the atom level. Tar Di Ra Ru 2077; Ny@ Sid Dip 31.15 era (riipa-hani) harm to the very nature of a things. 9. Peamraanivenrcaranceam fasiver ner | gat ere dtenetaacre et: | Nya Si Muk Din 58.13 2. elerariararrerare: fades onferrea | Tar Dip Pra 57.11 (recana) coming down to earth, to descend. One of the types of motion which is included in 7M. 9. UR rerregferearrea ory | yd Si Muk Kir 41.28; Pra Pa Bha 15.4 at (recana-tva) the state of desending. 9. Sfextarrreraricay | Nya Ri Kan 680.9 “3 waaay (lakara-vacya) expressible by 3%R/ verbal forms. Akhya Va 9.1 varerd (lakarartha) meaning of a verbal suffixs. 9, oa westeaTeaaTRTOT Gs aeHfOT a] ae eT aHeHHT ft au aarreagiert ada: | Vyu Va 194 Being subject in general is the meaning of ten types of verbal suffixes. Pad Va Rat 502.15Dictionary of Nyaya Terms 339 CAB (laksaka) one of the types of words, the word which denotes extra-conventionl meaning word conveying secondary meaning 9. aa agerh aH cesfaa faae afel Sab Sak Pra 133.2 A word conveying secondary meaning does not have primary relation with the object . The secondary meaning is different from the primary meaning. Sab Sak Pra222.5,72.3 2, parmnfafrerenrcarmaeaeT | Sab Sak Pra 154.5 ‘There are various types of secondary relations, therefore there are many laksaka words. wat (laksana) definition 9. reat - srferente - srine cagsorserteatt epi er Tar San 4. Nya Sid Muk Kir 35.34; Tar Dip 4. a definition is a property which does not involve the faults narrow- application, over-application and impossibility. 2. BHO, FATATEA | Tat Cin Rah 542.12 It differenciates the definitum from others. were ae wey | Nya Si Mu Kir 36.22 Itis the state of being a property, which is different from the delimitor of other Nya Si Muk Kir 36.12 . ee ceeaeat ait we! a 93. definitumness and which is different from separation(?) which pervades same of the delimitor of definitumness. q, Teas ATIC | Nya S@Bha 103-4 A property distinguishing the nature of the definitum from others is called @ SAAT Bary - aa TN FETT | Nya Kan 403-4 vee errands et war | Nya Kan695 . Cie areTTa ei way NyaMai29.9 . Savy Se wed AA TART watasata fad g + aritt agra ‘afer Nya Sa Bha Var 29.30 ; Li 18,90. . Barat | TATEATROTETE | Tar Bha64 - Aaiseneanfrease Fever eeteratststt we qa! Ny@Li748.1 warnfiiis: erated: | Tar Dip Ram Rud.255.15 SATIRE Se | Tar Kau 59.5 Nya Pra43.5 guattd fe vant zg cams INET | Tat Cin 1852; Tat Cin 549.2, 630.9, 17.10, 412; Nya Rat 89.12, 20.11, 177.12, 148.3; Nyd Kan 21.4; Kar Ca 42.54, 43.55, 56.71, 17.19; Dha Pra 36.23; Pra Pa Bha 133.1, 42.9; Ny@ Li 120.1, 139.1; Tar Dip Ram Rud 290.4, 116.2340 BATT (laksana-tva) the state of being Jaksana. Tar Dip Ram Rud, 147.3, 116.2 9. CaO a TIENT | NyaPra 130.2 The state of being definition is being distinguished from everything other than that (am) 2. wae a cnadard aa fadreraraen Tarr oTATEaTa TCT | Vyu Va 167 CANTATA TT (laksana-vyavasthapana) settling of laksana wares afr ae: | Nya Si 4.1.36 SATS ATT (laksana-laksana) definition of definition BeTSRTT Tere aa ATETISTY afraartrerd | Nya Bhi 9.1 Definition of definition distinguises the complete class of laksanas. Ca (laksana) arelation between the word and its referent denoting secondary meaning e.g. in ‘77a Ws’ the meaning ‘bank’ is obtained because of aT 9. meee Ber | Tar San Nyd Bo 52.7 2. RUT sTeRTTerRATeTag TARA: | Nya Si Muk 319.3 Dictionary of Nyéya Terms 3. wRedg ugai sferaiaty se Nya Pra 110.7 The relation between the words and their primary meaning is Sakti end the relation between the words and the other meaning is 1 %. aus are many waur fafeerenftcersearetann | Sab Sak Pra 154.5 4. ae srphiarerata aad eal Sak Vad 188.14 Tat. Cin Sab.660.2 ©. vant safe: serra wero | agra aie gaa TeIeaTeDTeEeeS derahera ARs afsrt seat) Gera waver: TER SeUrMTars faat eI | wa Pfaeanl segesmegeon oecTERATOT afer Tar Dip Pra Secondary relation is of three types. 9. FERAOT 2. STEAM |. IeTTERRT 6. afaféen) arcana war gar agra ais: wfvaata gaa ngraeréf vane HGreaATICaT Ager AY Sav BRAT | aa gen saferd dit ata: sfeaafe qeraaateit rate | Tar Ka87 8. van fafen | Teeaaismeraal a1 Tar Ka90. 90. wear fe wan, @ a sateen WL; FAP: | Tar Dip Pra242.1 99. aed waon a geafe: | Sak Va 1.4; Sak Va 104.3, 60.4, 163.10, 187.12; Nafi Va 193.10; Tar Dip RamDictionary of Nyaya Terms Rud 271.5, 85.9; Tar Cin (Upa) 74 13.6, (Pra) 104-106; Akhya Va 19.2, 2.3; Kar Ca 11.11, 24.29, 33.40, 33.41, 34.42, 3442, 36.44, 3847, 39.48, 70.92 83.10; Sab Sak Pra 244.5 SATA (laksanabhasa) a faulty definition aegad ward! Pra Patt (Nya Ko) oltta (laksita) the secondary meaning conveyed by laksand. 9. waar ase: sa, safe: Nya Ko 2. ware: THI Nya Ko olarearearerl (laksita-laksand) 4, TRTATTTTRTT GATT SRA ERTOM | TAT favanfe | Ny@ Pra 111.12 The secondary relation which is an indirect relation with the primary meaning is called 2. wat Aa Sroferyasre Gra: | Nyda Ko 3. as ofaratt wandered, 7g send: | (Nya Ko) Dina vy. qweatafseri wa a aa wear RAREST SAO AT Nya Ko.; Pramd Var 195.6 Cea (laksya) A) Definitum B) Secondary meaning. 341 q 9. waren atezitsa: | Nya Ko 2. aghees wa aT! Nya Ko; Tar San Nya Bo 7.18; Tar Dip Ram Rud 257.7, 251.7, 257.3 Bera (laksyata) the state of being definitum. 9. a a cemaiee: a1 Tentafeoen eee | Tar San Nya Bo 7.20; Sak Va 188.4; Nya Rat 88.3 Baa (laksyatavacchedaka) A) delimitor of definiendumness B) delimitor of secondary meaning, impli- cation. A) Tat Cin Dip 952,4; Pad Man 13.1; B) Nya Rat 88,3; Na Nya Sys log 34.31 Va (laksyatva) 1. The state of being definiendum 2. The state of being secondary meaning. 1. Tat Cin 584.16 Tar Dip Ram Rud 125.13 ved (laksyartha) secondary meaning 1. Pad Va Rat 121 2. Sak Va 182.9, 164.2, 24.1 cat (laghu) logically simple, wate oat et ga aeHrerg | AVa Nir Jag 1.1; Pad Vak Rat 205; Ava Nir Jig 3.1342 wat (laghuta) the state of being simpler property. Ava Nir Jag 29.1 wget (laghu-tva) A) the state of being most economical smallest / simpler property. B) lightness (absence of 41) A) 1. Tat cin Man 31 B) Tar Dip Pra 57.13; Tar Dip 5.2 2. ard a trary sohbet ware a Nya Si Muk Din 89.11 Laghut va is of three types. 1. Belonging to the body e.g. 4eta 2. Belonging to appearence e.g. we in comparison to riipo eat Capnidharm) logically simpler/economic property Tar Dip Pra 219.1; Ava Nir Jag 6.4; Na Nya Sys Log 21.15; Vyu Va 33. we (lan) group/Class one of the verbeal suffixes which denote past tense. It is metalinguistic termi- nology 9. ar erat feat are: ererrenefertfay | ontiacané @q: aett fre weed Sab Sak Pra 431.15 That which denotes past is called Suffix 2. wistenmrariacene: | Tar Ka 94. Dictionary of Nyaya Terms wal (lajja) shyness srabttcrcaarniet arias ea | Nya Pra 1103 A particular kind of cognition which de- pends on the cognition of having form of self-blame. we (lap) a class of verbal suffixes denoting present tense, it is a metalinguistic term coined by Panini. 9. TexinReuahtarecreararnies sre opr Rrra akarafaar va we we: safe: | Vyu Va 202 The suffix denotes only that period which is delimited by the time of utterence. 2. Wa Be We aera safe: | Vyu Va 202. wa (Jaya) a kind/ stage in salvation. 9. wae foyer: | It is destruction of fegarére Tat Cin 2072.6 wr (lava) a particular segment of time, consisting of two moments, aurea Ba: | Nya Kan 159.4Dictionary of Nyaya Terms want (lavana) salty, one of the six types of tastes. See also %4. Tar San 15 wrertoras (laksanika) belonging to laksana, the word which denotes meaning by — secondary relation. 9. warorar areata: Te | Nya Ko; Pad Va Rat 291, 121; Sak Va 182.8, 192.9, 8.5, 23.11; Sab Sak Pra 220.4; Akhya Va 7.5 orat (laghava) 1. logical simplicity. 2. Lightness Tar Di R@ Rud 114.9, 119.3, 205.7, 203.5, 200.3; Tat Cin 645.16, 653 Mani Ka 12.3; Ava Nir jag 33.1, 9.1; Pad Man 5.5; Vis Va 73.22, 76.12; Tar Dip Pra 166.2; Kar Ca 43.55 Seealso Bari, BIR (laghava-jfidna-sahakrta-anumiti) inference accompanied by knowledge of smallest property. arrueniakoster areal eraraemtafes STATA TT TART AaePAATAATAT faaremfafeoateaaarghte: | Nya Ko (laghava-tarka) simpler oreconomical argument. Tar Sari Dip RamRud 203.5 343 ‘ ay (labha) obtainment, Se Br: FRA: | Nya Pra 109.5 An delimited by selfness. (in) aclass of verbal suffixes denoting optative as well as imperative mood. 9, eadiern fatal araf fire fegera | Sab Sak Pra 410.7 The meaning of fafaf&g (optative mood) group of suffixes is well discussed in various philosophical disciplines 9. Rear 2. piraeaer 3. aeaefrengattra ‘These are the meanings of the lin suffix Tat Cin 280-281, 284-285, 307; Nya Si Dip 77.4, 75.18 2. fee aeafered: | cenger cerita | Vyu Va 206 (linga) A) Probandum, reason, one of the steps in syllogism. See also @, WH 9. anf verriorataya | Tar Kau. 27/5 A reason possesses vyapti and paks adharnat 2. Safafafirereenintataeey: fer! aan aR: orate &q: eeridrer | Nya Pra 943 3. wataes dened vrai fey! Tar San Si Ca P. 72.9 That which reveals concealed object by pervasion.344 «“ . a weaiisal feyad waa orate ee! aa Vee Nyd Mah 283.2 4. aegis aad ofee a aca wena area alee | Pra Pa Bha 193.18 That which is related with probanse and that which is well known as linked with it. eaferaerners Re Tar Bha 52.5 ©. frenfir a aida feght! srgrefer:, wana: ard afer | Nya Bin 2-10,2-11 . fega’ me ararel: fe fowl Nya Bin (Nya Ko); Nya Li 418.3, 405.3; Sab Sak Pra 11.5; Nya Rat 8.2, 1104, 54.5, 120.12; Nya Sid Dip 60.1, 575.5-6,; Tat Cin (na) P. 19 1308. 20. ; Pra Pa Bha 197.7, Rat (Nil) 36.5; Tar Dip Ram Rud 272.2, 274.12, 1522. B. Gender 9. aiegatt gfeg adrafeg fifi Pra Sab Sak Pra 275.9; Pra Pa Bha 74.5 &) ger arent gets | Dha Pra 21.6 ” S (linga-karana-tva) the state of treating a probans as an instrument See also RW, TIE 9. fogarorend vemst wa azarae, verse g9 arrerceae, aaron, ef 7 THO Tat Cin 767.3, 1284 Dictionary of Nyaya Terms (linga-jana) Tat Dip Ram Rud 272.5; Nya Rat 9.1, 120.12 (lingajfanatva) the state of being cognition of reason. Nya Rat 125.6 (ingata) the state of being a mark or reason or probans Nya Ra, 197:1 (lingatva) the state of being a probans or mark Tat Ci, 709:1; Nya Li, 61:4; Nya Si Di, 36:17 feguerst (lingapardmarga) confirmatory cognition of ue probans. var fe waata yeiresiay weranél ate yer aed Tere Ut afters: wdd a saree’ erefa aa Tar Sari, 37 aa: Hera Te gy ee afer enfrerent aaa anfeanetinersrt afgeara quarry sf ways: | Tar Ka, 72; Tar Bhd, 59:3; Man Ka, 10:1; Tat Cin. 760:11; Tat Cin, 711:7 examination/scrutiny of reason Nya Li Kan 495.11Dictionary of Nyaya Terms fey (lirigabhava) existence of reason. Nya Li Kah 245.10 (liriga-bheda-Nydya) a maxim called fete Tat Cin Gada 1118.14; Tat Cin Did.1118.5 foxereie (lingaSarira) smallest body. Symbolic body fegfiederifsanr va venga gerTzar Hara qagvaracbearicag: | Tat Cin 2072.6 the subtle body of the person which accom- panies the individual soul not destroyed at all. _ Tat Ci, 2072; Nya Si Di, 34:22 TATA (lingabhasa) appearing like a probans; a faulty probans Nya Maii, 26:9; Tat Ci, 350 saTeaCT (lingabhasatva) the state of being a faulty probans. Tat Ci, 1634 (lingin) probandum aa fest wager - rifairet eit area, a va Feit! Nya Mafi, 309:14 345 ( (lingopadhana) the existence of probans on a subject fogrofed vat oifmer area AAI Nya Ko. (lingopadhanamata) appehending the probandum along with the probans ona subject. Nya Ko. «ip name of the reduplicated perfect tense. feeisteamea waa odie ceca: Tar Ka, 94; Sa Sa Pra, 434:10; Sa Sa Pra 435:9; Nya Va, 206 oe (luk) A technical term in Grammar to express the dropping of suffixes. & (lun) aorist tense in Grammar refering to long past. Tar Ka, 94 arrears: | Vyue Va,205 weg aetarnete wer gered: | Vyu Va, 205 & (up) first future tense in Grammar sista | Tar Ka, 94 wasreaereras: | Vyu Va, 204346 Us (un) sometimes past tense sometimes future tense. arraiearn ara egisd: | aad at safe afer wet ‘area | Tar Ka, 95; Sa Sa Pra, 438:15 E (up second future tense in Grammar. ved wise, ce feamoomrasiedrg aie | Tar Ka, 94; Sa Sa Pra, 438:15 om (lekhana) the act of writing or scratching. ear! Nya Pra, 108:11 (lehana) the act of experiencing taste of liquid through the tongue, the act of licking. Rrerecorat oer Nya Pra, 108:7 (laingika) an inference which comes after seeing the probans or a mark. Pra Pa Bha, 193:6, 134:15; Nya Ra, 123:1 we (loka) the world, the human race, mankind. Tat Ci, 108; Tar Bha, 96:2 Dictionary of Nyaya Terms Stafaes (serra) (lokoviruddha) (paksabhasa) generally not accepted by people. Where there is a faulty subject Nya Pra Si, 2.20 ote (lon) imperative mood in Grammar. aniféssrerat atires fara | Tat Ka, 95 at (lobha) greed, covetousness. faftrecerretren a1: | Nyd Mait, 71:3 (lohita) red-coloured Pad Man, 14.4 Cifes (laukika) one type of perception caused by normal or common way (contacts) wera fafa - Girne Ata Tar Sarh Di Pra, 143:5 One type of contact which is between the sense-organ and the object. afrada dfeaistiimea, difeae afer: Tar Ka, 65 qeafagermren: | Nya Si Bha, 1.1.25 ifemarrord yer diy | Nya Pra, 91:21 One type of sentence ara fafaery| afta Sifter | dich ward FAT! Tar Sart 153347 q Dictionary of Nyéya Terms (laukikakdrana) (laukikavisayata) ordinary cause, common cause. ordinary contentness. Man Ka, 2:12 Man Ka, 14:9 (laukikatva) (laukikasannikarsa) the state of being ordinary, the state of being common, usual. (laukikapratiti) ordinary experience. common experience. Nya Li Vi K, 132:13 at (laukikapratyaksa) ordinary perception generated by the ordinary sense-object contact. Tar Sart Nyd Bo, 15:10; Tat Ci Ga, 638:29; Pada Ni, 42:4; Va Va, 101:26; Kar Ca, 71:14; Tar Sath Di R@, 201:5; Pad Man, 23:11 (laukikapramana) ordinary instrument of knowledge, common instrument of knowledge. Tat Ci, 49-50; Tat Ci, 51-52 itera (laukikavakya) ordinary sentence. Nya Ko. (laukikavisaya) ordinary/common object of knowledge. Pa Va Ra, 287 ordinary contact of the sense organ with the object which generates the perceptual knowledge. Va Va, 73:10; Tar Sath Di Pra, 16:17; Tar Sam Di Ra, 251:10 Vifeaearcar (laukikasaksatkara) ordinary experience (perception) through sense-object contact. Man Ka, 14:4 (laukikavisayatdsambandha) the relationship of ordinary objectness or contentness. Tar Sam Di Ra. 114:3; Nya Si Mu Di, 190:13 a (vaktrjnana) knowledge of the speaker apaand aaadart apa | Tat Ci Rah, 343:11; Nya Si Di, 28:17 (vaktrbuddhi) knowledge of the speaker (about the sentence uttered) Sak Va, 105; Tat Ci Ga, 57:26348 za (vacana) an utterance, speech. Sa $a Pra, 278:7; Nya Ra, 56:2 TART (vadhyaghatakapaksa) in the subject where one property is destroyed and then it also destroyes the other one subsequently. Pra Pd Bha, 133:1; Pra Pa Bha, 135:3 FATA RSA (vadhyaghatakalaksana) of the nature of destroyed and destroyer Kir Va, 133:4 aeererenteretet (vadhyaghatakavirodha) contradiction of the relation between two qualities which are destroyed and destroys. Pra Pa Bhd, 135:25 areata (vanaspati) tree, herb, fa! Pra Pa Bha, 42:11 wr (vamana) Vomiting The activity that produces that contact with upper direction, starting from the cavity of throat. NyaPra P. 109:7 Tere (varunaloka) the region of varuna. Pra Pa Bhd, 48:6 Dictionary of Nyaya Terms at (varna) phoneme, letter, colour. Tar Sam, 54,21; Tat Sart Di Pra, 259:3; Padat ni, 32:7 aotsert (varnalakgana) characteristics of a letter. Pra Pa Bha, 262 (varnavikdravikalpa) option of the change in a letter or colour. Nya Sit, 2.2.45 (varnavagahini) in which a phoneme in the object. Tar Bhd, 93:2 aererT (varnyasama) a type of property, a kind of fault involved while presenting an argument by changing, the letters. Nya Bha, 5.1.4 A type of jati. Ny@ Mai, 177:20 aoc (varnyasama) ore erie cere ga weer awe | Tar Sara Di Pra, 340:4; Nyd Pra, 156:18Dictionary of Nyaya Terms ada (vartamana) present (time) A thing which delimits whatever time that is called present for that particular thing. aa f Sq a: ardisalioad @ wea ada | Vai SaUpa 2.2.8 erg adaredasrrarenstectraatear: we: | ‘That time which is delimited by anon-counter-positive of the present destruction or pre-absence. Fang, Asafa OTS: | Nya Ko The time which is the substratum of the use of that particular word. Nya Ko; Vyu Va P. 202 (vartamanatd) same as Ava Nir Jag. P. 20:3 (vartamanatva) being the locus of the use of the word ada cecrarnaroreay| Nya Si Muk (Kir) P. 154.20 Being present (presenthood) (of a thing) means residing in (that) time which is not the locus of pre-absence or destruction of itself. AMT BOTA TTT | Nya Pra P. 59:15; Nya Ko; Tat Di Pra P. 89:90 werd aaa TATA aT: | The verbal behaviour about the presence/ existence of pot etc. is caused by presenthood « Pad Tat Nir. P. 49:1; Akhya Va P.6:10 Ibid P. 35:2; Akhya Va P. 30:2 Pad Man P. 24:3 atareiniga (vartamandrthagrahitva) the property of producing a congnition of something present. Tat Ci (Pramalaksana) P. 379 (vastu) thing 9. aehatia: | NyaKo. ‘The object of the relation between word and meaning. ae: Tera: | ‘The word is the synonym of correct object/thing Nya Bin TiP. 77:1; TAt Ci (Anu, Khar) P.1797; Pad VakRAt P.. 174; Prama Var P.187:7 (vastugati) state of facts Ava Nir Jag P. 18:2; Pad Vak Rat P.785:1; Tar Bha P. 110:2 (vastutva) objectness 1. Being an object of correct cognition. 2. A kind of self-linking relation Nya Ko. agra: (vastunirdesah) 1, Enumeration of things (to be discussed)350 2. RRR aT Tees aay Ta: Uttering/reciting the name of God without doing namaskdra/salutation etc. to him Nya Pra P. 46:2 (vastu-pratiti) understanding of an object (of correct cognition) Rat Nib P. 89:8 (vastusthiti) fact facts are caused by the cognition which is never contradicted. Nya Mafi P. 12:24 afa (vahni) the type of light (tejas) which is produced by earthy fuel. Hiaeenfed (@1:) Tar San P.8:10 aeatrsrca (vastvadhisthanatva) fafid arattrered am? fi qeercafi aq: ware, ay Ta gataq aero Sea, TEU a? Rat Nib P. 92:26 TESS (vak-chala) afatafifedsd aaqrftasreataecrt TSA | Nya Si 1.2.12 arawe is postulation of another meaning than desired by the speaker when the (sentence is uttered with reference to the) general meaning. Dictionary of Nyaya Terms Ny@ Mai P. 169:27; 169:22; Nya Rat P. 4189:1; P.190:1; Nya Pra P.155:15 ; Ny@ Bhu P. 335:19 arr (vakya) sentence collection of words having expectancy, proximity and compatibility. Tar Bha P. 89:2; P.91:7; P 94:3; Dhar Prad P. 8:14; Nya Bhit P. 274:22 Nya Mai P. 336:21; Tar San P. 50; P. Tar Kau P. 44:7; NyaPra P. 100:15; Pad Vak Rat P.459:3-4; Nya Rat P.135:1; Vidh Va P. 38; P. 33 ; Sab Sak Pra Ka P.63:7; Tat Ci (Pramanyavada) (utpattivada- Raha) P. 353 fe grate queens arene: TTI sierersiear fasranfeutreqarrt Asentence is the cause of the particular understanding when it takes place by the re membrance of previous words with the understanding of the last word, Nya Sit Bhit Var P. 17-10-14 qa (vakyatva) the property of being a sentence Nya@ Li Pra P.602:18 vig mitenreard aT | (The property of) being a sentence means having (@ series of) words in a particular order. TC. (Sabda) P. 476:1 (Part 1) area (vakyabheda) sentence-split Nya Si Di P. 34:9; P.41:16 TC (upamdna Kha) P. 12:2Dictionary of Nyaya Terms arearaeaeT (vakyavibhdga) division of a sentence. Nya Sit 2.1.62 ARR (vakya-sphota) flash of understanding of a sentence. Teeaga: ee Tega aH Per fa yeaa Wa Bale: | aa Veemrermendafeate: aprrenierel areaTeafaafes: | Nya Mai P.341:6 arate (vakyartha) sentence-meaning The relation among the (meanings that are) understood from the words is the sentence- meaning. i Pre: weit Tee: | Tar Kau. P. 44:6-7; Nya Mai P. 334:13; 22; Pad Vak Rat P. 369; P. 515; TC (Anumana) P. 2024 Saktivada? Dharm Prad P. 5.16; Nya Si Di P. 41:22 areata (vakyarthajfiana) understanding of sentence-meaning/verbal understanding. Sak Va P. 124.3; Tat Ci (Pra Manyava daP P. 343; 327; Nyd Ko. areareieft (vakyarthadhi) . same as vdkyarthajfiana Sak Va P. 103:3 areraretorchtfet (vakyartha-pratiti) same as vakyarthajnana Nya Rat P. 21:9 232:14; P.21:9 351 q arrarera (vakyartha-prama) valid knowledge of the meaning of a sentence. (Same as vakyarthajiiana) Same as vakyarthayatharthajiana) Nya Rat P. ‘at Ci (Prama Va.) P. 342 are (vakyarthabuddhi) same as vakyarthajnana Pad Vak Rat P.658:6; Man Kan P. 72:9 areaedater (vakyarthabodha) same as vakyarthajfiina Pad Vak Rat P.285; Nya Si Dt P.29:21 arrarehratar (vakyarthamaryada) limit of the sentence-meaning) (i. to be expressed by a particular sentence) Pad VakRat P. 254 array (vakyarthanubhava) experience (understanding) of the sentence meaning. Tat Ci (sémanyalaksana Pra.) P,729:22 arenatgaraact (vakyarthdnubhavakata) the state of being a describer of the understanding of the sentence-meaning. Nya Si Di P. 80.2 area (vakyaikavakyata) sentence-unity of (two) sentences. Pad Va Rat. P. 167; P.545352 arena (vakyaikavakyatva) the sentence-unity between (2) sentences. Tat Ci (Anumana; Muktivada) P. 2071 army (raf) (vagarambha) (pravrtti) (internal effort) which produces the language-utterance of words WMHS AM: SIREN: | Nya PraP.154:7 area (vagvyavahara) verbal behaviour Tat Ci (isvaravada) p. 1999:2 (vae) contact etc. which is the cause of the utterance of the words which are formed by syl- lables. Nyd Mai P. 69:21 as (vacaka) (a word) Expressive (of primary meaning.) Saaeaant (sam) orate vey Nya ko. at aa safe Gearat grad a Ter aes: | Nya Li P. S31:1 See also Pad Vak Rat P. 405:1 Tat Ci (Samava. Va) P. 680:5 area (vacakata) the state of (a word) being expressive (of primary meaning) Dictionary of Nyaya Terms Pad VakRat P. 139-40; P 342; Sak Va P. 50:6 (vdcakatavacchedaka) the delimitor of the state of (the word) being expressive (of the primary meaning) Limitor of conveyerness Na Nya Sys Log P.34:21 area (vacakatva) the property of (the word) being the denoter/expressive (of primary meaning) Nyd Si Di P. 15:5; Akhya Va P. 21:2 areata (vacakaSakti) innate capacity (of a word) to express (its meaning) (Mimamsaka’s opinion) Nya Mant P. 5971 aa (vacya) (the meaning which is) expressible (by the word through Sakzi) arematens4é: | gtacar dre gradi: | Nyd Ko; Tat Ci (Mangala) P. 104-106; Tat Ci (upamdana) P. 12:14; Kar Ca P. 20:22 (vdcyatavacchedaka) the delimitor of the state of (the primary meaning.) being (expressed) Na Nya Sys Log P. 34;18 wat (vacyatva) the property (of the meaning) being expressible (by a particular word)Dictionary of Nyaya Terms 353 Akhyd va P. 8:7; Ava P.89:1; Sak Va P. 41:3; 57:1; 59:4; Tar SanDi Ra Ru P. 260:7; Tat Ci (upaména) P. 12:15; Tat Ci (pratyaksa) P. 858:6; Mat Stu Na Nya P.61-62 (vacyavdcakatadatmya) identity of the expressive (word) and the expressed (meaning) Nya Li Vi P. 481:2 ATaaTaAS ATT (vacya-vacaka-bhava) the relation between expressed (meaning) and the expressive (word) Pra Ma Var P. 430:6; Nya Mai P. 410:6; P.17:7; Sak Va P.17:6; P.37:3; Nya@ Si Di P. 39:2 ara (vacyavacakabhava) Same as vacyacdcaka-bhava. Rat na Nib P. 100:31 are (vada) argument (for the discovery of truth) of that person who is desirous of arriving at truth- (to know the truth.) : Rreranfes: vera: varaferrersheaeT az: | Nya Sit 1.2.1 Aeag AA: Be ATE: | also Nya Sa Bha Var P. 148:14-18; Tar San. Di P.64:15; Ny@ Pra P. 155:10; Tar Bha P. 203:2; P. 3:2; Ny@ Rat P. 147:7; P. IS7AS deerme zara aa: | Nya Mai P. 18:10; P. 150:9 The argumentof anon-selfish person which results in the truth is vada. Ny@ Bhu P. 329:15; Nya Sa P. 329:6 (vadin) one who is involved in vada TEA aaa TAT | One who uses inference to establish the thing under consideration Nya Ko, Also see Nya Bin 3.43 area (vadivakya) a sentence of a person who initiates the discussion (on an issue to arrive at truth) Tat Ci P. 854:2 Tat Ci P. 1157:2; Tat Ci (Anumana) P. 1801; Tat Ci (Kevalavyativeki pra) P. ‘at Ci P. 854:5; Nyd Rat P. 157:4 (vamatva) the left (side of the body) aaa wa ATL! A particular part of the body Nya Li P,676:7 ag (vayu) wind ‘one of the nine dravyas, it does not have form & colour, itis perceived by touch. Ac- cording to the old school of the Naiyayikas itis infered but according to the new school it is perceived by touch. See also Va", alc 9. wafemeastareng: | a fafaed reais frerer | Tar Sari P.9354 eatery aa! Vai SH2.1.5 agente - srarerstary arg: | Sapta Rada %. TRAIAN AG: | Tar Kau 5.5 4. arial af tary orrepargomsftcersart ar ag: | Nyd Pra 56.6 roreape sirereastearaara hese apart ag: | Nya Pra 56.9 6. aranitsqonsiicestey Vat Aa: | 143.3 . derrary aa: aaifefegen: | ‘eaPrcaarepsd ezs whi 144,3-4; Nya Si Muk <. waigta ag: 1 Tar Sam p.9 . TRAE | Tar Kau Nya Ko 90.9) waaay carers aaa eT afer | 2) TaRecorergensticeastarar Reconnect | 2) TRarearnRrecorgensiraeraor- afer | ¥) waiter fasts- to ager | Upa on 2.1.4, P.117 99. areas ag: | 92. agenireraeary ag: | cahiieasrdte-ar arene: | ww ¥ Tar Bha 135.1 93, agar ag: | Pra Pa Bhd 53.24 (vayu-tva) windness Dictionary of Nyaya Terms 9. eairaaerret fasta warn onfrery | Vai Upa on 2.1.4 2. BUH aie Bsa | Va Kya Nyo Ko wa euaagieastaraterd: |e. a Nya Ko ¥. a a ereigeonsir-ustaeghearert meee | Din (Nya Ko) 4, oiirmeerad serene ofereTe | (Nya Ko) Nya Si Muk 144.2 arat (varta) commerce, eeMHEORATT ATA | NydSu Bha Var 13.14 at (vdsand) it is a kind of impression causing rememberence. It arises because of faulty cognition (knowledge) 9. wlttg: dearfads: | Nya Ko 2. affafafiretatcre: | Nyd Var Nya Ko 3. emererit ite genfearresracrl erafaara: | Nya Ko +, aftaer taeerar are aa: aeenfir amafasaateon sag: | ae atarerich eters ae Nya Maat 113.23 4. STE TTT Nya Pra 77.1; Nya Li 463.3; Nya Bhi 250.28Dictionary of Nyaya Terms 355 ARTS (vasana-sankrama) series of impression 9. res ered Fa yor! reeset ae AT eae FTI Nya Ku 181.1; Nya Si Muk Din 161.20 aR (vastava) reality 9. aeifeat gas aa | Nile (Rat) 87.18; Tat Cin (Anu) P. 1663.; Vi Va 4.6 TRATES (vasya-vasaka-bhava) relation between dtmd and Sarira vasya is that which dwells and vasakaisthatin which something dwells. Nyd Mai 113.18 (vikatthana) pompus argument aRIMeE Te WaT eae | Nya Pra 108.10 (vikarana) class-marker in case of verbs. Sabda Sak Pra 337.10 ferent (vikalpa) option 9. arene ferarea: | faferdy ar aed Pasa: | Nyd Si Bhd 72,10-12 2. Sey we zak zafterery| Nya Sit Vr 5.14; (Nya Ko); Tat Cin 857.5, 77.78.82, 69.70; Prama var 227.7; Nile (Rat) 126.31; Sab Sak Pra 454.16 freee (vikalpa-sama) one of the types of faulty arguments / of Rrearrert 3. Teer aeiRratacwt Reema, Far aaa ara Gea Bq WERT feRige ger draft, PefBq eg ae ag! Nila (Nya Ko); Tar Dip Pra 341.6, ; Nya Pra 1574 2. eaiarefaecte were Papers: afer: | wa waht yacrrentiad fafa ag ee THe PeRreatst meses wt sacra Patehicd afreat rete Fesfatret sree | | Nya Mai 177.23 2. arerenigay cert emia freee erlfereet weordt Rraer: | (ya Ko) leave rmaat ef fre erig saareaca ea ‘FaaeTTA | Nya Sa Vr 5.1.4 %. weftete safecattrare afte enter faded ft: wea and oft sara We! Nya Ko wietor Saft etter after: | ak: crenfrarrad Presenter | NyaSa494 frame (vikara) change in the original state of a thing. 9. eaerer Peart ofan at gear SRA | (Nyd Ko) ; Nya Sit Vr On. 2.2.40 2. frarg safaeneres: cat od frat aE Pad Vak Rat 513.7356 2. sulfa, UTTER Se IST: | (Nya Ko); Nya Sit 2.2.56 %. WRATH: TROT: | (Nya Ko) Vaca . araeerarererarh Perera: | NyaS Bhd 151, 17-19, 152 1-2 &. a 7 wecahors aera: | Nya Sit Vr 2.2.52; Kir 42.17; Nya Sit 3.1.19; Kitr Ca 39.48 faced (eat) (vikarya) an action which changes the original state of a thing. 9, Faemrd a weft rpirarrscceatirerent afet wate | afer - mpferiengs camara 3 | eat goed wafer =. fetter! Nya Pra 125.17 2. at a fafeei oral, faard, Pacer! fear geste ee orate ag feremrty | aar ares ware | Kar Ca: 35.36-44, 39-48 ag Padutadee: dad afar | Pad Val Rat 513-7-10 ¥, aa a operas afer | Pad Vak Rat, 514.6; Kar Ca 36-45,39-48 fama (vi-kraya) selling 9. FRR ere ora fea: | Kar Ca 30.36 2. FRONT RATA HORI: | ft ar Ferre | £ Ny Pra 109.3 Dictionary of Nyaya Terms iaoa (viklitti) softening / separation It is parting of parts of a thing because of heat. eerearmin areariaaaiaart fas: | (Nyd Ko) Sab Sak Pra ciizarg seam: dara sana | aa aieradarrisirrené forfae dapat: | (Nya Ko); Mani Kan 86.2; Akhya Va 16.11 (vikledana) Separation/loosening of parts of a thing because of the heat. RRR saree eT | Nya Pra 109.16; Kir 52.8 faa (viksepa) breaking the link. 9. were senferasdr feat: | Nyd Si 5.2.19 Itis discontinuing the disscusnion not it due to some other work. 2. TASTIER OTA HAMAS: faa: | Tar Dip. Pra 359.14; Ny@ Pra 161.23; Ny Rat 151.2 erica (vigitatva) the state of being prohibited 9. Aafia (Nyda Ko); Tat CinDictionary of Nyaya Terms The state of being prohibited by the Vedas. 2. Sires | Dealing with worldly things. Ny@Ko 2. Say | Producing demerit Nya Ko 4%, qeaehrerarIrry | Linking with great result. Nya Ko (vigraha) explanation, underlying sentence of com- pound 9. Fea Te Nyd Ko 2. fadrasay | Specific particular information Nya Ko ‘erecta: Nya Ko; Kir 88.6; Sab Sak Pra 257.5, 259.8, 297.7 (vicikitsd) sceptical thinking, included in, ae fa fatale fansit fafefece! Nyd Mat 71.9 fafraca (vicitratva) the state of producing different types of results. fafeacd faondmesracay | Nya Li Kan 236.3 frardia (vijatiya) belonging to other class/group 357 Kir 40.8; Padtat Nir 33.1; Kar Ca 34.43; Tar San Nya Bo 17.12; Tat Dip Pra396.11, 264.19; Pad Man 9.2, 15.5, 16.17, 10.11; Tat Cin P. 473; Tat Cin Did 1189.21; Tat Cin Gada P. 1089.21; Tat Cin Gada P. 1018.18 Paria (vijdtiyatva) the state of belonging to other class. Nyd Ku 73.2; Tat Cin Upa 2.5 (vijfi@na) cognition meres fe fart a walt + areory| Nya Maiti 104.1; Nib (Ratna) 131.4; Nya Kan 193.5 faarst (vitanda) a group of sentences which does not put forward any theory, but just blames the oppo- nent, one of the 16 padarithas of the Old Nyaya aeRATTTEMT FATT | Tar San 64-16; Tar Dip Pra 335.19 1B (sien) sfermereerornrérat Paver | (Nya Sit 1.2.3); Nya Sa 44.12 sfcreremcrétar fafertigaer | Nya Sit Vr 1.2.3) SURAT MT TTETOPTATTA | Nya Sit Bha On 1.1.1 sferaerenmaret a ary | Nya Var 1. waereraarerar ferrost | aT a TRTaAGTT sracarara | area Seger eam: TeHS A | ee ATTRA TCT TATE: | Tar Bha 2043358 Dictionary of Nyaya Terms Tarren fatritgar facet | Nya Rat 157.14 afe Gas crater cet are wa | ale oat war faavda| Nya Rat 157.16 IRE fraver | Nya Pra 155.12 RTA WATE FATT | Nya Bhit 334.27; Nya Rat 157.6 faak (vi-tarka) conjecture watag: Serr S| It is conjecture of the speaker in terms of posibility. fren (vidya) knowledge, cognition See also 44, SF, meM, fe etc. 9. Patera arene oreaaeratcter wefan | Ny@ Kan 4145-6 True/Valid congnition is certain, uncontradicted and definite cognition. 2. dei fren, we 7 wattaed, aft 7 qomdarnaar | Nya Mait 8.17 Congnition is knowledge. It is not (simply) congnising pot etc. But knowing the means of the ultimate aim of human life. . Itis of four types. Se, agar, sour and 3%. fren walter | wereiegenioaun | Pra Pa Bhd 183.6; Pra Pa Bha 170.25 Perera (vidya-sthana-tva) knowledge of the means of acquiring the ultimate aim, » 3. famed ama aqdorai sear goadaerarigrarsaraa | de fear ca a gated aft g geardares ae, fren: arr naa: Soe Fa | Nya Mai 8.17 2. Seqemenfeream ea wa gouTeerenitaeer wauraaaarearcay | Nya Mafi6:7 ooh one of the forms of light ofeeri frei frente 1 Tar Sai P. 8.11 faa (vidhana) statement, Pra Pa Bha 133.1 Tater (vidhi) statement which prompts action (esp. from the Vedas) 9. wafeat ard afer: | Tar Kau 46.6-7 | i rompts action. x A sentence which prompt a Tarifas erie asta | Nyd Pra 101.5 2. samarafaeal ert: | Vyu Va 206 %. wartoferitar saehiferosh Pate: | Sab Sak Pra 410.8 4. TaStrafafastarasrateraa fait: | Tar Dip 65.13 &. wang arden va Pate: | Tar Cin P. 238 vo, Pafeserera: | Nyd Su 2.1.64Dictionary of Nyaya Terms ¢. wart fara crea a feet: | fatty fraivits-aan a1, aa afer agar, eaten: 3. Nya S@Bha 1215.7 9. cared frarah teh a faite) fatty frapisgen ar gare Pera sé gale a Fran | Nya Sit Bha Var 271.6-8 far LL oifesreagateor arenes Feet: 1 Nya Matt 312.3 Pad Vak Rat 200; Sab Sak Pra 456.3,; 347.15; Akhy@ Va@ 22.6; Tat Cin 98,100,71.72; Pra Pa Bha 197.3,60.5; Pra MaVar 543.5 90. eer (vidhi-kalpana) postulating injunction or a prompting statement. Tat Cin (Man) P. 104 faterentte (vidhikoti) (2) part of injuction. Nya Si Mu Di 159.16 (vidhi-niyama) a rule prompting action ofa a faftrre: eda fafufiadt safe, eargtenfacante | Nya Mafi 377.20 fafeenaat (vidhi-bhavanda) volition of injuction, fafecarnfciree: saci faferret | Nya Li Kan 777.5 359 < fatafes (vidhi-lii) an optative suffix See feed Tar Ka 95 faaa (vidheya) predicate Kar Ca 52.68, 65.85, 138.5 Tatas (vidheyaka) of predicate, beloning to the predicate portion Sak Va 129.8; Kar Ca 53.69 fataat (vidheyatay predicateness Sak Vad 1265, 136.2 (vidheyata-vacchedaka) delimitor of predicateness Pad Vak Rat 195, fia (vidheya-tva) the predicateness i Nyd Si Muk Ra 234.35; Kar Ca 37.46; Sab Sak Pra 284.14, 395.6; Tar Dip Pra 399.6 fatenterast (vidheya-avimar$a) non-consideration of predicate Visa Va 21.14 fade (vidheyitva) the state of being a predicator Nyda SiMuk Ram 235.19360 Dictionary of Nyaya Terms destruction ere Nya Mafi, 301:2; Prapa Bha, 158:15 (vidhyartha) meaning of optative suffix. rust See also fafa, orpifaflr, fez etc. 9. Read: Safer ore ae, aed, Tard Reasrareray | Nya Si Muk Ram Rud 13.32 Tat Cin 270. 197-201 Rada (vidhyartha-tva) the state of being meaning of vidhi. (i.e. optative suffix.) Tat Cin 275.72 fraser (vinaSyat-ta) the state of getting destroyed ‘Frere F Penerarcoraraien er | Tar Bha 19.3 An association with the causal complex of destruction. frsaerea (vinaSyadavastha) being in the state of destruction eoiraiireesremiengagiie - Tg mafaiiresy| Nya Ko Qualified by destruction by two relations 1. Couterpositiveness its own 2. Existing in the moment preceding. Pad Vak Rat 190 fart (vina) without, except ferrat (vinaga) VyuVa, 150 (vinastva) the state of destruction Abha Va, 187:13 ferent (vindSitva) the state of being that which is going to be destoyed. Nya Si Di, 33:17, 34:4 Reid easter Nya Si Mukir, 61:10 the state of being a counterpositive of the (product) to be destroyed frasact (vinaSyabhavatva) the state of being an absence is to be destroyed. rau. ciecaereaafoutet ferearorry “arene ere aa Peter, wart weeaeaat Nyd si Mu Kir, 61:32 fafrr (vinigamaka) one that causes to accept one out of two hypothetical arguments. fre: vecnfrsen ra ZI einrrnfasrentecad: | Nya Ku Pra,20:20 ; farmrmeafee Rerarrereoren: were oTaP fee a paces: | Nyd& Ku Maka, 20:27; Pav Va Ra, 547:1, of that which Va Va, 100:9; Nyd Si Mu Ra, 327:29Dictionary of Nyaya Terms 361 re (vinigamakatva) (viniyoga) the state of being that a causes to acceptone application, use. out of two established (acepted) arguments. pra ni 6) Pad Man, 18:16 Pad Man, 32:2 fatrainfatr (viniyogavidhi) employing injuction. fy Mah, 379:21; (vinigamakaviraha) absence of that to accept cause one out of two hypothetical arguments. Tat Ci, 517:4; Tat Ci 901:2 Nya Mahi, 325:4 fare fama (vinigamakabhava) (vipaksa) same as fafrraface a dissimilar subject is that where there Tat Ci, 820:1; Tat Ci 343; Sak Va, 37:1 is definite absence of the probandum; the subject which is different from the subject fart having the probandum. (vinigamana) Fftarenarraenfayer: | one of the two accepted hypothetical Tar kay, 32:2; Nya pra, 95:2; Tar San, 44 arguments. . ‘ 4 q Vir Va, 14:5; Tar Sari Di Ra, 186:8 ee ee rica anit | vinigamanaviraha) Tar Bha, 77:1 one of the decision on either side, F94t Wa are aft Tar Sam Di Pra, 300:3 Nya Pra Si 1.12 reriersigeat eff fever: | Nya Mah, 283:9 emergent anit fava: | argument favouring one side. Nya Sa, 21:6; Nya Bhit, 301:8 faberr darcaeverntt ain: | Nya pra, 64:5; Nya Si Mu Ra, 32:2; fare Va Va, 73:4; Pa Va Ra, 333 (vipaksatva) the state of being a fiw farerraiace faved WRAT ATaaerL| (vinigamanaviraha) 1705:13; Nya Li Pra, 820:12 absence of | fafrTHaT Prrerearratiercrd Remar! Nya Si Di, 43:10; Va Va,77:11; Nya@ Ra, Sapta pada 1145 223:5; Sak Va, 17:4; S s aranamerearionafaderd Paar | Tar Sar Nya Bo, 44:6362 Dictionary of Nyaya Terms Paar (vipaksavyavartka) which excludes fava Tat Ci Di, 849:9; Tat Ci, 893:29 (vipaksavyavrtti) exclusion of fer Nyd Sa, 21:6; Nya Bhat, 301:8; Nyda Ra, 14:3 fandietargia: (vipaksaikadeSavrtti sapaksavyapi) partically existing in fama Nyd pra Sit, 4:10 (viparinama) change, modification, transformation. Kir Va, 93:16 (viparita) contrary, reverse, opposite ae fareiaard @ faaete: | Nya Kan, 560:2 (viparitajfidna) contradicted knowledge, Tat Ci Di, 673:12; Va Va, 99:31 (viparita-vyatireka) Teverse negative concomitance, Nyd pra Su, 7:6; Nya Bin, 3.135 (viparita vyapti) negative invariable concomitance. Nya Si Di, 93:24 (viparitanuvada) Teverse statement. Nya Rat, 237:1 (viparitanvaya) wrong or contradicted relationship. Nya Pra Sit, 6.12 farda (viparyaya) one type of false knowledge. wrong knowledge, misapprehension Reasrerrataiseeniea: Pre: Nyd Pra, 146:12 aaadart agile dei farada: eit swaaaait Tar Ka, 46 farceeh ar rH zeae: | Tar Sart Nya Bo, 5 oe: ged Rreda:| orafereatefer a4! Nya Sit Bha Va4, 26:3 aaurorearmcrant faada: | Sapta, 102:24 fara ero. Pred eure Torment yae | Tar Sar Di, 57 oramalguafiatae: derataacacrsierd, Peart faeia: | Tar Sari, 56 fremerererat fereeha: | Nya Bhit,25:5 era: | we fet ATA, Tar Bha, 189:3 (viparyayadasa) a state of a contradictory situation Tat Ci, 459Dictionary of Nyaya Terms 363 farear wferafafetnferatc: | regulating factor of wrong cognition Nyd Mai, 124:30 Tat Ci, 464 ariretendast Rafat: | Ny Bha.1.1.23; p.39:1 facata fergie ax gfeerar ar feafeeaerafer: | (viparyasa) 1.2.19; Nya Su Bhd 72:2; Nya Ku, 29:1; change, a mistake, error Tat Ci Ga, 1747:16 Pra Va, 125:7; Akhya Va, 16:5 fanferafast (aera) (vipratipattijasarhSaya) fared a doubt arising because of some (viprakarsa) discrepancy Tar Bhd, 197:2 remoteness, distance ray | fara Kir Va, 69:4; Kir Va 76:23 (vipratipanna) 1 confused person. Nyd Li pra, 281:22; Pra Va, 54:7; Tar Sari Di Pra, 260:21 Tar Bha, 165:1 farfereier (vipratisedha) (viprakrsta) conflict of two important rules or distant statements. Nyd Ko. Pra P a Bhd, 164:24; Pra Pa Bha 190:10; Va Va, 98:31; Pad man, 11:18; Nya Sa, 12:1; Tar Bhd, 164:6 (vipralambhahetu) a deceiving probans, a disagreeble reason Pra Va, 405:1 (vipakrstatva) the state of being distant. fates i famperart (vibhakti) Nya Li Kan, 281:12; Nya SiMuDi, 152:13; 2 S¥ftix . witb, 37:7 : Sa Sa pra, 196:6; Sa Sa pra 283-16; famed QaNgR Tay | Sa Sa Pra 284:8 Tt Ci Ga, 671:5 ferafieer gfe Fe fate | Vyu Va. 90; Vyu Va, 151 anteater (vipratipatti) fanitnet discrepancy, (vibhaktitva) the state of being a vibhakti. Nyd Bhii, 11:4 66 Sa Sa Pra, 284:1364 fanart (vibhaktyartha) the meaning of the suffix. Vyu Va,34; Karca , 5:3; Kar Ca, 20:23 tana (vibhava) the biggest possible size. fara frye 2 ae BSN: | Kir Va, 74:18 Rercererreremed ofearoTy | Pra Pa Bhd. 74:6; Kir Va, 102:7 frat (vibhaga) division, partition, disjunction, a quality that destroys contact between two things. Pra Pa Bha, 14:13; Pra Pa Bha, 74:7; Pra Pa Bhd, 79:11 fraritsiern seraeg; Nya Li pra, 760:12; Tar Bha, 163.3 i aareOE FETT: | Nya Si M, 415:9 aarrnsect aft dares: Peart: | Nyd pra, 70:13 i sere Pere: | Tar Kau, 13:7 ‘darrneey got ferart: | Tar Sam, 19 three kinds of disjunction arena, Sra, Pramaterarr Reishi forme (vibhagatva) the state of beinga disjunction. wariseed & aA BT Dictionary of Nyaya Terms aftryorea emcee aera | Nya Li Kan, 760:5 form (vibhagaja) caused by disjunction faurrifaariists fafaa: arora far: BIRT TAT TAT Tar Ka, 41; Pra Pa Bhd, 153:9; Tar Bhd, 163:6 feeent se Tar Kau, 52:12 fereamr frarr Nyd Mah, 121:30; Nya Bhit, 161:12 fa (vibhajakopadhi) the property which causes a disjunction Tat Ci Di, 1667:8; Tar Sara Di Ra, 98:5; Vyu Va, 28 Fraps (vibhagalaksana) ofthe nature of Hr Nya@Mah, 29:12 faiareet (viSistadhi) qualified knowledge Tat Ci, 645:3-4; Vis Va, 4:16; Ava Ni Ja, 150:3 fafsreneragt (visistaparamarSa) qualified confirmatory cognition Tar Sarh Di, 17:8; Nya Ra, 143:13; Tat ci Ga, 16:29; Tat Ci Ga 772:14; Tar Sari Di RG, 272:13; Tar Sart Di Ra 272:9365, < Dictionary of Nyaya Terms fafarecnctitea fafareatea (visistapratiti) (visistabodha) qualified knowledge Tat Ci,646:5-6; Tat Ci693:6 fafgremaet (visistapratyaksa) qualified perception Nya Li Vipra, 415:6; Tat Ci, 1313 fairer (viSistapratyaksatva) the state of being a qualified perception Pad Man, 26:9 fafineneaa (vifistapratyaya) qualified knowledge Kir Va, 129:15; Abha Va, 188:7; Nya Vi Kan, 706:19; Abha Va, 188:9 fairest (visistaprama) qualified valid knowledge Nya Mai, 39:3 fata (visistabuddhi) qualified cognition Tat Ci, 1287; Vyu Va, 34; Va Va, 71:21, 74:26; Pa Va Ra, 124; Man Ka, 12:3; Man Ka 20:9; Ava Nija, 150: Tar Sari Di Ra, 251:10 fata (visistabuddhitva) the state of being a qualified knowledge Nya Si Mu RG, 70:36; Va Va, 77:6; Pad Man, 26:5 ; Tar Sarh Di Ra, 263:14; qualified understanding (knowledge) Tat Ci, 861:9; Nya Si Di, 29:17 fafareareard (visistavakyartha) meaning of a sentence having a qualified sense. Sak Va, 124.3 Tairefastoorat (viSistaviSesanakatva) the state of having a qualified qualifier (ina qualified knowledge) Tat Ci, 860:8 fatarefastorors (viSistaviesanaka) having qualified qualifier (in a qualified knowledge) Vi Va, 15:25 fafirefaecat (visistavisayata) qualified contentness Va Va, 96:27, 97:12; Pa Va Ra, 68-69:3,1 fafirefaraa (viSistavisayatva) qualified contentness. fattsafiwad fairefasaay | Nya Li Kan, 524:7 fatrediiresart (viSistavaisistyajfana) knowledge of relation between a qualifier and a qualificand Nya Ra, 117:6; Tat Ci, 750:4; Tat Ci, 798:1; Tat Ci Di, 62:21366 Pretrearanerrast (visistavaisistya vagahiparamar$a) a confirmatory cognition in which a qualified and a qualifier relationship appears. Tar Sart Di Pra 177:6 fafineaiirearrnte sea Tar Di Ra, 250:8 panes feat Pa Va Ra, 18] fares (vifistavyavahdra) usage of the qualified. Tat Ci, 2008; Nya Li, 50:1 faftreea (visistasatta) a qualified universal property Nyd Si Mu Di, 224:7; Ava Ni Ja, 77:5 Taree (viSistasattatva) the state of being a qualified universal property Ava Ni JG, 3:1; Ava Ni J@6:2; Ava Ni J@ 147:1 Nya Si Mu Da, 226.8; Nya Si Mu Ra, 225:30 Rey (visistanubhava) qualified experience Tar Sari Di Pra, 116; Nya Si Mu Ra, 325232 fata (visistanupalabdhi) non-apprehension of the qualified Tar Sara Di Pra, 142:12 Dictionary of Nyaya Terms faigenuar (visistanubhavatva) the state of being a qualified experience Va Va, 74:14; Va Va 76:33; Nyd si Di, 46:11 faiirequasa (viSistanubhavakatva) the state of being that what causes experience of a qualified knowledge Pa Va Ra,369. fata (viSistanumititva) the state of being an inference of a qualified falirerreratedct (viSistantaraghatitatva) the state of being that which does not occured without that of a qualified knowledge. Nya Ko fafarerara (visistabhava) absence of qualifier and qualificand, three types of visistabhava visesandbhava, vigesydbhava and viSesana and visesyabhava Nyd Si Mu Kir, 30:21; Nya Si Mu Kir, 30:23; Nya Si Mu Kir 30:25; Ava Ni Ja, Kar Ca, 45:58; Tat Ci, 2008; Tat Ci 2006; Tat Ci 1984; Tat Ci 1173:3; Nyda Si Di, 21:15; Nyda Si Di 19:8 Arerrarararra (viSistabhavapratyasattitva) the state of being apprehended of the absence of qualifier and qualificandDictionary of Nyaya Terms Tae (visesa) particular, the ultimate differentiating factor residing in the nityadravyas, faararart varia eer qedacaar faa: | Pra Pa Bha, 4:4; Tar Sari, 2 Preameagedt fairer wat! Tar Sarit,6 Freacergeht carader: set: | Tar Sari, 61 Preamergeican fare: | Tar Ka, 60; Pra a& Bhé, 17:4 fade fied fraseragie: | Tar Bhd, 181:8 fase arrrarted Varcattngte: | Sap pada, 60:16 Premade achat wa 2 @ fader sft Nya Kan, 361-2 Ta: | Nya Kan, 40:6 ormenaarge sit arahkrgheraegiaae: | Tar Kau, 2:9 faara: fadrardroreaatessroerd: | Nya Si Mu Kir, 50:29. frame af aaraterd afe aatacd fagraeamry | Nyd Si Mu Ra, 58:27 faa eeorg- ATR ead ale ara ate aaa | Nya Si Mu Kir, 53:17 Para aceorreraaa: re | Nya Pra, 80:7 fasta (viSesaka) distinguisher; differentiator. Tat Ci, 763:6 Gau Vr 3.2.38; (Nya Ko) 367 q fasterenct (viSesakatva) the state of being visesaka Nya I. Kan, 528:4 Fasteysr (visesaguna) specific quality, particular quality, special characteristic feature of a thing which differentiates it from the other. Tar Ka, 29; Tar Sari Di, 59-60; Tar Sara; Nya Bo, 11:29; Pra Pa Bha, 71:9; Nya Kan, 149:1 fagreyerea (vifesagunatva) thestate of beingaspecial quality that differentiates: something from other. feared o i afrrameagiid at Nya Li Vi, 112:1 fasta (viSesana) qualifier, that what differentiates fadiout aaebeatite hat | Nya Kan, 278:10-11 fret aearnté fadreory | Nya Pra, 130:5; Vyu Va, 167 arate arent fadraory | Sap pada, 149:1 aaa fadrearatrasshaa aes | Nya li Pra, 717:15 were fateer- fasrworgueamra | Man Kan, 28:14 ah eat gall aa wares a factors | Pa Va Ra, 687:8 geretaarrd fastest Nya Pra, 109:12368 fagtoratte (viSesanakoti) the portion of a qualifier Sak Va, 163:8 fasten (viSesanagraha) apprehention of a qualifier Pad man, 30:18 fates (viSesanajfana) knowledge of a qualifier (which causes a qualified knowledge) Nya Kan, 273.3; Tat Ci, 526; Tat Ci 695:1; Nya Si Di, 45:9; Nya Si Di 45:12; Nya Si Di 46:8; Nya Si Di 46:16; Man Ka, 28:6; Pad Man, 26:4; Va Va, 98:17; Va Va, 71:21; Va Va, 72: fagieonat (viSesanajianatva) the state of being aknowledge of a qualifier. Nya Si Di, 27:4; Nya Si Di 46:22; Vai Va, 76:30; Nya Ra, 125:5 faster (visesanata) qualifierness, a self linking relation Ava Ni Di, 137:1; Ava Ni Di 141:1; Tat Ci, 575 aq 9 fatrereeserdaar Rares Nya Ku, 241:2 wae 2 we fader, ageigi ye Bernas Sasa FA: | Nya Pra, 92:9; Nya Si Mu Di, 192:21; Pa Va Ra, 88-89:2-4; Sak Va, 41:2, 73:6, 87:7, 175:3; Akhya Va, 12:7; Abha Va, 173: Vyu Va, 126:1 Dictionary of Nyaya Terms fastaoratacarara (viSesanatapratydsatti) qualifereness as a relationship Nya Si Mu Ra, 194:13; Tat Ci, 692:4 fagtaorarat reat (viSesanatdsannikarsa) the relationship of qualifierness (which occurs in the case of perception of an absence) Nyd Si Mu Ra, 194:16 arramcaa fadrmfasterara ar fase - afrad: | Tar Sari Ny@ Bo, 33:21 fatoormraden (viSesanatavacchedaka) delimitor of qualifierness. . Tar Sam Di Ra, 101:3; Tar Sam Di Ra 250:9; Tar Sar Di Ra 274:13 fatorareraet (viSesanatdsambandha) the relation of qualifierness(that helps. to have the perceptual knowledge of an absence) Nya Li Pra, 287:5; Tat Ci Ra, 136:3 fagtaora (vigesanatva) qualifereness, same as prakaratva a svartipasambandha, that which differen tiates something from rest of the things. fadauret wercer yalere’t Pa Va Ra, 687:7 fat faired 7 agafasonfasteraartra Tar Sart Di Ra, 245:15 aed fadroured eererara wa | Tar Sari Di Ra, 243:10Dictionary of Nyaya Terms 369 faired a snatacy | Nyi Li Kan, 73:8 fadraord carat | NyaLiKir,196:92 Pear atirarntact fe fairs, Nya si MU Kir, 3:3 Tama auendianed aq aet aa fadaured, 4g aeeaierey | Tar Bha, 105:1 fagtanrfastera (viSesana visesyabhava) the relationship of a qualifer and qualificand type. Nyd Maiti, 101:21, 146:2; Nya Ku, 240:1 omTarcaa fadremfasrersrdy ara fersrsora afer: | Tar Sari Nya Bo, 33:21 fataofatearrat fastwu- faseaaerita saferfem: | Tar Sant Di, 32:17; Tat Ci, 1358; Tat Ci 817:3; Nya Ra, 211:1; Tar BH, 105:6 fadoorfagerrat (viesanavisesyasambhanda) the qualifier qualificand type of relationship Tat Ci, 646:5 Same as fags faster fagroonera (viSesanasiddha) non-establsihment of a qualifier; the case where a qulifier cannot be proved or established, kind of fallacy. Nya Sa, 26:10; Nya Bhai, 311:15; Tar Bhi, 209:2; Nya Pra, 98:17 fader (vifesatva) particularity Rare waaaeraghied Rate Ny@ Li Kan, 757:6 fateica (viSesanisthatva) the state of residing in particular fisited Ritentadtact vat at Nya Li Kan, 227:20 faded Nyd Li Pra, 228:14 fatoarat (viSesasdmagri) collection of factors of a speical type Tat Ci, 298:9; Tat Ci, 846:2; Tat Ci, 527; Pad Man, 21:6 faders (viSesabhava) specific absence, Ava Ni Ja, 13:4 fata (viSesabhavakita) illusion of puzzle of the absence of a particular. Tat Ci, 531.4; Tat Ci, 268 fervarettrerd: | ara (vyadhikaranadharmavacchinnabhava) absence which is delimited by the property which does not have the same locus. Tar Sari Di Pra, 322:1 ARRON (vyadhikaranaprakaraka) having a qualifier which does not have the same locus. Man Ka, 10:7; Tat Ci, 474; Tat Ci 447370 mTOR (vyadhikaranaprakarakatva) the state of possessing a qualifer not having the same locus. Nya Li Pra, 529:10 ace (vyadhikaranaprakaravacchinna) delimited by the qualifer which does not share the same locus. Tat Ci, 1199:4 (vyadhikaranaprakaravacchinnatva) the state of being delimited by the qualifier which does not share the same locus. Ny@ Si Di, 91:11; Tat Ci, 886:15 (vyadhikaranavisayata) contentness which does not have the same locus, Tat Ci, 418 (vyadhikaranasambhandha) a relationship that does not share one and the same locus Tar Sam Di Ra, 263:7; Sak Va, 136:4; Tat Ci Di, 281:27 aires (vyadhikaranabhava) absence of that which does not have one and the same locus. Abha Va, 176:8 atrercontra (vyadhikararanasiddha) non-establishing that object which does not Dictionary of Nyaya Terms share one and the same locus, a kind of fallacy Ny@ Maji, 163:6; Nya Blut, 311:6; Nya Sa, 26:14 aqreat (vyapadesa) naming, designation, usage Vai St, 9.1.1; Prapd Bhd, 78:17; Nya Kan, 189:11-12;Kir, 14:7; Nya Li,69:1 arraa: fe srecrim: Ny@Li Kan, 708.7; Pra Va, 173:5; PraVa274:4; Nya Ku, 19:3; Tat Ci,476; Ny@Ra, 36:2; Nya Ra 60:1; Vai Upa,467 atresia (vyabhicaradarSana) where a fallacious reason is seen (present) Niba, 17:31; Tat Ci, 644:2 attra (vyabhicdradarSandbhava) absence of a fallacious hes Man Ka, 34:5 atria (vyabhicaritatva) . the state of having inconsistent relationship of vydpti Ava NiJa, 161:11 (vyabhicaritatvasambandha) a relationship of inconsistency NSL, 60:25 (vyabhicaritatva) the state of being a fallacious reason Pra Va, 361:8; Nya Ra, 37:10; Nya Ra, 78:3; Nyd Ra 89: Ava Ni Di, 161:2; Nya Li, 223:2| | Dictionary of Nyaya Terms 311 ata (vyabhicira) a fallacious reason which is seen ona locus where there is absolute absence of the probandum fra aera | Nya Si Di, 65:21 org a uara Sqafrerier aera qebepeata afta: | Tat Ci Di,612:14 aaa, vicars wreraafagtar ahssatatrmararraaemticd aaftrare: | Tat Ci, 1917 wel 8 erates aaa Safire: | Tar Bha,214:9 afira: td: ararrenteoraiicy | Nya Si Mu Kir, 142:12 atria (vyabhicaritva) the state of having a fallacious reason Tat Ci, 1237:16 arent (vyabhicarin) false cognition Poh cafrarhta? aeaferafetr salt | Nya@ Si Bha Var, 39:4-5; Nya Li Pra, 208:17; Pra Va, 61:1; Ava Ni Ja, 2:1; Tar Sari Di Ra, 151:2; Ny@ Mai, 28:3 eqeifergtot (vyarthavisesana) a redundant qualifier. Tat Ci,1106:1; Ny& Ra, 67:5 aqeifarareorat (vyarthavifesanatd) same as Seago Tat Cim 1127:2; Tat Ci Ga, 934:8 aeafateorst (vyarthavisesanatva) the state of being a redundant qualifier adr Reale aa eatamenra eelfastorey | Tat Ci, 866:1; Tat Ci 107. i aeifateonters (vyarthavisesanasiddha) a kind of fallacy in which the qualifier is not grasped (known) Nya Bhit, 312:2; Nya Sa, 27:11 ada (vyarthavisesyatva) the state of being a qualificand which is not grasped (known) Nya Ra, 108:3 aafatenita (vyarthavisesyasiddha) a kind of fallacy where the qualificand is not grasped (known) Nyda Bha, 311:12; Nya Sa, 27:10 Taal (vyavacchinnasvabhavatva) the state of being that which is having a character delimited (by some property) Nya Bhi, 232:13 (vyavaccheda) exclusion oar aera: | Nya Li Pra, 9:4; Nya Ku, 475.4; Nyd Kan, 21:5; Nya@ Kan 64:8-9; Nya Kan 181. Nya Kan 197:3-5; Nyd Bhii, 11:19; Nyaa, 5:23; Ny@ Ra, 214:15; Tar Ki,112; Tat Ci, 862:1372 aaeH (vyavacchedaka) that which delimits, distinguishes. Nya Bhui, 9:2; Nya Ku, 366:5 aaa (vyavacchedakatva) the state of being that which delimites or distinguishes (something from other) Nya Bhat, 11:20 TT (vyavacchedyavyavacchedkabhava) the relationship of delimited and delimitor Nya Kan, 4579-10 area (vyavacchedya) that which is distinguished, cut or delimited Tar Sam Di Ra, 100;3 aa (vyavacchedyatva) the state of being cut or delimited or distinguished (from the rest) Tat Ci, 1774:3 area (vyavasdya) determinate (knowledge) Tat Ci, 181, 793; Tat Ci 848:8; Man Ka, 4:9; Tar Sari Di, 22:2; Tar Sart Di Pra, 269:1; Tar Ka, 70 ATTA (vyavasayatmaka) determinate knowledge ama finer aA | Tat Ci Rah, 409:5 arerererorantater | fafreceraerarers- fread: | fafireararcrantait aad | Dictionary of Nyaya Terms Nya Si Mu Di, 174. 12; Nya Mai, 202. Nya Maii 329:6; Nya Bhit. 19:5; Nya Bhit , 10:7 RTT ATT (vyavasayariipapratyasatti) knowledge having of the determinate type Tat Ci, 173 aT (vyavastha) order, arrangement Pad Man, 27:23; Nyda Su Bha, 12:2 AR (vyavasthdna) arrangement in a particular order, settlement - Nya Sai, 3.1.2; Nya Sa 2.1.55 ATATTET ATA (vyavasthapakabhava) ; absence of a particular decisive order (settlement) Kir, 103:13 RTT (vyavasthapana) arranging, settling, deciding. Tar Sart Di Pra, 398:20 aafera (vyavasthita) that which is arranged in a particular order Tar Bha, 28:6, 61:5 (vyavasthitatva) the state of being that which is arranged properly in a definite order. Nya KoDictionary of Nyaya Terms (vyavahartavyajfidna) the knowledge of that fit for the object of usage Nyd Li Vi Pra, 404:10; Abha Va, 181:18; Tar Sarit Di Pra, 40:12; Tar Sart Di Pra, 182:2 rere (vyavahara) usage, rule, an established practice. BIER TETANT: | Tar Sam Nya Bo, 22; Tar Sarit Di RG, 210:3; Nyé@ Li Kan, 306:11 arnfuerreasra f Saree: | Nya mai, 479:16 ara seer sft Geen saree AERITHSTTTT | Tar Sari Di RA, 212:2 oer werd: | wireageqitsa oar A TAM fees: Tere Nya Si Mu Kir, 296:6 AST (vyavaharakarana) the cause of the usage; the cause of the practice Abha Va, 184:7 ARTA (vyavaharajanaka) produce of usage, practice Tar Sart Di Ra, 212:2 eR (vyavaharajanakatva) the state of being a producer of a verbal usage. Man ka, 10:9 373 (vyavahdranimitta) the instrument of a verbal usage. Tat Ci Rah, 542:12; Nya Li Vi, 402:2 (vyavaharapadavi) unable in language characteristics of a verbal usage Nyd Mai, 36:12 aE (vyavaharasadhakatva) extablishing verbal usage. Tar Sari Di Ra, 128:2 (vyavaharasiddhi) establishing a verbal usage Tat Ci, 1.7 (vyavahita) separated, obstructed, interrupted Pra Pa Bhd, 190:10; Pra Pa Bha@ 202:14; Kir, 48:14; Nyd Ra, 27:3; Tar Bhd, 147:1; Va Va, 98:31; Tat Ci Di, 670:24 mata (vyavahitatva) the state of being separated or obstructed. Tat Ci Ga, 671:4 aaa (vydghata) obstacle, impediment. striking against, contradictory statement i Nya Sa, 4.1.15 ara fraeismea za | Nya Sit Bhai, 39:1-3374 aa: vedtalasdrat aerasra: | Nya Si Bha Var, 267:5 Sraniish weaie wea art | Nyaa, 15:6 arash fedefaare: | Nyd Ra, 18:5 fresaqwa: era: | Nya Pra, 148:4 am (vyana) one of the vital life winds in the body, {SI | Kir, 60:4; Tar Sark Di Pra, 83:13; Nya Si Mu Di, 141.9 ae (yapaka) pervader, invariably concomitant Nyd Kan, 602:2-6; Nya Si Di, 13:20; Ny@ Li, 260:1; Tat Ci, 823:] i Tat Ci, 212; Man Ka, 36:3; Tar Sar Di Ra, 196:2; Tar Sart Di RG 271:7; Nya Sa, 89:1 Nya Li, 260:1; Nya Pra, 504:15; Nyd Ra, 20:4, 61:1, 101:2; Nyd Ra 102:8, 144:7 Tea (vyapakata) the state of being a pervader Nyd Ra, 17:4; Pad Man, 2 (vyapakatavacchedaka) delimitor of the pervaderness Nya Li Pra, 242:8; Tat Ci, 857:9 Dictionary of Nyaya Terms AAT (vyapakatdsambadha) the relation of pervaderness a self linking relationship Vyu, 200:1; Sak Va, 131:6 ATT (vyapakatva) the state of being pervaded or invariably concomitant faa Srey | Tar Sart Nya Bo, 36:18 amead afatraracy | Tat CiDi,897:16 - ameed § cabaret Try | Tat Ci,280 mad a oeaerraararfaarrcery | Tar Sarit DiRG, 122:5 wer aay | Nya Pra, 43:8 aarel fe meferareorger rater | Nya Si Mu Kir, 232:22 amma afeerzorfararrecrsra afer aabeapenaaaar | Vyu Va, 151 siratianacderarr de wfeatraaftren cor qeayfaal fared aearararafe- maagafafeeraca rare Bra Tanto caged ae]! Ny@ Si Mu, 244:1-2 arevaqia aatateerrafeat Praret saat urRcanfratray | Nyd Si Mu Kir, 43:2-8 ifn eatera Dictionary of Nyaya Terms 375 DSA (vyapaktvasambandha) the relationship of pervaderness NSL, 62:26 (vyapakaviruddhopalabdhi) cognition of that which is contrary to the pervader Nib, 3:4; Nyd Bin, 2.38 (vyapakanivriti) devoid of pervader Nya Li Kar, 245:10; Tat Ci, 586:7 AayIo (vyapakanupalambha) non-perception of a pervader Nya Li, 246:1; Nib, 86:22 qT TH ATT (vyapyavyapakabhava) relation of pervader and the pervaded type Va Va, 97:12 (vyapakanupalabdhi) non-apprehension of a pervader Nya Bi, 2.33; Ny Ra, 101:2, 202:1 ATT (vyapara) 1) intermediate causal link SIR ERA | Nya Si Mu Kir, 6:14; Pra Pa Bha, 52.22,Tar Kau, 26:7; Tat Ci, 103-104, Tat Ci Ra, 30:10; Nya Si Di, 30:5 2) an intermidiary contact am: = afar: Nya SiMu Kir,209°6 3) an action aor: frat Nyd Si Mu Kr, 41:19 4) avydparais that which is the producer of that which is a produced of that (something) at the same time. aaa VAs TAIT SAIN | Tar Kau, 15:14; NydOpra, 89:16 ara (vydparatva) the state of being a vydpara is the state of being a producer of something which is produced by that and at the same time that is produced by something. anid aed af TEETER | Ny@ Si My Di, 210:5; Nya Si Mu Ra, 321:3; Tat Ci Ra, 83:13 areaarante ra (vydparavyaparibhava) the relationship of an intermediate action(cause) and that having a vyapara. Tat Ci Di,1313:9; Upa on 1.14 p.17 aR (vydparavatva) the state of possessing an intermidate function SR SATSTARATL | Nya Si Mu Kir, 6:13 anita (vydpitva) the state of being a pervader array, Nyd Ko.376 Dictionary of Nyaya Terms aie (vyapita) pervaderness Pra Va, 478:2 arta (vydptatd) pervadeness Nya Ra, 18:6 ara (vyaptatva) the state of being pervaded NyaKo anita (vyapti) invariable concomitance between a probans and probandum 1) invariable concomitance a , eaicad: | Nya Mai, 296:3 7a rer areeitma: geenifran afer SeOry | Tar Sark Di, 35; Tar Sari Nya Bo, 36:18 wae area: ot meat aa | Tar Bhd, 53:1 7a 7a Reena aad anita: | Tar Sari, 34 wea TAME way we Bet Fran: anata: | . : Tar Sar Di Ra, 256:2 2) anatural relationship between a sadhya and sadhana ere: TE ere afar: | Nya Sa, 16:18 wert wear arte wait afte: | Nya Li Pra, 497:1 aa ats are eats: | Nya Li Kan, 499:4 3) invariable concomitance is one type of @ causal relationship between a probans and a probandum - afeepeh: arrears arf: | Nyq Li Kan, 257:12; Tat Ci, 584:1 4) invariable and inseparable connection Nya Ku Ti, 7:36 ; vier anita: cera afesroTs arse Si safe aa afeenads wachfa: aaa | Nya Ra, 124:7 aaewaeaaraeeeafatreeneaT TT fraeoege aaa: | Man Ka, 30:8 caer caer aa eneos es TAAL: wa4:| SapPa,107:18 _ fearing fattraraaaratot I gate a4 aH ae arated anita: | Tat Ci, 307 arerararnbreca a eae: | Nya Si Mu, 24434 j maf: | Tar Kau, 27:6 5 sararaferat conta sau arent | Tar Ka, 73; Tar Sarit, 35 antes Saaarate wears weatreTengic aifafane Rqarraseaots | Tar Sarit Di Pra, 165:12 Raaara fear eoararaferea Pra eaaTAT AT aaa: | Tar Sarin Di Ra 263:12 areraPassruranferaifereremecd eartic: | Nya Li Kan, 819:9Dictionary of Nyaya Terms arent weary: safe: | Nyd Pra, 109:13 fraser zarfta: | sierefrsir: | Nya Ra, 80:1 ore opiate: were eater: | Tat Ci, 280:15 a aitarfiaaca- (vyaptigraha) grasping the invariable concomitance between a probans and a probandum Tat Ci, 111, 837:2, 1105:1,1130:3; Tat Ci Di, 614:4; Nya Ra, 69:6, 118:2, 62:2, 18:6 Nya Si Di, 70:23; Tar Bhd, 74:4; Tar Sam Di Pra, 166:1 Nyé Li Vi Pra, 489:19, 489:12 (vyaptigrahakaranatva) the state of being a cause of grasping the relationship of invarible concomitance Tat Ci Ga, 645:6; Nya Si Di, 70:8 (vyaptigrahapratibandha) obstacle for grasping the relationship of invariable concomitance Tat Ci Di, 908:5; Man Ka, 38:1; Tar Sar Nya Bo, 48:12 (vyaptigrahapratibandhakatva) the state of being an obstructor of grasping the relationship of the invariable concomitance. Tat Ci, 1133:1; Tar Sart Di Pra, 212:21 377 (vyaptigrahahetu) cause of grasping concomitance. Tar Sart Di Pra, 165:19 the. invariable TEs (vyaptigrahaka) that what causes grasp of invariable concomitance Tat Ci, 517:3, 785:1; Tat Ci Di, 644.8; Tat Ci, 644:2; Nya Li Pra, 251:15; Tar Bha, 79:4; Nya Ra, 103;1 mrareeet (vyaptigrahakatva) the state of being a causes of grasping the invariable concomitance. Tat Ci, 654:15; Nya Li, 260:2 eats (vyaptijfiana) knowledge of the relationship of invariable concomitance sgart a ears | Tar Sam Nyd Bo, 35:11; Tat Ci, 782.4; Tat Ci, 64:25; Tat Ci, 04:1; Nyd Ra, 178:11; Nya Ra, 165:9; Nya Ra 164:7; Nya Ra, 123:7; Tar Sarit Di Ra, 263:11; Tar Sarh Di, 255:14; Tar Sarh Di Ra, 247:4; Tar Sarh Di Ra, 267:2 (vyaptidhihetu) cause of the knowledge of the relationship of invariable concomitance Tat Ci, 640:23, 1060:29378 anttareat (vydptiniScaya) determining the relationship of invariable concomitance. Tatr Ci, 1199:19; Nya Mahi, 322:!0; Tat Ci, 503:2; Tat Ci 586:1; Tar Sam Di Pra, 213:7; Tar Sam Di Ra, 264:2 aaifataraafcrarra (vyaptiniscayapratibandhaka) obstructor of the confirmation of an invariable concomitance. Tar Sark Di Ra, 263:14; TarSar Di Pra, 213:7 antenieae (vyaptipariccheda) knowing the invariable concomitance. Tat Ci, 651:19, 271; Tat Ci Di, 680:20 aarTAT (vydptiprama) yalid knowledge concomitance Tat Ci, 724:23; Nya Ra, 163:8 aittarafartet (vydptipramitiy valid knowledge of the concomitance. Tat Ci, 1176:1 amntiras (vyaptibala) strength of invariable concomitance Nya Si Di, 2:23; Nya Si Di, 41:24 aaiferarea (vyaptibadha) obstruction of invariable concomitance. Tat Ci, 509, 1164:6 of invariable invariable Dictionary of Nyaya Terms (vyaptibuddhi) knowledge of invariable concomitance. Tat Ci Di, 612:11, 719:3 arterater (vyaptibodha) understanding or knowledge of invariable concomitance. Nya Li Vi, 451:2; Tat Ci, 736:4; Sak Va, 127:5, 133:1 aafatreara (vyaptivighata) interruption of invariable concomitance Tat Ci (Sabda) 1.276:2 aniftatata (vyaptisiddhi) establishing the invariable concomitance Nib, 70:17 mare (vyaptismarana) recollection of invariable concomitance Nyd Si Di, 60:7; Nya Ra, 143:13: Nya Ra, 66:5 a aoermarrrtceraat, FAST afar sft arent afrerory | Man Ka, 6:9 Tat Ci, 589:2; Tat Ci, 69 Tat Ci, 1199; Tar Sari Di Ra, 272:9 anttrercorartare (vydptismaranapaksadharmatagraha) grasping the hefu on a subject by remem- bering the invariable concomitance Tat Ci, 710:2Dictionary of Nyaya Terms m (vyaptismrti) (vyaptyupajivin) remembrance of the relation of invariable depending ~— upon the invariable concomitance. Co BLT Tat Ci, 1166:8, 79 Tar Bhd, 81: Nya Ra, 66:4, 178: Kar Ca, 43:55; Kar Cay 45:58; parva) Tar Bha, 61:1 pervaded, a reason {ae eet a area a (vyaptyanubhava) experience of the invariable concomitance relationship Tat Ci, 730: Nya Ra, 40:2 aH (vydptyadhikarana) locus of the relation concomitance Nib, 3:24 731:4; of invariable (vyaptyanusmrti) the remembrance of an concomitnace Kir, 90:7 invariable RT (vydptyavagama) knowledge of the relaion of invariable concomitance. Tat Ci, 299:5 (vyaptyavacchedakata) the state of being a delimitor of the relation of invariable concomitance Nyd Ra, 120:10 aren! Tat Ci, 601:18; Nya Li Kan, 260:8; Pada Ta Ni, 26:2; Pa Ca Ra, 49:1-3; Nya Ra, 126:2; Nya Kan, 602:2-6; Tar Sara Nya Bo, 3.8; Tar Sari Di Ra, 122:4 AMTBTE (vydpyatavavechedaka) delimitor of pervadedness Tat Ci, 716:1; Tar Sarit Di Ra, 272:14; Tar Sart Di Ra, 272:9; Tar Sar, 273:10 (vyapyatavacchedakata) the state of being a delimitor of pervadedness. Tat Ci, 750:2 (vyapyatvavacchedakatva) the state of being a delimitor of pervadedness Nya Li Pra, 219:12; Tar Di Pra, 165:15; Tat Ci, 1987 ara (vyapyatva) pervadedness qe aenaatenarad Te TTT arerery| Nya Pra, 43.9380 a 9 aerneRoerarraneaires eect Rea area | Tat Ci, 752.2 arent apa | Tt Ci Rah, 313:7; Nya Si Mu kir, 234235 . Sart 3 vacates | Vyu Va, 108 aad 1 wareraebengparghacr | Tar Sarh Di Ra, 122:4 area ‘enh adari at arecagic - erfafestatrantrareis aad afereatreay | Nya siMu Kir, 44:7 arenraae ~NyaKo TeaRRR OTA ara AG, 7a Ser | NyasiDi,56;(NyaKo) (vydpyatvavyavaccheda) distinguishing or _particularising pervadedness. Tat Ci Ga, 140:6 ITT (vyapyatvasambandha) the relation of pervadedness, NSL, 62:13 (vyapyatvasiddha) : akind of fallacy belonging to asiddha type where there is non-existent concomitance sftafafar: | curate: aeafeet arerenteate | draft araranfire: | Tar Sarh , 46; Tar Ka, 79 ., 80 Dictionary of Nyaya Terms arate gq: =rercattz: | Nya Pra, 98:18 I Tar Kau, 40:2 araaiteratiestrgpeca rena: | Nya Ra, 181:6 SIE 8 a aa eareaiferteraa | Tar Bhd, 211 ;4 ASS (vyapyatvavacchedaka) delimitorof the pervadedness. Tat Ci, 708:1; Tat Ci, 589:2 (vyapyatvariddhatva) the state of being a pervadedness Nya Ra, 174:8 non-existent (vydpyatvasiddhi) atype of fallacy which belongs to the non- existence of the pervadedness ae ; : Wee as: Tat Ci, 1180:1; Nyd Ra, 173:1,174:6 aera ere Fen ie. waargraneatarees Terni Team Tat Ci, Di. 1855 (vydpyavirahavyapya) pervading the absence of that which is pervaded in the absence of the pervader. fra area Prat arafeeeerer: | Nyd si Di, 175:11Dictionary of Nyaya Terms (vyapyanivrtti) devoid of the pervaded one, absence of the probans. aamefiatt: aratiafer: fg dea! Nya Li Kan, 245:10 (vyapyavriti) existing in the pervaded one. Tat Ci, 805:6; Tat Ci Di, 32 Pada Ta Ni, 32:2; Ava Ni Ja, 14: 53:2; Pada Man, 13:13; Tar Sari Di Ra, 205:3, 204:10 (vyapyavrititva) the state of existing in the pervaded aragia-eratesairray | Tat Ci Ra, 376:15 area Di (Nya Ko) ade g smakernancdarry| Prats afer | Nya Ko; Nyd Ko fre (wyapyavrutitd) same as Tat Ci, 363; Tat ci Ga, 13:21; Tar Sar Di Ra, 204:10 TAH TT (vyapyavyapakabhava) the relationship of pervaded and pervader Pra Vd, 549:3, 542:8; Tat Ci, 268, 584:14; Nya Si Di, 66:24; Tar Bha, 66:5; Va 131:17; Sak Va, 134: 96:3 381 ( aaaree (vyavarttaka) distinguisher aqeriaet Teurh aera a TeATISaTA: at ar cease yela: | Tat Ci Di, 1200:4 ater q Tar Sari Nya Bo, 61:15; Tat Ci, 514:1, 581:2; Kir Va, 17:12; Nya Bhit, 15:14; Sak Va, 93:4, 136.8 Seat (vyavartakatva) the state of being the distinguisher arated Nya Si Mu Ra, 59:9 aadaed dearer tae | ‘Nye Si Mu Ra, 59:16; Nya Si Mu Ra 64-19; Pada Ta Ni, 31:2; Sak Va, 122:4 arateent (vyavartakadharma) distinguishing property, differentiating property Tat Ci, 707:1, 1199:23; Nya Li Kan, 94:13; Nya Li Vi, 454.5; Nya Li Pra, 88:9 arr Qyavrtia) distinguished Tat ci, 866:3, 803:5 (yavrttatva) the state of being distinguished angie o Renfeatiiay! Nya Pra, 135:11 ATTA Nya Li Kan, 779:9, 382 aga aieraafadaeatati wae sairanrantearcay | Vyu Va, 186 Nya Li Kan, 732:7 anguaam tefre Raaahretia teat or | Nya si Mu Kir, 52:15; Nyd Ra, 75:3, 105:5 (vyavrtti) distinction, covering ,excluding ,exclusion aqdka vata afafeaa mongrel sae Nery srleR De | Tar Sart Di Ra, 124:12; Tar Sart Di Ra 128:2; Tar Sart Ny@ Bo, 21:5; Nya Ra, 17215, 108:6, 106:1; Tar Bha, 75:2; Sak Va, 130:3, 76:9; Tat Ci, 515:2; Nya Li Vi, 463:5; Nyd@ Kan, 30:2-3; Kir, 17:13 (vyavrttibheda) difference in exclusion Nya Bhut, 13:12. (vyavrttidhi) knowledge of exclusion Pad Man, 12:15 (vydsanga) close connection, Ny Kut,320:2; Upa 3.2.1, Tat Ci, 828:10, 835:3 (syasajyavrttiy existing in more than one locus together rt ef eresegfct: | Dictionary of Nyaya Terms Nyd pra, 68:11; Sak Va, 141:4, 134:4; Tat Ci(Upa) P:8; 698:2,584:17; Sabda) 79:7; Nyd Li Vi Pra, 402:12; Vi Va, 4:28; Kir Va, 142:21; Upa, 65 (vyasajyavrttita) the state of existing together in more than one locus. Ava Ni Ja, 40:4 (vyasajyavrttitva) the state of existing together in more than one locus. uararafesraafaal Pare vat fearas aed Na Si Mu Kir, 233:24; Nya Si Mu Ra, 221:22 (Nya Ko) (vydsajyavrttidharma) property of remaining together in more than one locus. Tat Ci Ga, 333:17; Nya Si Mu Kir, 233:23; Nya si Mu Ra, 57:17, 339:29 araahent: swagfeerh: Har | Nyd Si Mu Di, 221:7; Vi Va, 4:28 (vyutpatti) knowledge ageaferd at gfzararr vertaia: at | Tat Ci Upa, 16:22; Pa Va Ra, 165, 353, 437, 537:6; Kar Ca, 24:29, 59:76, 60:79, 79.104; Tar Sart Di Ra, 181:2, 206:10(vyutpattigraha) knowledge of the process of verbal understanding Nya si Di, 39:1; Nyda si Di, 39:5; Nya Si Di, 29:12 a (vyutpattibalalabhya) obtained through the strength of a derivative process. Nati Vada, 189:2 (vyutpattiviraha) absence of a understanding Nya si Di, 40:6 (vyutpattisiddha) established through derivation and understanding Vyu Va, 37, 40; Pa Ta Ni, 78:5 (vyutpattisiddhatva) the state of being established through the process of derivation and knowledge Naf Va, 191:10; Kar Ca, 83:110 agart (vyudasa) exclusion. Kar Ca, 45:58 Gina) collection Nyda Si Mu Di, 118:14; Sa Sa Pra, 452:5, 63:7; Kir Va, 121:19 Dictionary of Nyaya Terms at arg (San ka) doubting knowledge of doubt gg f& aH gfe: | Nya Mai, 353:4 aM freee: ag] a Tat Cim 662:3 q (Sankitopadhi) indescribable property which is doubtful. aarggedsiifa Siswives: | a a fee: | aigetnfarPanerer | Nya Ku,351:2; Ny@Ra, 100:4 (Sankitopadhitva) the state of being a doubtful undescribale property Nya Ra, 100:6 se (Sakta) meaningful RIOTS TENET A: | Nya Si Di, 41:20; Pa Va Ra, 118; Kar Ca, 11:11 site (Sakti) primary relationship between a word and its meaning. anrarpeenterg safeetetit ataerratoeaate: | Nyé si Di, 15:2 safenfé amety at rather, Nyda si Di, 17:11384 afaféiaen oierdaon a | afenerfeuces sere | Tar Ka, 87 sredeTor oi wae: Tere wanes weer: ahaha: | Tar Sari Di Pra, 225:5 the desire of God that let this word express this meaning is called Sakti, Soret: aft: Sak Va 6:1 rarerarcanat aterer straint ae: | Tar Sari Di, 50. meresarereit dierer grararansTaret safer: | (the convention since time immemor let such word express such meaning is called Sakti) Tar Kau, 44:10-11 earreranat dere: ediertear afer: | Nyd pra, 102:8 aeata verfefastsaaaerfeset sal a faa IRAE | Tar Sart Nya Bo, 52:3 aifaaar Ferran: artaaen: Teaeeer | Nya Si Mu Kir, 28:8 afwer wa ae vardeq sears! msmrsereara deer zeta tao: | Nya Si Mu, 265:4 verggetten a sifen:, Rafeacba aargiae aehash ating | Ny@ Si Mu , 266:3 dat raaey dst waa: alt ara: aft: waned: | Tar Sant Di pra, 218:8 acausalty, wate ofnerl: aoe | aa ere ae arate remreaa | Tat Ci, 2043 cf. Wa, gear, amvel, after, wy, ‘jal that ar Dictionary of Nyaya Terms TETE (Saktigraha) grasping of the primary relationship of a word with its meaning. ofered Faareraten grater: | Tar Sart Di Pra,234; Tar Sari Di Pra 378:9; Tar Ka, 83; Nya si Di, 17:4; Akhya, 24:5; Va Va, 34; Pa Va Ra, 378:2; Pag Man,30; Sak Va, 28:7; Sak Va, 58:10; Sak Va, 62:1; Sak Va. 74:3 aiemres (Saktigrahaka) that what causes grasping of the expressive power of a word and its meaning. Sak Va, 110:5, 174:2 sheet (Saktijfiana) knowledge of the expressive power (rela tionship) between a word and its meaning Sak Va, 67:5,62:3,72:2.68:10,61:6, 104-5 sifted (Saktitva) the state of being a primary relation of a world and its meaning PaVa Ra, 69:4-6 srfereit (Saktidhi) knowledge of the expressive power of a word. Sak Va, 51:4, 87:3; Sak Va, 88:4, 104:]: Sak Va, 174:5 : Q (Saktiniripaka) describer of the expressive power of a word. Sak Va, 177:14385 ( Dictionary of Nyaya Terms aifeePrevenct MATT (Saktinirapakata) (Saktatvasambandha) the state of being a describer of the expressive power(relation) ofaword. Sak Va, 80:1 UFR TAT (Saktiprama) valid knowledge of the expressive power of a word. Sak Va, 81:10 aay (Saktibhrama) wrong apprehension of primary (relationship between a word and its meaning) Sak Va, 8,2,79:13, 45:6, 62:4; Vyu Va, 38 arfepantey (Saktivadin) exponent of the doctrine of the expressive power of a word. Nya SiDi,21:24 sifererrent (Saktivyavahara) usage of the expressive relation Nya Si Di, 25:26 artery (Saktisambandha) the relationship between a word and its meaning i.e. Sakti. Sak Va, 176:3; Vyu, 186:1 ater (Saktisamsargata) the state of being the relation of the expressive power of a word. the relationship of the state of being an expressive power of a word. Sak Va, 36:1 (Saktismrti) remembrance of the expressive relation. Tat Ci Ga, 793:6 sateen (Saktisarncara) extension of Sakti Nya Ra, 192:5 eT (Sakya) primary meaning Akhya Va, 8:8 WS Sakyajnana) knowledge of the expressed sense. Tat Ci (Sabda), 272.2; Sak Va, 180:3 RAT (Sakyata) expressedness Pa Va Ra, 143, Sak Va, 49:1, 54:12, 59:5, 73:4, 87:5 - TTT (Sakyatavacchedaka) delimitor of the expressedness. Pa Va Ra, 279; Tat Ci (Sabda), 491. Va, 61:7, 87:9; Akhya Va, 10:4, 24:4; Pad Man, 36:5; Tar Sar Di Pra, 56-57:21; Pa Ta Ni, 74:1 .386 MeSH (Sakyatavacchedakata) the state of being a delimitor of the expressedness of a word. Sak Va, 87:5 eM EA (Sakyatavacchedakatva) the state of being a delimiitor of the expressedness of a word. Pad Man, 10:1; Pad Maft, 25:6; Tar Sar Di Pra, 381:15; Sak Va, 79:3 aT (Sakytva) the state of being expressed meaning TTI | Nyd Bo (Nya Ko); Sak Va, 65:7; Va Va, 73:10; Nya Si Di, 41:11; Akhya Va, 32:9 wayHa (Saktyanubhava) experience of the expressive relation of a word. Tat Ci, 792:22 RTT (Sakyasambandha) relationship with the expressed (sense). Sak Va, 188:6; Vyu, 166:13 TI (Sakyasadhana) instrument of the expressed(sense) Tat Ci Ga, 559:25 Tet (Sabda) word a word is that which is the object of hearing. Dictionary of Nyaya Terms airamett asd: & ge: Vai Su, 2.2.21 a sentence which is uttered by a trustworty by person. STATE: TE: | Nya Si 1.1.7 arin: et: FATT | Tat ka , 84 a word is that through which something is expressed. gerrensrTd saidad aa | Nya Sit Bha, 11:5 Sabda is the instrument of verbal knowledge. smectite 12 | Man Ka, 68:1 MPTEOTATATTE: TE: Tar Kau, 44:4 eae: Te: AON | Tat Ci Sabda),(ptJ), 12 word is the quality of akasa which is known through ears reatsraey: AToTEL: Pra Pa Bhd, 262:6 TETRIS: TE | Nya Maft 568:5 saree apr: ere | STPETSTATAGFEE: | Tar Sarn,21 re: Tenet yor: | eT faster: | Tar Bhd, 167:4 se | Nya Pra, 73:6 srecrearreeaey aired YT: $1: | Sapta Pada, 82:15 teamed IO: ae: | p.52:9 two kinds of Sabda :- 2) lingustic sound. 1) noise andDictionary of Nyaya Terms get carer avier gegiesat ear | Nya Si Mu, 498:2 get feet arnt aoternsnearaate: Tar Ka, 28 aorta: Tar Kau, 53:1 three kinds of Sabda a faferer: ae fre: rerale Tar Sari grecfeaterr: arnt fauna: serie | Tar Ka, 54 ey (Sabdakarman) word functioning Pad Vak Rat, 604:2 eu (Sabdaguna) that what has Sabda as its quality Tar Bha, 145:4 sreqors (Sabdagunaka) possessing sound as a quality Tar Sa7 Di Pra, 88:12 eae (Sabdagraha) grasping of the sound. Tat Ci, 836:12; Man Va (Pra kha) rat (Sabdaja) that which is produced by a sound. Falters ated factenfegren: eT: | Tar Sari Di, 21:12; Tar Kau, 52:14-15; Tat Ci Ga, 185:11 387 q MST (Sabdajfdna) knowledge of word (ina sentence) , verbal knowledge. Tar Sam DiPra,222:9 areardart Teer | Tar Sarn, 54 aa (Sabdatva) x the state of being a word Man Ka, 50:5 Tata (Sabdatvakatva) the state of being that what possesses the state of being a Sabda. Mai Ka, 20:6 TAT (Sabdadhara) series of sounds Tar Sam Nya Bo, 21:19 qeert (Sabdadharma) property of sound Nya Bhai, 162:21; Tat Ci, 929:10 TAT (Sabdapramana) a sentence of a reliable speaker, instrument of verbal cognition. STAAL TAT, Ny@ Pra, 100:14 afte TTR Sah AEST FATT | Tar Bha, 96:1388 erat (Sabdaprayoga) verbal usage Kar Ca, 30:37; Tar Sarh Di Ra Rit, 210:3; Nya Li Vi Pra, 445:19 ener (Sabdaprayojakatva) the state of being prompter of Sabda Tat Ci Sabda.; Vol, 4 pt. 3: 862:2 TATE (Sabdapramanya) authority of a sentence Nyd Si Di, 28:1; Nya Li Vi, 428.8 sregta (Sabdabuddhi) cognition caused by Sabda Va Va, 101:26 MAT (Sabdavyaparatva) the state of being a word function. Nya Si Di, 76:1 greats (SabdaSakti) Dictionary of Nyaya Terms and its meaning, Nyd Ku, 277:4, 408:5; Sa Sa pra, 1:5 a (Sabdaaktigraha) knowledge of the primary relationship between a word and its meaning Tat Ci, 2000 sakes (SabdaSaktimila) based on the primary word meaning rela. tionship Tar Sarh Di pra, 242:14 Te (Sabdasantana) chain of sounds Kir Va, 57:23; Tat Ci Rah, 619 qrexerrartaet (Sabdasamavayita) the state of being the’ material cause of sound Pa Man, 3:9 qrerrafaet (Sabdasamavayitva) the primary relationship between a word sameas T&afit

Dictionary of Nyaya Terms - V.N. Jha - Part2

Загружено:

Сведения о документе

Оригинальное название

Авторское право

Доступные форматы

Поделиться этим документом

Поделиться или встроить документ

Параметры публикации

Этот документ был вам полезен?

Это неприемлемый материал?

Авторское право:

Доступные форматы

Dictionary of Nyaya Terms - V.N. Jha - Part2

Загружено:

Авторское право:

Доступные форматы

Вам также может понравиться