You are on page 1of 507

5/9/2014

6.

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 2

The following type of bonding is strongly directional in solids.


A.

Vander Waal's

B.

Ionic

C.

Metallic

D.

Covalant

Answer & Explanation

Answer: Option D
Explanation:
No answer description available for this question. Let us discuss.

View Answer
7.

Workspace

Report

Discuss in Forum

Fog is an example of colloidal system of


A.

solid dispersed in gas.

B.

solid dispersed in liquid.

C.

liquid dispersed in gas.

D.

gas dispersed in liquid.

Answer & Explanation

Answer: Option C
Explanation:
No answer description available for this question. Let us discuss.

View Answer
8.

Workspace

Report

Discuss in Forum

Chromium molybdenum steel can not be welded using __________ welding.


A.

thermit

B.

electrical resistance

C.

oxy-acetylene

D.

any of these

Answer & Explanation

Answer: Option B
Explanation:
http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171002

1/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 2

No answer description available for this question. Let us discuss.

View Answer
9.

Workspace

Report

Discuss in Forum

Speisses is a mixture of the following:


A.

Arsenides of heavy metals.

B.

Antimonides of heavy metals.

C.

Arsenides & antimonides of heavy metals.

D.

Iron, cobalt and nickel.

Answer & Explanation

Answer: Option A
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

10. Auto collimator is used to check


A.

flatness

B.

angle

C.

rotor balancing

D.

roughness

Answer & Explanation

Answer: Option B
Explanation:

http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171002

2/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 3

11. In troposphere (the weather domain), the temperature 't' at height 'h' above the sea
level in metres is given by (where, temperature at sea level is 15C and t is in C.)
A.

t = 15 - 0.0065 h

B.

t = 15 + 0.0065 h

C.

t = 0.0035 h - 15

D.

t = 15 - 0.0035 h

Answer & Explanation

Answer: Option A
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

12. A high pressure boiler generates steam at a pressure greater than __________
kg/cm2 .
A.

10

B.

30

C.

50

D.

80

Answer & Explanation

Answer: Option D
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

13. Evaporative cooling process employs a combination of cooling and humidification in


which the
A.

sensible heat is added.

B.

sensible heat is removed and the latent heat is added.

C.

latent heat is removed.

D.

sensible heat is added and latent heat is removed.

Answer & Explanation

Answer: Option B
Explanation:

http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171003

1/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 3

No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

14. Which of the following is not an explosive ?


A.

TNT

B.

CMC

C.

RDX

D.

Lead azide

Answer & Explanation

Answer: Option B
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

15. Maxwell's thermodynamic relations applies to the


A.

chemical systems in equilibrium.

B.

mechanical systems in equilibrium.

C.

irreversible thermodynamic processes.

D.

reversible thermodynamic processes.

Answer & Explanation

Answer: Option A
Explanation:

http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171003

2/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 4

16. Annealing ofwhite cast iron produces __________ iron.


A.

grey

B.

nodular

C.

malleable

D.

spheroidal

Answer & Explanation

Answer: Option C
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

17. Resistance of an electrical conductor is proportional to its (where, l = length and A =


cross-sectional area of the conductor)
A.

B.

C.

A2

D.

both 'a' & 'b'

Answer & Explanation

Answer: Option D
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

18. A solar cell converts the sunlight directly into __________ energy.
A.

thermal

B.

electrical

C.

mechanical

D.

chemical

Answer & Explanation

Answer: Option B
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

19. If a nuclear reactor produces more fissile nuclear fuel than it consumes, then it is
http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171004

1/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 4

called a __________ reactor.


A.

critical

B.

breeder

C.

fertile

D.

heterogenous

Answer & Explanation

Answer: Option B
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

20. Wrought iron is never shaped by


A.

casting

B.

cold working

C.

forging

D.

welding

Answer & Explanation

Answer: Option A

http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171004

2/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 5

21. Powder metallurgy process does not make metal powder by


A.

atomisation

B.

grinding/milling

C.

hammering

D.

electrolytic deposition

Answer & Explanation

Answer: Option C
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

22. In the blast furnace, incorporation of water vapour in the blast gives the following
effect.
A.

Increases the reducing potential of the gas.

B.

Increases the flame temperature.

C.

No significant change occurs.

D.

Increases the hydrogen content in the metal.

Answer & Explanation

Answer: Option A
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

23. Pick out the wrong statement.


A.

A ferromagnetic material becomes paramagnetic above the 'Curie


temperature'.

B.

Permanent magnets are made of hard materials, whereas electromagnets


require soft magnetic materials.

C.

Soft magnetic materials (e.g., pure iron) have higher permeability and low
hysterisis loss and coercive forces.

D.

Tungsten steel and alnico are not hard magnetic materials.

Answer & Explanation


http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171005

1/2

5/9/2014

Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 5

Answer: Option D
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

24. The usual energy consumption in electric arc furnace steel making is __________
KWh/ton of steel.
A.

60 - 100

B.

400 - 700

C.

1200 -1500

D.

2000 - 2300

Answer & Explanation

Answer: Option B
Explanation:
No answer description available for this question. Let us discuss.

View Answer

Workspace

Report

Discuss in Forum

25. Maximum permissible air velocity in pipelines is about __________ metre/second.


A.

B.

10

C.

20

D.

40

Answer & Explanation

Answer: Option B
Explanation:

http://www.indiabix.com/chemical-engineering/chemical-engineering-basics/171005

2/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage6

26. Areaunderthestressstraincurveuptothe__________isreferredtoasthemodulusof
resilience.
A.

yieldstrength

B.

elasticlimit

C.

proportionallimit

D.

maximumpoint

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. __________isthehardestoxideandishenceusedwherehighwearresistanceathigh
temperatureisrequired.
A.

Beryllia

B.

Zirconia

C.

Alumina

D.

Magnesia

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. TitaniumalloysareweldedusingtheFollowingprocess:
A.

TIGwelding.

B.

Submergedarcwelding.

C.

Buttwelding.

D.

Electronbeamwelding.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. AnalloyofFe0.4%Cis
A.

castiron.

B.

hypoeutectoidsteel.

C.

hypereutectoidsteel.

D.

eutectoidsteel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Amaterialinwhichtheatomsarearrangedregularlyinsomedirectionsbutnotinothers,
istermedas'mesomorphousmaterial'anexampleofwhichis
A.

lead

B.

glass

C.

mica

D.

silver

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage7

31. Inextrusionofmetals,whichofthefollowingstatementistrue?
A.

speedoftheextrudedmaterialissameasthatoframspeed.

B.

Redundantworkisafunctionofthedieangle.

C.

Relativemotionbetweenthebilletsurfaceandthecontainerwallisalways
present.

D.

Hollowramisusedforindirectextrusion.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Nuclearfissionofoneatomofuranium235producestheenergyequivalenttoabout
__________MeV.
A.

20

B.

200

C.

500

D.

1000

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Whichofthefollowingparametersisnotresponsiblefortheheatlossfromahotsteam
carryingbarepipesurfacelocatedinaroomwithoutfans?
A.

Emissivityofpipesurface.

B.

Diameter&lengthofthepipe.

C.

Temperatureofhotpipesurface&thatofairintheroom.

D.

noneofthese.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. Machinabilityofhardalloysandtoolsteelsisimprovedby
A.

spherodising

B.

annealing

C.

tempering

D.

normalising

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Transformationrangeforferrousmaterialisthetemperatureintervalduringwhich
__________isformedduringitsheating.
A.

cementite

B.

austenite

C.

martensite

D.

pearlite

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage8

36. Maximumamountofthermalradiationisemittedatallwavelengthsatanyspecified
temperaturebya/an__________body.
A.

grey

B.

black

C.

opaque

D.

white

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Incondensersusedinthermalpowerplants,steamisnormallyusedinshellsideand
coolingwateronthetubeside,becauseofthereasonthat
A.

comparedtothemassflowrateofcoolingwater,therateofcondensationof
steamisinvariablysmaller.

B.

maintainingvacuumontubesideismoredifficultthanthatontheshellside.

C.

watervelocitycanbeincreasedconvenientlytoincreasetheoverallheattransfer
coefficientbecauseofitslowerspecificvolumecomparedtosteam.

D.

condensercanactasastorageunitforcondensedsteam.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Cobalt60isusedasasourceof__________inmedicaltherapy&industrial
radiography.
A.

Xrays

B.

rays

C.

rays

D.

rays

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Absolutezeropressurecanbeattainedatatemperatureof
A.

0C

B.

50K

C.

0R

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Theproductoutfromacupolaiscalled
A.

wroughtiron

B.

pigiron

C.

castiron

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage9

41. NusseltnumberisrelatedtoGrashoffnumber(Gr)inturbulent&laminarflow
respectively,inrespectoffreeconvectionoveraverticalflatplateas
A.

Gr0.25,Gr

B.

Gr0.25,Gr0.33

C.

Gr,Gr0.25

D.

Gr0.33,Gr0.25

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Ifthedemandforanitemistrebledandtheordercostisreducedtoonethird,thenthe
economicorderquantity
A.

istrebled.

B.

remainsunchanged.

C.

decreasesbyafactorof 3.

D.

decreasesbyafactorof1/3.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. CopperdepositsarefoundinIndiaatthefollowinglocation:
A.

Kudremukh

B.

Kolar

C.

Khetri

D.

Ramagundam

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. Electricalconductivitiesofsemiconductorsareoftheorderof__________ohm/cm.
A.

10 3

B.

10 3

C.

10 15

D.

l0 15

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Corrosionofmetalscannotbepreventedbyits
A.

tempering

B.

chromising

C.

aluminising

D.

alloying

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage10

46. Transitionfromlaminartoturbulentzoneinfreeconvectionheattransferisgovernedby
thecriticalvalueof
A.

Grashoffnumber.

B.

Grashoffnumber&Reynoldsnumber.

C.

Reynoldsnumber.

D.

Grashoffnumber&Prandtlnumber.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Themosteconomicalchannelsectionforthefluidflowistheoneforwhichthedischarge
ismaximumforagivencrosssectionalarea.Verticalvelocitydistributioninanopen
channelforlaminarflowcanbeassumedtobe
A.

parabolic

B.

hyperbolic

C.

straightline

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Energyofthesunarisesmainlyfrom__________reactions.
A.

fusion

B.

fission

C.

combustion

D.

noneofthese

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsChemicalEngineeringQuestionsandAnswersPage10

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Whichofthefollowingfasteningdeviceshasaheadatoneendandanutfittedtothe
other?
A.

Bolt

B.

Stud

C.

Topbolt

D.

Noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Suddenfallofatmosphericpressurebyalargeamountisanindicationofthe
A.

rain

B.

coldwave

C.

storm

D.

fairweather

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage2

6. __________ofairdoesnotincreasewithincreaseintemperature.
A.

Density

B.

Thermaldiffusivity

C.

Viscosity

D.

Thermalconductivity

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Sphericalshapeofmercurydropletsisduetoits
A.

highviscosity.

B.

lowsurfacetension.

C.

highdensity.

D.

highsurfacetension.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Subzerotreatmentofsteelisdoneto
A.

suppressmartensitetransformation.

B.

enhanceitsworkingperformanceinsubzeroatmosphere.

C.

reducetheretainedausteniteinhardenedsteel.

D.

inducetemperbrittlenessafteritshardening.

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Airpetrolratioformaximumpowergenerationinsparkignitionengineisabout
A.

6:1

B.

12:1

C.

18:1

D.

24:1

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Whichofthefollowingvariesasthesquarerootofoilpressureduringatomisationoffuel
oilthroughapressurejetburner?
A.

Output&fineness

B.

Velocity

C.

Both(a)&(b)

D.

Noneofthese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage3

11. Themostsuitablematerialofconstructionforasewertocarrysewageunderhigh
pressureis
A.

asbestoscement

B.

steel

C.

cementconcrete

D.

stoneware

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Fillermaterialusedinweldingshouldhave__________ascomparedtotheparentmetal
tobewelded.
A.

lowermeltingtemperature

B.

samemeltingtemperature

C.

samecomposition

D.

both'b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Oxygencylindersusedforautogenous(cutting/welding)purposesare
A.

seamless&madeofsteel.

B.

heattreatedbeforeuse.

C.

madebysandcasting.

D.

weldedsteelcylinders.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage3

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Identifythecorrectstatement.
A.

Sphleriteiszincoxide.

B.

ThefirstlawofthethermodynamicsisstatedasE=QW.

C.

Leadcanbeproducedinablastfurnace.

D.

T.ferrooxidansisafungusthatcanbeusedforleachingchalcopyrite.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Dowthermisa
A.

hightemperatureheatingmedium(apetroleumproduct).

B.

productofcoaltardistillation.

C.

veryheatsensitivematerial.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage4

16. Tocounteractthebadeffectsofstrainhardeningonacoldformedpart,itmustbe
A.

tempered

B.

normalised

C.

annealed

D.

hardened

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Thedewpointtemperaturelinesonpsychrometricchartsarestraightinclinedsloping
downwardstotheright.Whenrelativehumidityofmoistairis100%,then
A.

wetbulbtemperature=drybulbtemperature.

B.

wetbulbtemperature=dewpointtemperature.

C.

saturationtemperature=dewpointtemperature.

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Galvaniccorrosioncannotbepreventedby
A.

cathodicprotection.

B.

anodicprotection.

C.

usageoflargestpossibleanodicarea.

D.

anyoneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Fireinfuelgaspipelinesisextinguishedmosteffectivelyby
A.

sprayingwater.

B.

blankettingtheareawithnitrogenatmosphere.

C.

firefightingfoam.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Whichofthefollowingisthemostsuitableabrasiveforgrindinghightensilestrength
materials?
A.

Siliconcarbide

B.

Corundum

C.

Aluminiumoxide

D.

Boroncarbide

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage5

21. Casehardeningisnotdoneby
A.

nitriding

B.

hotdipping

C.

electroplating

D.

bothb&c

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Satellitesburnoffduringreentrytoearth'satmosphere,becauseofthe
A.

combustionwithair.

B.

gravitationalpullbyearth.

C.

frictionwithearth'satmosphere.

D.

lossinweightofthesatellite.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Withincreaseincompressionratio,thevolumetricefficiencyofaircompressor
A.

increases.

B.

decreases.

C.

remainssame.

D.

mayincreaseordecrease(dependsonthesuctionpressure).

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage5

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Neutronsarepresentinallatomsexceptthatof
A.

He

B.

C.

D.

Ar

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Biologicalshieldinanuclearreactorisgenerallyprovidedtoprotectagainstthe
A.

rays

B.

rays

C.

gammarays&neutrons

D.

electrons

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage6

26. __________circuitismostcommonlyusedtomeasurestrainwiththehelpofastrain
gauge.
A.

Ballast

B.

Voltagebalancingpotentiometric

C.

Simplecurrentsensitive

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. WhichofthefollowingisnormallynotfoundinboththeS.I.(petrol)&C.I.(diesel)
engines?
A.

Airfilter

B.

Fuelinjector

C.

Exhaustsilencer

D.

Battery

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. __________isaspecialconstituentofchlorophyllwithoutwhichphotosynthesisisnot
possible.
A.

Calcium

B.

Nitrogen

C.

Phosphorous

D.

Hydrogen

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. __________isusedasamaterialofconstructionforthebladeofpowersaw.
A.

Wroughtiron

B.

Stainlesssteel

C.

Mildsteel

D.

Highspeedsteel

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Duringdecarburisingofaplaincarbonsteel,thethicknessofferritelayergrowthis
proportionalto
A.

time

B.

squarerootoftime

C.

squareoftime

D.

cubeoftime

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage7

31. Laserweldingiswidelyemployedinthe__________industries.
A.

electronic

B.

structural

C.

process

D.

heavy

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Drynessfactorofsteamisdefinedastheratioofthemassofvaporinthemixturetothe
massofthemixture.Drynessfactorofsteamismeasuredbya__________calorimeter.
A.

bomb

B.

throttling

C.

Junker's

D.

Boy's

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Whichofthefollowingisusedtoproducedraughtinthelocomotiveboilers?
A.

Chimney.

B.

Induceddraughtfan.

C.

Forceddraughtfan.

D.

Steamjetarrangement.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Temperbrittlenessofamaterialcanbefairlydetectedbythe__________test.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage7

A.

fatigue

B.

notchedbarimpact

C.

tensile

D.

hardness

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. WhenthewavelengthofincidentXraysincreases,theangleofdiffraction
A.

decreases.

B.

increases.

C.

remainsconstant.

D.

showsnosystematicvariation.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage8

36. Theelasticstrainenergyofaunitlengthofanedgedislocationascomparedtothatofa
screwdislocationis
A.

more

B.

equal

C.

less

D.

double

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thespecificgravityofcoaldependsmainlyonits__________content.
A.

carbon

B.

volatilematter

C.

ash

D.

moisture

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Incaseofcondensers&evaporatorsoperatingundergiventerminalconditions,LMTD
(logarithmicmeantemperaturedifference)forcounterflowascomparedtothatfor
parallelflowis
A.

more

B.

less

C.

equal

D.

muchmore

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Normalisingdoesnot__________ofametal.
A.

improvemachinability&tensilestrength

B.

removeinternalstresses

C.

refinethestructure

D.

removestrainscausedbycoldworking

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Whichofthefollowinghardnesstestsdoesnotmeasuretheindentationhardnessof
metalsandalloys?
A.

Vicker'shardnesstest.

B.

Shoresceleroscopetest.

C.

Brinellhardnesstest.

D.

Rockwellhardnesstest.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage9

41. Withincreaseinannealingtemperature,thefollowingdefectdensitydecreases.
A.

Vacancy

B.

Dislocation

C.

Grainboundary

D.

Allofthem

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Carnotcycleisalsotermedastheconstant__________cycleinthermodynamics.
A.

entropy

B.

pressure

C.

volume

D.

heat

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Thermistorsareusedin__________devices.
A.

voltagemeasuring

B.

temperaturemeasuring

C.

temperaturecompensating

D.

both(b)&(c)

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage9

44. Broachingtoolsareusuallymadeof
A.

cermets

B.

highspeedsteel

C.

tungstencarbide

D.

stellite

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Theratiooftheshearstresstotheprincipalstressonaprincipalplaneis
A.

B.

C.

1/2

D.

1/3

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage10

46. Minimumsafedistancebetweentwoliquidfuelstoragetanksisequalto(where,H=
heightofthetank)
A.

B.

H/2

C.

H/4

D.

H/6

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Propulsionofrocketfollowsfromthe
A.

Newton'ssecondlawofmotion.

B.

Newton'sthirdlawofmotion.

C.

lawofprojectiles.

D.

Archimedesprinciple.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Inmultipasswelds,shotpeeningisdoneaftereachpassto
A.

closethesurfaceporosity.

B.

breakthecontinuityofcolumnargrains.

C.

flattentheweldment.

D.

introducetextureintheweld.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswersPage10

ViewAnswer

Workspace

Report

DiscussinForum

49. Pickoutthecorrectstatement.
A.

MaterialsexhibitinghighelasticityobeyHooke'slaw.

B.

Theelasticbehaviourofrubberundercompressionisthesameasitsbehaviour
undertension.

C.

Thedampingcapacityofamaterialisduetoitsplasticdeformation.

D.

Thestressrequiredtocauseplasticflowinpolycrystallinematerialishigheras
comparedtomonocrystallinematerialsduetothepresenceofgrainsofdifferent
orientations.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. ConsidertheequilibriumA

(g) +B(g) =AB(g) .WhenthepartialpressureofAis10

2atm,

thepartialpressureofBis10 3atmandthepartialpressureofABis1atm,the
equilibriumconstant'K'is
A.

10atm1

B.

10 5atm1

C.

10(dimensionless)

D.

10 5(dimensionless)

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswers

1. Inchemicaldehumidificationprocess
A.

wetbulbtemperatureincreases.

B.

drybulbtemperatureremainsconstant.

C.

dewpointtemperatureincreases.

D.

drybulbtemperatureincreases.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Secondaryhardeninginsteelsarisesoutofthe
A.

precipitationoffinealloycarbidesathightemperatures.

B.

refinementofferritegrainsizebyworking.

C.

decompositionofretainedausteniteuponheattreatment.

D.

precipitationofcomplexintermetallicsuponheattreatment.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Drillsareusuallymadeof
A.

cermets

B.

highspeedsteel

C.

alloysteel

D.

tungstencarbide

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection2ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Tumblingistheprocessofimprovingthe__________ofthematerials/parts.
A.

surfacefinish

B.

fatiguelimit

C.

creeplimit

D.

surfacecleanlineses

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. The__________ofadoubleactingreciprocatingpumpascomparedtothesingleacting
pumpwillbealmostdouble.
A.

flowoutput

B.

headdeveloped

C.

overallefficiency

D.

weight

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage2

7. Firerefiningprocessisemployedincaseof
A.

tin

B.

copper

C.

zinc

D.

aluminium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Largerlength&diameterwaterpipesaremadeby
A.

electricalresistancewelding.

B.

diecasting.

C.

semicentrifugalcasting.

D.

continuouscasting.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Carbidetippedcuttingtoolsaremanufacturedbypowdermetallurgytechniquesandhave
acompositionof
A.

90%tungstencarbideand10%cobalt.

B.

70%aluminiumoxide&30%silica.

C.

30%nickel,15%chromium&55%tungsten.

D.

65%tungsten&35%zirconium.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

10. Thetemperatureatwhichferromagneticmaterialcannolongerbemagnetisedbythe
outsideforces,istermedasthe
A.

criticalpoint.

B.

curietemperature.

C.

inversiontemperature.

D.

eutectictemperature.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage3

11. Bafflesprovidedontheshellsideofashellandtubeheatexchangeraremeantfor
A.

providingsupportforthetubes.

B.

improvingheattransfer.

C.

both'a'&'b'.

D.

preventingthefoulingoftubes&stagnationofshellsidefluid.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Whenanisolatedthermodynamicsystemexecutesaprocess,
A.

workisdone.

B.

heattransfertakesplace.

C.

massflowoccursacrosstheboundaryofthesystem.

D.

nochemicalreactiontakesplacewithinthesystem.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Brittlenessinducedduetothepresenceofsulphurinsteelcanbereducedbyadding
A.

manganese

B.

magnesium

C.

vanadium

D.

copper

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage3

14. Atomic__________ofanelementisawholenumber.
A.

weight

B.

number

C.

volume

D.

radius

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Theboiling&freezingpointsonanewlydefinedtemperaturescaleindegree'D'are
400D&100Drespectively.Thetemperaturereadingcorrespondingto60Conthis
newtemperaturescalewillbeequalto__________D.
A.

140

B.

180

C.

240

D.

280

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage4

16. Whichofthefollowingisanunconventionalsourceofenergy?
A.

Thermalpower

B.

Hydroelectricpower

C.

Nuclearfusionpower

D.

Solarpower

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Theproduct(s)ofroastingofasulphideoreis(are)
A.

oxideonly.

B.

sulphateonly.

C.

oxideandsulphate.

D.

dependentontemperatureandpartialpressureofoxygen&sulphurdioxide.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Whichofthefollowingareconsideredapplicationsofultrasonictesting?
A.

Determinationofelasticconstant.

B.

Detectionofdefectsinmetal.

C.

Measurementofmaterialthickness.

D.

Noneoftheabove.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Suitabilityofsteelforitsuseincableisjudgedbyitsstrengthin
A.

tension

B.

compression

C.

torsion

D.

shear

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Hydrogeninliquidsteelsisdissolved
A.

astinygasbubbles.

B.

intheatomicform.

C.

intheionicform.

D.

inthemolecularform.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage5

21. __________ironisproducedbytheannealingofwhitecastiron.
A.

Malleable

B.

Nodular

C.

Ductile

D.

Grey

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Themechanismwhichchangesthevalueofmanipulatedvariableinresponsetothe
outputsignalfromthecontrolunitiscalledthe
A.

finalcontrolelement.

B.

onoffcontrol.

C.

floatingcontrolaction.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. FahrenheitandCentigradescaleshavethesamereadingsat
A.

55

B.

40

C.

33

D.

58

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Whichofthefollowinglowmeltingalloycontainingbismuthandleadisusedforelectric
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage5

fuse?
A.

Wood'smetal

B.

Babbitmetal

C.

Monelmetal

D.

Duralumin

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Watertubeboileristheone,inwhich
A.

waterpassesthroughtubesandfluegasesaroundit.

B.

tubecarryinghotfluegasesareimmersedinapoolofwater.

C.

tubesareplacedinverticalposition.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage6

26. Dephosphorisationofmoltenpigironisfavouredby
A.

oxidisingandbasicslag.

B.

reducingandbasicslag.

C.

highactivitycoefficientofphosphorousinmetal.

D.

oxidisingandneutralslag.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Inaneutralsolution
A.

H+ionsareabsent.

B.

OH ionsareabsent.

C.

bothH+andOH ionsarepresentinverysmallbutequalconcentration.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Whichofthefollowingcommonlyusedcondensertubematerialshasthelowestthermal
conductivity?
A.

Admirabilitybrass.

B.

Stainlesssteel.

C.

Aluminiumbrass.

D.

Titanium.

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Strainhardeningeffectinametalsubjectedtocoldworkingisduetothe__________
mechanism.
A.

fracture

B.

dislocation

C.

slip

D.

twinning

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Acommondisinfectantusedinvillagewellsfordisinfectionofwateris
A.

freechlorine

B.

bromine

C.

iodine

D.

potassiumpermanganate

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage7

31. Moistairiscooledalongthelineofconstant__________,whenitispassedoveracold&
drycoolingcoil,suchthatnocondensationoccurs?
A.

enthalpy

B.

relativehumidity

C.

wetbulbtemperature

D.

dewpointtemperature

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Whichofthefollowingmetalscannotbehotworkedatroomtemperature?
A.

Zinc

B.

Nickel

C.

Lead

D.

Tin

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Primarydesignationofsteelisbasedonits
A.

hardness&tensilestrength.

B.

carboncontent.

C.

ironcontent.

D.

alloyingelementscontent.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. Steelcontaininglowpercentageofnickel,chromium&tungstenaretermedasthe
__________steel.
A.

wrought

B.

tool

C.

alloy

D.

plaincarbon

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Superheatingofsteamisdoneatconstant
A.

enthalpy

B.

entropy

C.

pressure

D.

volume

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage8

36. Acylindericalrodsubjectedtoatensilestrainwithintheelasticlimitundergoesavolume
change.Ifthevolumestrainisequaltohalfthetensilestrain,thenthePoisson'sratioof
therodis
A.

B.

0.33

C.

0.44

D.

0.25

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thesurfacetensionofaliquid,atcriticaltemperatureis
A.

indeterminate.

B.

zero.

C.

infinity.

D.

sameasthatatanyothertemperature.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Largescalefireonfuelgaslineisnormallyextinguishedby
A.

water

B.

steam

C.

foam

D.

nitrogen

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage8

39. Brazingisthejoiningofmetals
A.

withoutmeltingthebasemetal.

B.

withanonferrousfiller.

C.

both(a)&(b).

D.

neither(a)nor(b).

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Moistclimateisthemostfavourablefactorinthesiteselectionfara
A.

steelplant

B.

textilefactory

C.

petroleumrefinery

D.

cokeovenbattery

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage9

41. Drysaturatedsteamcanbeconvertedintosuperheatedsteamby
A.

increasingitscrosssectionalareaofflow.

B.

passingitthroughapressurereducingvalve.

C.

forcingitdownwardsthroughaverticaltube.

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Pickoutthewrongstatement.
A.

Copperisthemetalhavingthehighestelectronicconductivity.

B.

Hardenability&weldabilityofmetalsareinverselyrelated.

C.

Covalantbondingformedbysharingofelectronsispresentinallsemiconductor
materials.

D.

Glasstransitiontemperatureappliesto'polymers'butnotto'glasses'.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Increasingsulphurcontentinpigirontendstomakeit
A.

soft

B.

hard

C.

tough

D.

ductile&malleable

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Oxyacetylenereducingflameisusedwhilecarryingoutweldingon
A.

alloysteel

B.

greycastiron

C.

mildsteel

D.

highcarbonsteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. M10indexofcokeindicatesits
A.

compressivestrength.

B.

hardness.

C.

abrasionresistance.

D.

impactstrength.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage10

46. Ganttchartsareusedforstreamliningthe
A.

inventorycontrol

B.

productionschedule

C.

salesforecasting

D.

qualitycontrol

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. IntheBayer'sprocess,bauxiteisdigestedunderpressureusing
A.

H2SO4

B.

NaOH

C.

NH3

D.

HCl

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Circularcrosssectionmachinepartswhicharesymmetricalabouttheaxisofrotationare
madebyhot
A.

piercing

B.

spinning

C.

drawing

D.

extrusion

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Thesubstanceusedasasmokescreeninwarfareis
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswersPage10

A.

C2H2

B.

SiCl4

C.

P2O5

D.

PCl5

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Thesamevolumeofallgasesisrepresentativeoftheir
A.

specificgravities.

B.

densities.

C.

gascharacteristicconstants.

D.

molecularweights.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswers

1. Intheformationofcermets,theratioofceramicmaterialtometallicmaterialisusually
80:20.Whichofthefollowingisacermet?
A.

Zirconia

B.

Alumina

C.

Bakelite

D.

Tungstencarbide

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Enzymesbelongtothecategoryof
A.

proteins

B.

carbohydrates

C.

vitamins

D.

fats

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Whatisthevalueofincludedangleofatriangularnotchformaximumdischarge?
A.

30

B.

60

C.

90

D.

120

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Forseparatingsmallpiecesofmetalfromengineoilofacar,thebestseparating
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection3ChemicalEngineeringQuestionsandAnswers

techniqueisthe
A.

chromatography

B.

evaporation

C.

filtration

D.

fractionaldistillation

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Heatflowacrossahollowsphereofinnerradius'r1'andouterradius'r2'isdirectly
proportionalto
A.

B.

C.

D.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage2

6. Theultimatestrengthintensionforsteelis__________timestheultimatestrengthin
shear.
A.

0.5

B.

0.9

C.

1.5

D.

2.5

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Theactivityofpurehydrogengasat1000Cand5atmpressure
A.

isalwayslessthan1.

B.

isalwaysgreaterthan1.

C.

canbe5.

D.

dependsonthechoiceofthestandardstate.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Whichofthefollowingtransducersismostcommonlyusedforthemeasurementofshock
andvibration?
A.

Linearvariabledifferentialtransducer(LVDT)

B.

Dialgauge

C.

Accelerometer

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Thepowerofalowcapacityprimemoverismostsuitablymeasuredbya__________
typedynamometer.
A.

driving

B.

transmission

C.

absorption

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. __________additionincreasesthedepthofhardnessofsteel.
A.

Chromium

B.

Nickel

C.

Tungsten

D.

Vanadium

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage3

11. Themostimportantconsiderationinvalueengineeringisthe
A.

profitmaximisation.

B.

customersatisfaction.

C.

costreduction.

D.

processimprovement.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Limecontainsabout90%CaO.PercentageCaOpresentinlimestoneisabout
A.

25

B.

50

C.

70

D.

80

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Themostimportantmaterialhandlingsysteminanintegratedsteelplantisthe
A.

beltconveyor

B.

diesellocomotive

C.

truck

D.

overheadhoists&cranes

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage3

14. Propertyofamaterialtoresistatensileforcewithoutgivingawayisameasureofits
A.

stiffness

B.

toughness

C.

resilience

D.

tenacity

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Castironhastheuniquepropertyofhigh
A.

ductility

B.

dampingcharacteristics

C.

hardness

D.

malleability

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage4

16. Steelswithhighcarbonequivalenthavepoorweldability,becauseinthesesteelsduring
welding
A.

carbonandotheralloyingelementsgetoxidisedfromtheweldpool.

B.

excessiveferriteformsintheheataffectedzoneleadingtopoortoughnessofthe
weld.

C.

martensiteformsintheheataffectedzoneleadingtopoortoughness/ductilityof
theweld.

D.

segregationofcarbonandotherelementoccursintheweldpoolleadingtopoor
propertiesoftheweld.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. IfthepHvalueofasolutionofsodiumchlorideis7thenwhatwillbethepHvalueofthe
solutionafteritselectrolysis?
A.

B.

<7

C.

>7

D.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Measurementoftheareaoftheindentedsurfaceisnotinvolvedinthe__________
hardhestestingmethod.
A.

Vicker's

B.

Rockwell

C.

Knoop

D.

Brinell

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage4

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Salvagevalueisthemostflexiblecriteriaforanalysingafinancialinvestment.'Salvaging'
means
A.

disposingoffamachine/propertyonasiswhereisbasis.

B.

disposingoffmachine/property,whichisnolongerusefulinthepresentscenerio.

C.

mortgagingtheobsoletemachine/property.

D.

writingofftheobsoletemachine/property.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Superconductioninmetalsisobservedatatemperatureof__________K.
A.

<100

B.

>100

C.

about273

D.

about373

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage5

21. Springbackinsheetmetalbendingdependsonthe
A.

elasticlimit

B.

bendradius

C.

degreeofbend

D.

thicknessofsheet

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Theyieldpointinfatigueloadingcomparedtothatinstaticloadingisless.Theratioof
ultimatetensilestrengthtoendurancelimitofamaterialsubjectedtofatigueloadingis
A.

0.5

B.

C.

1.5

D.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Whichofthefollowingisnotusedasafuelinrocketpropellaht?
A.

Liquidhydrogen

B.

Liquidoxygen

C.

Liquidhydrazine

D.

Keroseneoil

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage5

ViewAnswer

Workspace

Report

DiscussinForum

24. Hypo(sodiumthiosulphate)becauseofitscomplexformingbehaviourisusedin
photographytoremoveundecomposedsilverbromideasasolublecomplexfor
__________ofthepicture.
A.

printing

B.

developing

C.

colour

D.

fixation

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Temperatureofhotgasesflowinginapipeismeasuredbyathermocoupleinsertedinthe
thermalwell.Thethermalwellmadeof__________willfacilitatethemostaccurate
measurementofthetemperature.
A.

copper

B.

steel

C.

aluminium

D.

brass

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage6

26. __________weldingwillbethemostsuitableforbuttweldingtwo20cmsthickboiler
drummildsteelplates.
A.

Electricalresistance

B.

Electroslag

C.

Plasmatorch

D.

Submergedarc

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Machinabilityofhardalloys&toolsteelsisimprovedby
A.

spherodising

B.

annealing

C.

tempering

D.

normalising

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. LASER
A.

standsforLightAmplificationbyStimulatedEmissionofRadiation.

B.

hasthesameintensityasvisiblelight.

C.

can'tbeusedforcuttingmetals.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. __________forcesdonotactincaseoffluids.
A.

Vibratory

B.

Centrifugal

C.

Elastic

D.

Tensile

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Whichofthefollowingisnotanaturalabrasive?
A.

Siliconcarbide

B.

Quartz

C.

Corundum

D.

Emery

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage7

31. Thefunctionofanozzleprovidedinsteamturbineisto
A.

throttledown(i.e.,reduce)thepressureofsteam.

B.

convertinternalenergyintokineticenergy.

C.

increasethevelocityofsteam.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Whichofthefollowingpolymersisobtainedbycopolymerisationofthreemonomers?
A.

SAN

B.

ABS

C.

SBR

D.

PTFE

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Siliconpercentageinthesiliconsteelusedforelectricalappliances/equipmentsis
A.

0.30.4

B.

1214

C.

34

D.

2025

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Materialofconstructionoffoundarycrucibleis
A.

graphite

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage7

B.

lead

C.

porcelain

D.

stainlesssteel

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Titaniumcanbeeasilyweldedusing__________welding.
A.

submergedarc

B.

TIG

C.

shieldedmetalarc

D.

electroslag

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage8

36. Feedcheckvalveisusedinsteamboilersto
A.

checkthewaterlevelintheboiler.

B.

checkthefeedwaterflowrate.

C.

feedhighpressurewatertoboilerandguardagainstitsbackflowthroughit.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Threeelasticconstantsforacompletelyanisotropicelasticmaterialwhichfollowsthe
Hooke'slawareyoung'smodulus,elasticlimitstressandyieldstress.Whichofthe
followingpropertiesismostsensitivetoincreaseinstrainrate?
A.

Tensilestrength.

B.

Elasticlimit.

C.

Proportionallimit.

D.

Yieldstrength.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Swagingisa/an__________operation.
A.

piercing

B.

forging

C.

extrusion

D.

drawing

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Pigironis
A.

madefromcastiron.

B.

madefromwroughtiron.

C.

theone,whichcomesoutoftheblastfurnace.

D.

freefromimpurities.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Classificationofmetalformingprocessesintohotandcoldworkingisbasedonthe
followingparameters.
A.

Stackingfaultenergy.

B.

Recrystallisationtemperature.

C.

Solidustemperature.

D.

Transformationtemperature.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage9

1. Kinematicviscosityofwaterascomparedtothatofairis
A.

more

B.

same

C.

15%more

D.

15%less

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Whichofthefollowingisthemostsuitableforremovingfineparticles(<1micron
diameter)fromairbelowitsdewpoint?
A.

Venturiscrubber

B.

Electrostaticprecipitator

C.

Cycloneseparator

D.

Fabricfilter

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Whichofthefollowingistheterminologyusedforthetemperatureatwhichthephase
changesoccurinametal?
A.

Criticaltemperature.

B.

Recrystallisationtemperature.

C.

Phasetransformationtemperature.

D.

Transitiontemperature.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Puddlingprocessisusedforconvertingpigironinto
A.

castiron

B.

wroughtiron

C.

mildsteel

D.

semisteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Additionof__________insteelcanhelpinincreasingthedepthofhardness.
A.

nickel

B.

chromium

C.

vanadium

D.

tungsten

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Works

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage10

46. Onoffcontrol
A.

fullyopensthefinalcontrolelement,whenthemeasuredvariableisbelowtheset
point.

B.

fullyclosesthefinalcontrolelement,whenthemeasuredvariableisabovetheset
point.

C.

isatwopositioncontrol(fullyopenorfullyclosed)controladequatetocontrola
processwithslowreactionandminimumdeadtimeortransferlag.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Thetensileloadelongationcurveofametaldoesnotdescribe
A.

workhardening

B.

yieldstress

C.

anisotropyindex

D.

neckingstrain

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Usualvalueoftheresistancesuitableforawireresistancestraingaugeis__________
ohms.
A.

20

B.

80

C.

120

D.

500

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Permanentsetinamaterialisproducedbysubjectingitto
A.

triaxialloading.

B.

fatigueloading.

C.

stressesbeyondtheelasticlimit.

D.

tensile&compressiveloadssimultaneously.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Thefollowingisatypicalanioniccollectorusedinflotation.
A.

Ethyldixanthogen.

B.

Trimethylcetylammoniumbromide.

C.

Potassiumethylxanthate.

D.

lAurylaminehydrochloride.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/25/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswers

1. Fluorineisnotaconstituentof
A.

freon

B.

chloroform

C.

teflon

D.

fluorocarbons

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. ThemostcommonlyusedcombustionsystemmanufacturedinIndiaforthethermal
powerplantboilersisthe__________combustionsystem.
A.

pulverisedfuel

B.

travellinggratestokerfiring

C.

circulatingfluidisedbed

D.

fluidisedbed

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Duringsolidstatesinteringofpowders,thefollowingmechanismcanbeactive.
A.

Evaporationandcondensation.

B.

Solidstatediffusionprocesses.

C.

Liquidformationingrainboundaries.

D.

Creationofmoredislocations.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/25/2015

ChemicalEngineeringBasicsSection4ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4. Thetransitiontemperatureatwhichalltheferromagneticmaterialsbecomeparamagnetic
materialsistermedasthe'Curietemperature'.Itsvalueforcobaltis__________C.
A.

768

B.

1127

C.

1359

D.

1480

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Regenerationofmolecularseiverequiresittobeheatedtoatemperatureofabout
__________C.
A.

80120

B.

200300

C.

600800

D.

10001100

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage2

6. Areductioninthermalresistanceduringheattransferdoesnotoccurinthe
A.

convectionheattransferbystirringthefluidandcleaningtheheatingsurface.

B.

conductionheattransferbyreductioninthematerialthicknessandincreasein
thethermalconductivity.

C.

radiationheattransferbyincreasingthetemperatureandreducingtheemis
sivity.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. UnitofviscosityinCGSsystemis
A.

gm.cm1sec1

B.

gm.cm2.sec2

C.

gm.cm2,sec1

D.

gm.cm.sec1

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Shaft/rotorspeedismostaccuratelymeasuredbya
A.

frequencycounter.

B.

tachometer.

C.

strobometer.

D.

speedometer.

Answer&Explanation

Answer:OptionC
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage2

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. __________testdeterminestheyieldstrength,Young'smodulusofelasticity,
percentagereductioninarea&percentageelongationofamaterial.
A.

Tensile

B.

Fatigue

C.

Impact

D.

Noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Therollingprocesscannotbeusedtoproduce
A.

plates

B.

rods

C.

tubes

D.

wires

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage3

11. CoefficientofperformanceofaCarnotcyclerefrigeratoroperatingbetween23Cand+
27Cis
A.

B.

C.

0.5

D.

1.5

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Presenceofnickel&chromiuminsteeldoesnotraiseits
A.

elasticlimit

B.

machiningproperties

C.

ductility

D.

resilience

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Hotextrusionprocessisnotusedformaking
A.

castironpipefordomesticwatersupply.

B.

aluminiumcurtainrods.

C.

stainlesssteeltubesusedinfurnitures.

D.

anyofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Additionof__________tosteeldoesnothelpinimprovingitsmachinability.
A.

sulphur

B.

silicon

C.

lead

D.

phosphorous

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Quartzisa__________material.
A.

diamagnetic

B.

ferromagnetic

C.

ferroelectric

D.

piezoelectric

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage4

16. Theunitsoftherateconstantforasecondorderreactionare
A.

sec1.mole.

B.

moles1.sec1.

C.

moles1.sec1.

D.

moles1.sec1.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Themostseriousmanufacturingdefectfromfracturetoughnesspointofviewis
A.

surfaceroughness

B.

pores

C.

sphericalinclusion

D.

crack

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Leakageinacookinggascylinderisdetectedby
A.

radioisotopes.

B.

pouringsoapsolutiononthesurfaceandlocatingthegasbubbles.

C.

halidetorch.

D.

pungentsmellofmercaptanspresentinthegas.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Whichofthefollowingisthemostwearresistantgradeofcarbideusedforthecutting
tools?
A.

Aluminiumcarbide

B.

Tungstencarbide

C.

Nickelcarbide

D.

Ironcarbide

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Theratioofmassofaneutrontothatofanelectronisabout1839.Whatistheratioof
themassofaprotontothatofanelectron?
A.

159

B.

1837

C.

2537

D.

10000

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage5

21. Laserisadevicetoproduce
A.

gammarays.

B.

microwaves.

C.

abeamofwhitelight.

D.

abeamofcoherentlight.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Additionofsmallamountof__________togreycastironisdonetoproducenodular
greycastiron.
A.

manganese

B.

phosphorous

C.

magnesium

D.

chromium

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Minimumthermalefficiencyofasteamboilermaybearound__________percent
A.

25

B.

45

C.

65

D.

20

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Thetemperatureatwhichthemagneticpropertyofirondisappears(i.e.,itbecomesnon
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage5

magnetic)anditselectricalconductivity&specificheatalsochanges,iscalledthe'Curie
point',whichis__________C.
A.

768

B.

908

C.

1400

D.

1539

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Fatiguelimitimprovementbyoverstressingthemetalbysuccessivelyincreasingtheload
iscalledcoaxing.Infatiguefailure,thematerialfails
A.

belowtheyieldpoint.

B.

abovetheyieldpoint.

C.

belowtheelasticlimit.

D.

attheelasticlimit.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage6

26. Themalleabilityofamaterialisthepropertybyvirtueofwhichitcanberolledor
hammeredintothinsheets.Whichofthefollowingmaterialshasthemaximum
malleability?
A.

Lead

B.

Copper

C.

Aluminium

D.

Wroughtiron

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Particlenatureofcathoderaysisprovedduetothefactthatthey
A.

travelinastraightline.

B.

getdeflectedbymagneticelectricfield.

C.

producefluorescence.

D.

heattheexposedmaterial.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Themostcommonlyusedmoderatorinnuclearpowerplantsis
A.

graphite

B.

lightwater

C.

heavywater

D.

berellium

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Babbitliningisusedonbrass/bronzebearingstoincreasethe
A.

antifrictionproperties.

B.

compressivestrength.

C.

bearingresistance.

D.

wearresistance.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Theheatofneutralisationremainsconstant,whenthereisareactionbetweendilute
solutionsofstrong
A.

baseandstrongacid.

B.

baseandweakacid.

C.

acidandweakbase.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage7

31. Joiningofthinfoilsispreferredtobedoneby
A.

gammarays

B.

Xrays

C.

microwaves

D.

gaswelding

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Whichofthefollowingmetalsreactsviolentlywithwater?
A.

Mercury

B.

Sodium

C.

Calcium

D.

Magnesium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Asteamcarrayingpipelineisinsulatedwithtwolayersofinsulatingmaterialswiththe
inferiorinsulationmaterialformingtheinnerpart.Ifthetwoinsulatinglayersare
interchanged,theheatconductedwill
A.

increase.

B.

decrease.

C.

remainunaffected.

D.

mayincreaseordecreasedependsonthethicknessofeachlayer.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. Damagetometalsurfacebymechanicalactioniscalled
A.

pitting

B.

corrosion

C.

erosion

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Theescapevelocityofabodyonearthwhichisindependentofitsmassisabout
__________km/second.
A.

B.

C.

11

D.

15

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage8

36. Whichofthefollowingtestisusedfordistinguishingamongdryoils,semidryingoilsand
nondryingoils?
A.

Elaidentest

B.

ReichartMeisslvaluetest

C.

Hentervaluetest

D.

Iodinevaluetest

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thewetbulbtemperatureislowerindryairthaninwetairatthesametemperature.A
drybulbthermometerregistersahighertemperaturethanawetbulbthermometer
exceptat__________percentrelativehumidity.
A.

B.

100

C.

50

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Theprocessofremovalofscaleformedduringhotrollingofsteelistermedas
A.

descaling

B.

shotblasting

C.

pickling

D.

skimming

Answer&Explanation

Answer:OptionC
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage8

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Apsychrometerdoesnotmeasurethe__________temperatureofmoistair.
A.

dewpoint

B.

drybulb

C.

wetbulb

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Anidealmaterialformakingcookingvesselsshouldhave
A.

highheatcapacity.

B.

lowheatcapacity.

C.

highthermalconductivity.

D.

both(b)and(c).

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage9

41. Whichofthefollowingapproachestheidealgasbehaviourmostclosely?
A.

Wetsteam

B.

Saturatedsteam

C.

Superheatedsteam

D.

Saturatedwater

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Whichofthefollowingisnotthefunctionofavolutecasingprovidedinacentrifugalpump
?
A.

Toreducetheheadlossindischarge.

B.

Toincreasethepumpefficiency.

C.

Tocollectliquidfromtheperipheryoftheimpellerandtotransmitittothe
deliverypipeatconstantvelocity.

D.

Toincreasethepumpdischargerate.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Thepressureoutsideabubble/dropletofliquidis__________theinternalpressure.
A.

greaterthan

B.

lessthan

C.

equalto

D.

unpredictabledependsonthebubblesize

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Twowiresofthesameradius&materialhavinglengthintheratioof1:2arestretched
bythesameforce.Thestrainproducedinthetwowireswillbeintheratioof
A.

1:1

B.

1:2

C.

2:1

D.

1:4

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Powdermetallurgytechniqueisusedintheproductionof__________tools.
A.

tungstencarbide

B.

highcarbonsteel

C.

highspeedsteel

D.

drilling

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage10

46. Principalalloyingelementsofcasttoolalloyswhichhaveveryhighwearresistance&high
temperaturestrengthare
A.

cobalt,chromium&tungsten,

B.

cobalt,chromium&nickel.

C.

molybdenun,tungsten&chromium.

D.

cobalt,zirconium&molybdenum.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Whichofthefollowingisthemostsuitablematerialofconstructionforthecondenser
tubes,wherethecoolingmediumisbrine(saltywater)?
A.

Aluminium

B.

Copper

C.

Titanium

D.

Stainlesssteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Whichofthefollowingisanoredressingoperation?
A.

Classification

B.

Smelting

C.

Roasting

D.

Noneofthese

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswersPage10

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Gratingsisassociatedwiththemeasurementof
A.

lineardisplacement.

B.

concavity/convexity.

C.

surfacetexture.

D.

flatness.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. __________jointismostlyusedforjoiningpipescarryingwateratlowpressure.
A.

Nipple

B.

Socket

C.

Union

D.

Bellandspigot

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswers

1. AsolutionwhichresistschangeinitspHvalueonadditionofacid/alkaliiscalledthe
__________solution.
A.

neutral

B.

ideal

C.

buffer

D.

zeropH

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Pickoutthewrongstatement.
A.

Weldabilityofhighcarbonsteelispoorercomparedtolowcarbonsteel.

B.

Invarisamagneticalloy.

C.

Magneticpermeabilityofthediamageneticmaterialislessthanone.

D.

Martensitictransformationnevergoestocomplection(i.e.,100%)atroom
temperature.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Theboltissubjectedto__________whenthenutistightenedbyputtingthewasher
beneathit.
A.

tension

B.

shear

C.

compression

D.

bending&tension

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection5ChemicalEngineeringQuestionsandAnswers

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Whichofthefollowingisnotcategorisedastheoreagglomerationprocess?
A.

Nodulising

B.

Pelletising

C.

Balling

D.

Briquetting

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Withincreaseintemperature,thesurfacetensionofwater
A.

increases

B.

decreases

C.

remainsconstant

D.

increaseslinearly

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage2

6. Thesizeofthetetrahedralvoidintheclosestpackingofatomsis__________thatofthe
octahedralvoid.
A.

equalto

B.

greaterthan

C.

lessthan

D.

either(a),(b)or(c)dependsonthesizeofatom

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. __________theexhaustgasisanindicationoftheincompletecombustionoffuel.
A.

Lowtemperatureof

B.

Hightemperatureof

C.

High%ofCOin

D.

High%ofCO2in

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Air/fuelratioonmolar(volume)basisforcombustionofmethanewiththeoreticalquantity
ofairwithbe
A.

9.5:1

B.

12.5:1

C.

15.5:1

D.

18.5:1

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage2

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Frostformationontheevaporatortubesinthedomesticrefrigerators
A.

canbepreventedbyproperdesign.

B.

decreasedcompressorpower.

C.

causesheatlossduetopoorheattransfer.

D.

isimmaterial.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Functionoffeedcheckvalveinaboileristo
A.

facilitatecirculationofhighpressurefeedwater.

B.

checkthewaterlevelintheboilerdrum.

C.

preventthebackflowofwater.

D.

regulatethewaterflowtoboiler.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage3

11. Ganistercontainsmaximumpercentageof
A.

FeO

B.

SiO2

C.

MgO

D.

MnO2

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Nitrogenisnotanessentialcomponentof
A.

protein

B.

urea

C.

oils&fats

D.

anyofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Ininventorycontroltheory,theeconomicorderquantity(EOQ)isthe
A.

lotsizecorrespondingtobreakevenanalysis.

B.

averagelevelofinventory.

C.

optimumlotsize.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage3

14. Themainchargeinblastfurnaceisusually
A.

ironore&coke.

B.

ironore,coke&air.

C.

limestone,coke&ironore.

D.

limestone,sand&ironore.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Theatmospherictemperatureduringmeltingofice/snow(intheatmosphere)
A.

decreases

B.

increases

C.

remainssame

D.

mayincreaseordecreasedependsonthealtitudewheresnowmelts

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage4

16. Atroomtemperature,F.C.C.crystalstructureisobservedin
A.

lead

B.

cupronickel

C.

titanium

D.

tungsten

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Thebasicfunctionofthedruminaboileristo
A.

actasastorageforfeedwater.

B.

actasastorageforsteam.

C.

separatesteamfromwater.

D.

removesettlingimpuritiesfromsteam.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Pickoutthewrongstatement.
A.

TheXrayscannotbedeflectedbyelectricfieldunlikecathoderays.

B.

TheintensityofXrayscanbemeasuredbyionisationcurrentproducedduetothe
ionisationofgasbyXrays.

C.

ThequalityofXrayscanbecontrolledbyvaryingtheanodecathodevoltage.

D.

Crystalstructureofamaterialcanbestudiedbyanelectronmicroscope.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Colloidscanbepurifiedby
A.

dialysis

B.

reverseosmosis

C.

coagulation

D.

peptization

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Themostprominentsinglecauseofcorrosioninboilertubes,drums,economisersand
steamsuperheatersinathermalpowerplantboileristhe
A.

wateralkalinity&leakage.

B.

hydrazineadditionduringfeedwatertreatment.

C.

releaseofnoncondensablegasfromwaterintheboiler.

D.

scaleformation.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage5

21. Maximumcarboncontentincastironis__________percent.
A.

3.8

B.

C.

4.3

D.

4.6

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Screwsarespecifiedbytheir__________diameters.
A.

minor

B.

major

C.

pitch

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Thestressatwhichextensionofthematerialtakesplacemorerapidlyascomparedtothe
increaseinloadistermedasthe__________pointofthematerial.
A.

elastic

B.

ultimate

C.

yielding

D.

breaking

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Amaterialbeingtestedforendurancestrengthissubjectedtothe__________load.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage5

A.

impact

B.

completelyreversed

C.

dynamic

D.

static&dynamic

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Withincreaseinpressure,thelatentheatofsteam
A.

increases.

B.

decreases.

C.

remainsunchanged.

D.

datainsufficientcan'tbepredicted.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage6

26. 'Flaretower'usedinindustryismeantfor
A.

ventingoff(afterburning)theexcessinflammable/toxicgasesathighpressure.

B.

absorbingthepollutantgasesfromthefurnaceexhaust.

C.

coolingoffurnaceexhaustgases.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Whichofthefollowinghasthehighestmodulusofelasticity(about7x10 6kg/cm2)?


A.

Highspeedsteel

B.

Stainlesssteel

C.

Tungstencarbide

D.

Superalloys

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. ElectrolyticreductioncellusedforconversionofcalcinedAl2O3toAlisacarbonlined
furnaceoperatingat800900C.Thepurposeofelectriccurrentsuppliedtothefurnace
isto
A.

achieveveryhighpurityofaluminium(99.9%).

B.

keeptheelectrolyteinliquidconditionbythegenerationofheat.

C.

electrolyticallydissociatealumina.

D.

both(b)&(c).

Answer&Explanation

Answer:OptionD
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Allradiationsfallingonablackbodyare
A.

refracted

B.

reflected

C.

transmitted

D.

absorbed

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Styrofoamisthecommercialnameof
A.

polyurathene

B.

polystyrene

C.

polyacrylonitrile

D.

polybutadiene

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage7

31. Ceramicmaterialsare
A.

organicinnature.

B.

strongerincompressionthanintension.

C.

alwaysamorphousinnature.

D.

alwaysbadheatconductors.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Drynessfractionofdrysteamis
A.

B.

C.

D.

0.5

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Whichofthefollowingprocessesfollowsthehardeningprocessforreducingthehardening
strains&increasingthetoughnessofthesteelpart?
A.

Anodising

B.

Tempering

C.

Carburising

D.

Annealing

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Heatrequiredtoraisethetemperatureofabodyby1Ciscalledits
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage7

A.

heatcapacity.

B.

specificheatcapacity.

C.

thermalconductivity.

D.

waterequivalent.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Coatingofzincoversteelisknownas
A.

cladding

B.

galvanising

C.

anodising

D.

passivation

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage8

36. Airpetrolratioinanautomotivepetrolengineisaround
A.

14:1

B.

22:1

C.

25:1

D.

4:1

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thepropertyofmaterial,bywhichagivenamountofenergyisabsorbedbyit,without
plasticdeformationiscalled
A.

resilience

B.

toughness

C.

ductility

D.

impactstrength

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Sacrificialanodemethodisusedintheprotectionofpipelineswhichareburied
underground.Sacrificialanode
A.

occurshigherintheelectrochemicalseriesofmetals.

B.

isexemplifiedbymagnesiumplate.

C.

ismuchcheaperthanthecathodicbasematerialtobeguardedagainstcorrosion.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage8

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Electrochemicalcorrosioncanoccur,onlyif__________ispresentincontactwithmetal.
A.

air

B.

oxygen

C.

liquidmedium

D.

gaseousmedium

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Crystallisationofpolymersisanundesirableproperty.Crystallisationofcelluloidis
preventedbyadding
A.

glycerol

B.

nitrocellulose

C.

camphor

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage9

41. Preheatingpriortoweldingisdoneforthepurposeof
A.

decreasingcoolingrate.

B.

facilitatingfusionofhighmeltingmetals.

C.

preventinghotcracking.

D.

ensuringfullpenetration.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Presenceofsulphurinsteelreducesthe
A.

hardness.

B.

grainsize.

C.

tensilestrength.

D.

toughness&transverseductility.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Frotherisaddedinthefrothfloatationcellusedinorebeneficiationtostabilisetheair
bubbles(i.e.,froth),whichwillholdtheoreparticles,butitdoesnotaffectthefloatability
ofminerals.Whichofthefollowingisnotusedasafrother?
A.

Cresylicacid

B.

Xanthaies

C.

Pineoil

D.

all'a''b'&'c'

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Ottocycleusedinsparkignitionpetrolenginesisalsoknownastheconstant
__________cycle.
A.

volume

B.

pressure

C.

heat

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Fireonfueloillinescanbeextinguishedby
A.

foam

B.

steam

C.

water

D.

carbondioxide

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage10

46. Inafurnacewithheatingelementtemperatureat1700C,thedominantmachanismof
heattransferwillbe
A.

conduction

B.

radiation

C.

naturalconvection

D.

forcedconvection

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Opticalactivityisa/an__________property.
A.

additive

B.

constitutive

C.

both(a)&(b)

D.

neither(a)nor(b)

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Solutionlossreactionoccurs
A.

intheblastfurnaceshaft.

B.

duringpretreatmentofhotmetal.

C.

intheL.D.process.

D.

duringdeoxidationintheladle.

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Outofthefollowingmaterials,theonewhichgenerallyexhibitsanyieldpointis
A.

hardbronze

B.

softbrass

C.

coldrolledmildsteel

D.

hotrolledmildsteel

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. TheefficiencyofaCarnotheatengineoperatingbetweenabsolute
temperaturesT1andT2(when,T1>T2)isgivenby(T1T2)/T1.Thecoefficientof
performance(CO.P.)ofaCarnotheatpumpoperatingbetweenT1andT2isgivenby
A.

T1/(T1T2)

B.

T2/(T1T2)

C.

T1/T2

D.

T2/T1

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswers

1. Grossnationalproduct(GNP)meansthetotalvalueof__________inacountry.
A.

goodsproduced

B.

goldreserve

C.

earningofthecitizens

D.

taxespaid

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Energytobesuppliedtotheradioactivenucleusfortheemissionofaneutronis
__________MeV.
A.

0.8

B.

7.8

C.

200

D.

10000

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Thecoordinationnumberinsimplecubicstructureis
A.

B.

C.

D.

12

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Outofthefollowingsurfaces,theemissivitywillbeminimumfor
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

26/04/2015

ChemicalEngineeringBasicsSection7ChemicalEngineeringQuestionsandAnswers

A.

aluminiumfoil

B.

concrete

C.

plaster

D.

smoothglass

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Thepropertyofmaterial,bywhichagivenamountofenergyisabsorbedbyitwithout
plasticdeformation,iscalledthe
A.

resilience

B.

toughness

C.

ductility

D.

impactstrength

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage2

6. Nonferrousalloysusedformakingcuttingtoolsneednothavehigh
A.

abrasionresistance

B.

toughness

C.

redhardness

D.

cuttingspeed

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Hollowshaftscanbemadeasstrongassolidshaftsbymakingthetwistingmomentsof
boththeshaftssame.Shaftsmadeby__________haveresidualstresses.
A.

forging

B.

coldrolling

C.

hotrolling

D.

casting

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Capacity&powerrequirementforanaircompressorworkingathighaltitudecomparedto
sealevelwillbe
A.

more

B.

less

C.

same

D.

eithermoreorlessdependsontheclimaticconditions.

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage2

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Glycereneisusedasacoolantincoolingofsomeenginesinsteadofwater,because
A.

itshigherboilingpoint(290C)increasesitsheatcarryingcapacity.

B.

compartivelylessweightofcoolantisrequired.

C.

smallerradiatorcanbeused.

D.

alla,b&c.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Coldworkingofamaterialresultsinincreaseinhardness,whichistermedasthe
__________hardening.
A.

cold

B.

work

C.

age

D.

induction

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage3

11. Potablewatermeansthewaterusedfor
A.

firefighting

B.

cooling

C.

drinking

D.

evaporationtoproducesteam

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Onetonofrefrigerationisnotequivalenttotheheatremovalrateof
A.

200BTU/minute

B.

50kcal/minute

C.

50kJ/sec.

D.

3.5KW

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Startingfrictionislowincaseofthe__________lubrication.
A.

boundary

B.

hydrodynamic

C.

hydrostatic

D.

mixed/semifluid

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage3

14. Ultimatestrengthintensionascomparedtothatinshearforsteelis
A.

half

B.

onethird

C.

oneandhalftimes

D.

onefourth

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Whichofthefollowingheattreatmentprocessesisusuallyappliedtocastings?
A.

Tempering

B.

Annealing

C.

Normalising

D.

Carburising

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage4

16. Photographicplatesarecoatedwith
A.

silvernitrate

B.

silverhalide

C.

calciumsilicate

D.

metallicsilver

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Hardeningofsteelisnotpossible,unlessitisheated__________criticalpoint.
A.

abovethehighest

B.

abovethelowest

C.

betweenthefirst&second

D.

betweenthesecond&third

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Isotropicmaterialshavethesame__________inalldirections.
A.

inducedstresses

B.

density

C.

elasticproperties

D.

thermalproperties

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Themostimportantrequirementforaluminiumindustryistheavailabilityofcheap
A.

ore

B.

electricalpower

C.

labour

D.

&abundantwater

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Spheriodisingofamaterialisa/an__________process.
A.

normalising

B.

annealing

C.

tempering

D.

hardening

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage5

21. Thetracemetalpresentininsulinis
A.

Cu

B.

Zn

C.

Fe

D.

Ni

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Coldcrackingintheheataffectedzoneofahighstrengthsteelweldcantakeplace
becauseofthe
A.

retainedaustenite.

B.

martensiteformation.

C.

relativelyhighsulphurcontentinthebasemetal.

D.

sufficienthydrogenpresentintheweldingarc.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Drossingisa__________operation.
A.

smelting

B.

dressing

C.

roasting

D.

dressing

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Mostofthephosphorouspresentintheblastfurnaceburdenentersinto
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage5

A.

hotmetal

B.

fluegases

C.

slag

D.

refractorylining

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Duringsensibleheatingofhumidair
A.

relativehumidityincreases.

B.

dewpointremainsconstant.

C.

drybulb&wetbulbtemperatureincreases.

D.

both'b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage6

26. IroncontentinIndianironoreisabout__________percent.
A.

8085

B.

6065

C.

4045

D.

2025

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Theheattreatmenttowhichthesteelwirecontaining>0.25%carbonissubjectedtois
A.

fullannealing

B.

brightannealing

C.

patenting

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. __________ofhardalloyandtoolsteelisdonetomakeiteasilymachinable.
A.

Casecarburising

B.

Tempering

C.

Normalising

D.

Annealing

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage6

29. Whichofthefollowingmainlydecidesthecurrenttobeemployedisarcwelding?
A.

Electrodesize

B.

Platethickness

C.

Voltageacrossthearc

D.

Weldedportionlength

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Temperatureattainedinsolderingofmetalsisabout__________C.
A.

150300

B.

400500

C.

650800

D.

10001100

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage7

31. Thenormalstressisthesameinalldirectionsatapointinafluid,onlywhenthefluid
A.

isatrest&haszeroviscosity.

B.

isfrictionless.

C.

fluidlayerhasnomotionrelativetoanadjacentlayeroffluid.

D.

isincompressible&frictionless.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. A2kgobjectweighs1.8kgfonaspringbalance.Thevalueof'g'atthatlocationin
m/sec2is
A.

8.82

B.

9.81

C.

10.88

D.

0.95

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Inchemicaldehumidificationofair
A.

bothspecifichumidity&drybulbtemperatureincreases.

B.

bothspecifichumidity&drybulbtemperaturedecreases.

C.

specifichumiditydecreases&drybulbtemperatureincreases.

D.

specifichumidityincreases&drybulbtemperaturedecreases.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. WhatisthepHofdistilledwater?
A.

B.

C.

D.

14

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Pickoutthecorrectstatement.
A.

Hotworkedmaterialsaresubjectedtoannealingtoremoveinternalstresses.

B.

Annealingofsteelhardensitslightly

C.

Normalisingofamaterialinducesstresses.

D.

Temperingofamaterialimprovesductility&toughnessbutreducesshardness&
brittlenes.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage8

36. Dielectric
A.

isanelectricalinsulatingmaterial.

B.

oflowresistivityispreferred.

C.

shouldhavehighthermalconductivity.

D.

neednotdefythecorrosiveactionofchemicals.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Normalisingofanobjectdoesnot
A.

refinecoarsegrainstructureobtainedduringhotworking.

B.

improveductility.

C.

improveyieldstrength.

D.

improvemachanicalproperties.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Plasmais
A.

ahightemperatureneutralgas.

B.

nothingbutionisedgas.

C.

asourceofsteadyandhighestcontrollablepressure.

D.

formedatverylowtemperature.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Themachanisminvolvedintheremovalofmetalindrillingoperationisby
A.

compression

B.

extrusion

C.

shearing

D.

both'b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Thermalconductivityofamaterialdoesnotdependuponits
A.

mass

B.

volume

C.

surfacearea

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage9

41. Carbonsupplyinpackcarburisingprocessisintheformof
A.

charcoal

B.

calciumcarbide

C.

hydrocarbonoil

D.

graphite

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Waterhammeriscausedinsteamcarryingpipelines,becauseof
A.

partialcondensationofsteam.

B.

vibrationofthepipeline.

C.

highdegreeofsuperheatofsteam.

D.

itsexposuretotorrentialrain.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Powdermetallurgyisusedtoproduce
A.

highprecisioncomponentswithcomplexcavitiesandsharpfeatures.

B.

componentsoflargesize.

C.

porosityfreecomponents.

D.

componentsofsuchalloyswhoseconstituentsdonotformalloysreadily.

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. CatalystusedinthecatalyticconverteremployedinautomobilestoconvertCOinto
COandforcompleteoxidationofunburnthydrocarbonsis
A.

nickel

B.

cobalt

C.

vanadium

D.

platinum

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Forathermodynamicsystemundergoingaprocess,whichofthefollowingpairsbest
expressestherelationshipsimilartothatexpressedbythepressurevolumeplot?
A.

Temperatureentropy.

B.

Temperaturepressure.

C.

Enthalpyentropy.

D.

Enthalpypressure.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage10

46. Themainconstituentofbonesis
A.

CaF2

B.

Ca3(PO4)2

C.

CaCO3

D.

CaCl2

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Globularformofcementiteisformedduringthe__________process.
A.

spherodising

B.

hardening

C.

annealing

D.

normalising

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Faraday'slawofelectrolysisisrelatedtothe
A.

cationspeed.

B.

atomicnumberofthecation.

C.

equivalentmassoftheelectrolyte.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Thetwoelementsrequiredtoformsubstitutionalsolidsolutionshouldnothave
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswersPage10

A.

samecrystallinestructure.

B.

samevalancy

C.

widelydifferingelectronegativity.

D.

sameatomicsizes.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Rankinecyclecomprisesoftwoisothermalandtwo__________processes.
A.

isobaric

B.

polytropic

C.

isentropic

D.

noneofthese

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswers

1. Diamagneticmaterials
A.

aremagnetisedbyeddycurrentsonly.

B.

arenonmagneticandcannotbemagnetised.

C.

aremagnetisedindirectionoppositetothemagneticfield.

D.

canbemagnetisedinonedirectiononly.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Inconnectionwithcorrosionofmetals,passivationistheprocessthat
A.

intensifiesdeterioration.

B.

changesthecompositionofthemetal.

C.

inhibitsfurtherdeterioration.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Withincreaseinimpuritiesinmetals,theircorrosionresistances
A.

increase

B.

decrease

C.

remainsame

D.

mayincreaseordecreasedependingonthetypeofmetal

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection8ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Mostimportantpropertyofsteelsforuseinautomobilebodiesisthe
A.

formability

B.

yieldstrength

C.

toughness

D.

resilience

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Considerationofthecreepisthemostimportantincaseofthe
A.

bladesofgasturbine.

B.

pistonofanI.C.engine.

C.

flywheelofsteamengine.

D.

cyclechain.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage2

6. Pipelinescarryingvariousutilitiesinchemicalindustriesareidentifiedbytheircolour
codes.Thecolorofpipelinecarryingsteamis
A.

black

B.

silvergrey

C.

green

D.

yellow

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whatisthepercentageofchromiumin1841highspeedsteel?
A.

B.

C.

18

D.

23

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Preheatingbeforeweldingisdoneto
A.

maketheplatesofter.

B.

burnoil&greasestickingtoplatesurfaces.

C.

avoidplatedistortion.

D.

preventcoldcracks.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Thermaldiffusivityofasubstanceisproportionalto(where,k=Thermalconductivity)
A.

1/k

B.

C.

k2

D.

1/k2

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Dewpointtemperaturealwaysgivesanindicationofthe__________ofthemoistair.
A.

dryness

B.

moisturecontent

C.

coolness

D.

latentheat

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage3

11. Forafirstorderchemicalreaction,theconcentrationofthereactantdecreases
__________withtime.
A.

linearly

B.

exponentially

C.

logarithmically

D.

inversely

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. AirstandardOttocycleismoreefficientthanthedieselcycleforthesame
A.

heataddition&compressionratio.

B.

heataddition&pressure.

C.

compressionratio&pressure.

D.

cylinderdimension&rpm.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Incaseofbrasses,withdecreasingzincpercentageandincreasingcopperpercentage,its
__________increases.
A.

percentageelongation

B.

brinellhardness

C.

tensilestrength

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Asuitablelubricantusedforwatchesis
A.

metallicsoapsolution

B.

grease

C.

palmoil

D.

hazelnutoil

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Outofthefollowing__________ironhasthebestcapabilitytobearsudden&excessive
shocks.
A.

white

B.

cast

C.

wrought

D.

pig

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage4

16. Fortheirreversiblereaction,C +2C=C C ,H298=60000J.mole1.Ifasystem


a
a 2
initiallycontaining2molesofcalcium,3molesofcarbonand1moleofcalciumcarbideis
allowedtoreacttocompletion,theheatevolvedat298Kwillbe
A.

30000J

B.

60000J

C.

90000J

D.

240000J

ViewAnswer

Workspace

Report

DiscussinForum

17. Projectionwelding&studweldingiscategorisedasthe__________welding.
A.

pressure

B.

thermit

C.

resistance

D.

arc

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Thedrivingforceforthesinteringofapowdercompactis
A.

strainenergy.

B.

surfaceenergy.

C.

volumeenergy.

D.

stackingfaultenergy.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Theamountofwaterevaporatedinkgperkgoffuelburntinaboileriscalledthe
__________ofaboiler.
A.

evaporativecapacity

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage4

B.

evaporationefficiency

C.

thermalefficiency

D.

steamload

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. VolumetriccompositionoffluegasanalysedwiththeOrsatapparatusis:CO2=12%,
O2=8%,CO=nil,N2=80%.Thisfluegascompositionindicatesthat
A.

pureoxygenhasbeenusedforcombustion.

B.

nitrogenpercentageinthefuelisveryhigh.

C.

excessairhasbeenusedforcombustion.

D.

hydrogenisnotpresentinthefuel.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage5

21. AfluidistermedastheNewtonionfluid,whentheshearstressis__________the
velocitygradient.
A.

independentof

B.

inverselyproportionalto

C.

directlyproportionalto

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Transitionfromlaminarflowtoturbulentflowinfluidflowthroughapipedoesnotdepend
uponthe
A.

lengthofthepipe.

B.

diameterofthepipe.

C.

densityofthefluid.

D.

velocityofthefluid.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Whenthewetsteamisthrottledbutstillremainswetattheexitofthethrottlevalve,
thenitstemperature&drynessfractionrespectively
A.

decreases&increases.

B.

increases&increases.

C.

increases&decreases.

D.

decreases&decreases.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage5

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Limestoneadditionintheblastfurnaceisdonetoflux__________presentintheraw
materials.
A.

SiO2

B.

Al2O3

C.

MnO2

D.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. The'transitiontemperature'forductiletobrittlebehaviourofsteelincreaseswithincrease
inthe__________contentinsteel.
A.

carbon

B.

manganese

C.

botha&b

D.

neither'a'nor'b'

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage6

26. Theburnoutheatfluxinthenucleateboilingregimeisnotafunctionofthe
A.

liquiddensity.

B.

vapourdensity.

C.

temperaturedifference.

D.

heatofevaporation.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Theapproximateheightofablastfurnacehavingausefulvolumeof2000m3isabout
__________metres
A.

25

B.

35

C.

55

D.

75

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Thecathodeinanelectrochemicalcellalwayscarries
A.

negativecharge.

B.

positivecharge.

C.

zerocharge.

D.

positiveornegativechargedependinguponthenatureofthecell.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. Anoxidationprocessisaccompaniedwithdecreaseinthe
A.

numberofelectrons.

B.

oxidationnumber.

C.

numberofions.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Hotdippingprocessisusedforcoatingalowmeltingpointmetal(e.g.Pb,Sn,Zn)oniron,
steel&copperhavingrelativelyhighermeltingpoints.Whichofthefollowingisnotahot
dippingprocess?
A.

Galvanising

B.

Tinning

C.

Sheardising

D.

noneofthese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage7

31. Hotextrusionofaluminiumisdoneinthetemperaturerangeof__________C.
A.

550600

B.

450500

C.

350400

D.

250300

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Stelliteisa__________material.
A.

ferrous

B.

ceramic

C.

cementedcarbide

D.

nonferrouscastalloycuttingtool

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Percentageofargon(byvolume)indryatmosphericairisabout
A.

0.09

B.

0.3

C.

0.57

D.

0.94

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Anabruptandsuddenfallinthereadinpofbarometerisanindicationofthe
A.

storm

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage7

B.

rain

C.

clearweather

D.

coldwave

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Steamcondensertubesaremadeofadmirabilitybrass,inwhichpercentageofzinc&
copperare__________respectively.
A.

70&30

B.

30&70

C.

50&50

D.

90&10

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage8

36. Withincreaseintemperature,theelectricalconductivityofa__________decreases.
A.

semiconductor

B.

metaloralloy

C.

dielectric

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Alltheatomsoftheworldcompriseofelectrons,proton&neutronexceptthatof
__________atominwhichneutronisabsent.
A.

deuterium

B.

hydrogen

C.

neon

D.

helium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Whichofthefollowinggasescauseglobalwarming?
A.

Carbonmonoxide

B.

Carbondioxide

C.

Nitrogen

D.

Ozone

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Multistagecompressionofairascomparedtosinglestagecompressionoffersthe
advantageof
A.

powersavingperunitweightofairdelivered.

B.

moistureeliminationintheinterstagecooler.

C.

increasedvolumetricefficiency.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Finegrainedsteelshave
A.

highbrittleness

B.

highertendencytodistort

C.

highductility

D.

noneofthese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage9

41. Dislocationcrossslipisdifficultinthosematerials,whichhave
A.

largenumberofslipsystems.

B.

highworkhardeningrate.

C.

coarsegrainsize.

D.

lowstackingfaultenergy.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Shrinkageallowanceonpatternisprovidedtocompensateforshrinkagewhenthe
A.

metalchangesfromliquidstatetosolidstateatfreezingtemperature.

B.

solidphasetemperaturedropsfromfreezingtemperaturetotheroom
temperature.

C.

liquidmetaltemperaturedropsfrompouringtemperaturetoroomtemperature.

D.

liquidmetaltemperaturedropsfrompouringtemperaturetofreezing
temperature.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Sparkplugisprovidedina/an
A.

enginehavingcarburettor.

B.

dieselengine.

C.

compressionignitionengine.

D.

both(b)&(c).

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Oxyacetylenereducingflameisusedwhilecarryingoutweldingon
A.

alloysteel

B.

greycastiron

C.

mildsteel

D.

highcarbonsteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. NusseltnumberisrelatedtotheReynoldsnumber(Re)inturbulent&laminarflow
respectivelyas
A.

Re0.5,Re0.8

B.

Re0.8,Re0.5

C.

Re0.8,Re0.5

D.

Re0.8,Re0.5

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage10

46. Leadpencilcontains
A.

graphite

B.

leadsulphide

C.

lead

D.

both(b)&(c)

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Functionofgearboxisto
A.

reducethespeed.

B.

obtainvariablespeed.

C.

increasethespeed.

D.

producehightorque.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Pearlitecomprisesof
A.

87%cementite&13%Fe.

B.

87%ferrite&13%cementite.

C.

93.33%ferrite&6.67%C.

D.

87%ferrite&13%C.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Whichofthefollowingifpresentinironore,enhancesitsvalue?
A.

Alumina

B.

Alkalioxide

C.

Lime&Magnesia

D.

Noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Asperinternationalnorms,themaximumpermissiblevalueofnoiselevelintheindustrial
environmentis__________decibelsasmeasuredatadistanceof1.5metresfromthe
sourceofnoise.
A.

110

B.

85

C.

60

D.

45

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswers

1. Coatingprovidedontheelectrodesusedinthearcweldingisnotexpectedto
A.

addalloyingelements.

B.

preventelectrodefromcontamination.

C.

stabilisethearc.

D.

provideprotectiveatmospheretoweld.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Desalinationofwater
A.

makesitpotable.

B.

makesitnonpotable.

C.

meansdistillationofwater.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Viscoelasticbehaviourisobservedin__________materials.
A.

noncrystallineorganicpolymeric

B.

ceramic

C.

allcrystalline

D.

allamorphous

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection9ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Probabilityofcavitationoccuringbecomesveryhigh,whenthelocal__________
resultinginwaterbubblesformation,whichonrupturecausecavitation
A.

pressurefallsbelowthevapourpressure

B.

pressurebecomesveryhigh

C.

temperaturebecomeslow

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Whichofthefollowingmaterialshasthepoorestelectricalconductivity?
A.

Carbon

B.

Aluminium

C.

Silver

D.

Stainlesssteel

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage2

6. Glassreactswith
A.

H2SO3

B.

HF

C.

HNO3

D.

K2Cr2O7

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Thecostofprovidingserviceinaqueingsystemdecreaseswiththe
A.

increasedmeantimeinthequeue.

B.

increasedarrivalrate.

C.

decreasedmeantimeinthequeue.

D.

decreasedarrivalrate.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Theactivitycoefficientofthesoluteinadilutesolution
A.

decreaseswiththeincreaseofconcentrationofthesolute.

B.

increaseswiththeincreaseofconcentrationofthesolute.

C.

remainsconstant.

D.

isunityatinfinitedilution.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage2

9. Constituentsofstelliteare
A.

zinc,copper&nickel.

B.

cobalt,chromium&tungsten.

C.

zinc,aluminium&nickel.

D.

nickel,cobalt&vanadium.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Thekinematicviscosity(instoke)andtheabsolute/dynamicviscosity(inpoise)arethe
samefor__________atroomtemperature.
A.

air

B.

water

C.

mercury

D.

alcohol

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage3

11. Multistagecompressionisnecessaryforhighefficiency,
A.

iftheratioofthedeliverypressuretotheintakepressureexceeds5:1.

B.

whenlargeamountofgasistobecompressed.

C.

whenthedeliveredgasisdesiredatveryhighvelocity.

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. __________cannotincreasethefatiguestrengthofamaterial.
A.

Grainrefining

B.

Graincoarsening

C.

Surfacehardening

D.

Shotpeening

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Iftheheadisdoubledin&centrifugalpump,thepowerrequiredwillincreaseintheratio
of
A.

23

B.

2 3/2

C.

2 5/2

D.

2 1/3

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Workhardenablealloysteelusedtomakethebucketwheelexcavators,bladesof
bulldozersandotherearthmovingequipmentscontainiron,carbonand
A.

manganese

B.

silicon

C.

nickel

D.

chromium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Electrometallurgyisnotinvolvedintheextractionof__________fromitsore.
A.

aluminium

B.

tin

C.

lead

D.

both(b)&(c)

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage4

16. Afreelyfloatingobjectisstable,ifitscentreofbuoyancy
A.

coincideswithitscentreofgravity.

B.

liesbelowitscentreofgravity.

C.

liesbelowitsmetacentre.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Whichofthefollowingmaterialsdoesnotformadherentoxidefilmonsurface?
A.

Copper

B.

Nickel

C.

Aluminium

D.

Gold&silver

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Cassiteriteisanoreof
A.

tin

B.

lead

C.

molybdenum

D.

chromium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage4

19. Insheetmetalforming,stretcherstrainsoccurin
A.

duraluminsheets.

B.

lowcarbonsteelsheets.

C.

austeniticstainlesssteelsheets.

D.

Nibasealloysheets.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Forgrindingofsoftermaterials,thegrindingwheelshouldhave__________grainsize.
A.

finer

B.

coarser

C.

medium

D.

anytypeof

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage5

21. Nusseltnumber/Biotnumbervaries
A.

inverselywiththermalconductivity.

B.

directlywithheattransfercoefficient.

C.

directlywiththermalconductivity.

D.

inverselywiththedimensionofthesolid.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Outofthefollowing,maximumtemperaturedropforagivenheatflow&forthesame
thicknesswillbeinthecaseof
A.

steel

B.

glasswood

C.

copper

D.

fireclaybricks

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Parallelstraightlinepatternoftemperaturedistributionforbothhotandcoldfluidsis
observedincaseofheatexchangerofthetype
A.

parallelflowwithequalheatcapacities.

B.

counterflowwithequalheatcapacities.

C.

counterflowwithunequalheatcapacities.

D.

parallelflowwithunequalheatcapacities.

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage5

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Rockwellnumberrepresentsthe
A.

hardnessofasubstance.

B.

colourofapigment.

C.

densityofapolymer.

D.

activeingredientsinafertiliser.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Whichofthefollowingfasteningdeviceshasitsbothendsthreaded?
A.

Bolt

B.

Stud

C.

Setscrew

D.

Splitnut

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage6

26. Notchedbartestisusedfortestingthe__________ofamaterial.
A.

impactstrength

B.

endurancelimit

C.

machinability

D.

corrosionresistance

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Themostsuitablematerialfordiecastingis
A.

iron

B.

copper

C.

steel

D.

nickel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Heatingofanorebelowitsmeltingpointinpresenceofexcessofairiscalled
A.

calcination

B.

smelting

C.

roasting

D.

sublimation

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Depreciationofmachinesfailsundertheindirectexpenseshead.Asperincometax
regulations,itiscalculatedbythe__________method.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage6

A.

diminishingbalance

B.

sinkingfund

C.

multiplestraightline

D.

sumoftheyearsdigit

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Asemiconductorisdamaged&behaveslikeaconductor,onpassingastrongelectric
currentthroughit,becauseitheatsupthecrystals&breaksthecovalantbondsresulting
in__________electrons.
A.

lackoffree

B.

excessof

C.

decreasein

D.

noneofthese

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage7

31. Thebankoftubeslocatedatthebackofthedomesticrefrigeratorsarethe__________
tubes.
A.

refrigerantcooling

B.

evaporator

C.

condenser

D.

throttling

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Materialhavingnegativecoefficientoflinearexpansionis
A.

copper

B.

aluminium

C.

rubber

D.

nickel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Specificgravityofhotmetal(pigiron)is__________timesthatoftheblastfurnaceslag.
A.

B.

C.

0.8

D.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. __________isthehardestmaterialoutofthefollowing.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage7

A.

Boroncarbide

B.

Tungstencarbide

C.

Hardenedsteel

D.

Siliconcarbide

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Thephenomenonofwelddecayisfoundincaseof
A.

gunmetal

B.

brass

C.

stainlesssteel

D.

castiron

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage8

36. Ifasolidiscompressedadiabaticallyinitselasticrange,its__________remainsconstat
A.

internalenergy

B.

enthalpy

C.

entropy

D.

temperature

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. 'GASOHOL'widelyusedinBrazilasamotorfuelisamixtureofalcoholand
A.

petrol.

B.

LPG.

C.

lighthydrocarbongases(e.g.butaneorpropane).

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Ondecreasingthegrainsizeofapolycrystallinematerial,thepropertymostlikelyto
deteriorateis
A.

creep

B.

toughness

C.

tensilestrength

D.

fatigue

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Itispossibletoformmartensite
A.

sometimesbycoldworking.

B.

sometimeswithoutnucleation.

C.

sometimesbygasquenching.

D.

onlyinironbasedalloys.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Whichofthefollowingmaterialhandlingequipmentsisnotsuitableformovingmaterials
invaryingpaths?
A.

Handtrolley

B.

Beltconveyor

C.

Crane

D.

Truck

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage9

41. Theeffectoffrictionontheflowofsteamthroughanozzleistodecreasethe
__________ofsteam.
A.

wetness

B.

massflowrate

C.

both'a'&'b'

D.

neither'a'nor'b'

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Thermalequivalentofelectricalpowerinpracticalcalculationis__________kcal/kWh.
A.

746

B.

3000

C.

1000

D.

550

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Gross&Netcalorificvalueswillbethesamefor
A.

methane

B.

propane

C.

carbonmonoxide

D.

hydrogen

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. AspertheIndianboilerregulation(IBR),thetypeofjointpreferredforthecircumferential
jointisthe__________joint.
A.

butt

B.

lap

C.

welded

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Presenceofsmallquantityofsulphurinlowcarbonsteelimprovesits
A.

formability

B.

machinability

C.

weldability

D.

hardenarality

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage10

46. Duraluminisanalloyofaluminiumandcopper.Percentageofcopperinduraluminis
A.

38

B.

26

C.

16

D.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Copperisnotpresentasanalloyingconstituentin
A.

siliconbronze

B.

constantan

C.

nichrome

D.

deltametal

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Leadisaddedto60:40brassprimarilytoimprove
A.

machinability

B.

corrosionresistance

C.

fluidity

D.

strength

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswersPage10

49. Airintakeforanaircompressorshouldbepreferablytakenfrom
A.

asite,wherecoolingtowersarelocatednearby.

B.

asite,whereopencoalyardinlocatednearby.

C.

anairconditionedroommaintainedatatemperatureof18C.

D.

anoutsideatmosphereat10C.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Currentassetofafactoryincludesthe
A.

goodwillofthecompany.

B.

commonstocksheldbythecompany.

C.

manufacturingplant&equipment.

D.

inventory.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswers

1. LVDTusedfordisplacementmeasurementisa/an__________transducer.
A.

passive

B.

active

C.

capacitive

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Astaticfluidcannothave
A.

zeroshearstress.

B.

positivenormalstress.

C.

nonzeroshearstress.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Inaforceddraftcoolingtower,wateriscooledfrom95to80Fbyexposuretoairwitha
wetbulbtemperatureof70F.Inthiscase,the
A.

rangeis15F.

B.

approachis10F.

C.

both(a)&(b).

D.

neither(a)nor(b).

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/26/2015

ChemicalEngineeringBasicsSection10ChemicalEngineeringQuestionsandAnswers

Temperaturerange(T1T2)=15F.
Temperatureapproach(T2tw)=10F.
Wetbulbtemperaturetw=70F.

ViewAnswer

Workspace

Report

DiscussinForum

4. Whichofthefollowingisthemostelasticmaterial?
A.

Plastic

B.

Glass

C.

Steel

D.

Rubber

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. The'laughinggas'is
A.

nitrousoxide

B.

nitricoxide

C.

nitrogentrioxide

D.

nitrogenpentoxide

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage2

6. Esterisformed,whenanalcoholreactswith
A.

carboxylicacid

B.

aldehyde

C.

ketone

D.

ether

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whichofthefollowingaccountsformaximumlossofenergyinacoalfiredboiler?
A.

Incompletecombustionoffuel.

B.

Outgoingfluegases.

C.

Radiationheatlosses.

D.

Unburntcarboninash.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Presenceofsulphurinthefuelfiredinafurnace
A.

contributestoitsheatingvalue.

B.

helpsinelectrostaticprecipitationofashfromfluegases.

C.

corrodesducts&airpreheater,ifthefluegastemperatureislow.

D.

all'a','b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Boilingtemperatureofcarbondioxideatatmosphericpressureis__________C.
A.

30.5

B.

78.5

C.

183.5

D.

10.5

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Eutectoidreactionforironcarbonsystemoccursatatemperatureof__________C.
A.

597

B.

959

C.

1147

D.

1493

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage3

11. Theabilityofasubstancetoassumetwoormorecrystallinestructureiscalled
A.

isomorphism

B.

polymorphism

C.

amorphism

D.

isomerism

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Themainfunctionofthedeaeratorusedinthethermalpowerplantisto
A.

throttledownthesteampressure.

B.

enhancefeedwatertemperature.

C.

removedissolvedgasesfromfeedwater.

D.

removenoncondensablegasesfromcondenser.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Lubricantscanbeusedto
A.

transmitpowerhydraulically.

B.

formasealincompressors.

C.

removecontaminantsbyflushingandtoinsulatetransformers,switchgearsetc.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage3

14. Whichofthefollowingistermedastheboilermounting?
A.

Feedwaterpump

B.

Steamsuperheater

C.

Blowoffcock

D.

Economiser

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Paintspraygunworksontheprincipleof
A.

Bernoulli'stheorem.

B.

Boyle'slaw.

C.

Newton'slawofviscosity.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage4

16. Gascarryingpipelinesarebestjoinedby
A.

nuts&bolts

B.

rivetting

C.

welding

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Scabisadefectdevelopedduring__________ofmetals.
A.

forging

B.

sandcasting

C.

machining

D.

welding

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Pickoutthewrongstatementaboutpowdermetallurgytechnique.
A.

Powdermetallurgytechniquesareappliedatroomtemperature.

B.

Finalproductinpowdermetallurgyisnotnecessarilymetallicpowder.

C.

Thefinalproductinpowdermetallurgyismadefrommetallicpowder.

D.

Silverandnickelwhenmeltedtogetherdonotmixtoformanalloyhowever
alloyoftheseconstituentscanbemadebypowdermetallurgytechnique.

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Afloatingbodyoscillatesaboutits__________whenitisdisplacedslightly.
A.

centreofgravity

B.

metacentre

C.

centreofbuoyancy

D.

centreofpressure

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Whichofthefollowingrelativelyemploysthehighestheattransfersurfaceareainahigh
pressureboiler?
A.

Airpreheater

B.

Economiser

C.

Steamsuperheater

D.

Furnacewaterwall

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage5

21. Theroutingfunctioninaproductionsystemdesignisconcernedwiththe
A.

materialflowoptimisationthroughtheplant.

B.

machineutilisation.

C.

qualitycontroloftheproduct.

D.

manpowerutilisation.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Fillermaterialusedinweldinghavingthelowestmeltingpointoutofthefollowingis
A.

aluminium

B.

softsolder

C.

silversolder

D.

brazingspelter

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Whichofthefollowinghasthehighestdensityandthelowestmeltingpoint?
A.

Stainlesssteel

B.

Titanium

C.

Lead

D.

Aluminium

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage5

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Electrolytesconductelectriccurrentby
A.

themovementofions.

B.

themovementofmolecules.

C.

allowingelectronstoflowthroughthemfromcathodetoanode.

D.

movementofelectricchargethroughthem.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Toimprovethemachinabilityofsteelbyitssoftening,itissubjectedto
A.

coldworking

B.

annealing

C.

shotblasting

D.

heating

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage6

26. Heattransferbyradiationfromahotbodywillbemostrapid,ifitssurfaceis__________
becauseofitshigheremissivity.
A.

white&rough

B.

black&rough

C.

white&polished

D.

black&polished

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Reductionreactioninvolvesthe
A.

lossofelectrons.

B.

increaseinoxidationnumber.

C.

gainofelectrons.

D.

additionofoxygen.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Specificheatofanidealgasdependsuponits
A.

molecularweight

B.

pressure

C.

temperature

D.

volume

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage6

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Incaseofcompressionofonekgofair,theworkdonewillbetheleast,whenthevalueof
polytropicindex'n'is
A.

B.

1.4

C.

1.5

D.

Y=Cp/Cv

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. A__________typepressuresensingelementiscommonlyusedinaneroidbarometer.
A.

capsule

B.

bellow

C.

spiraltube

D.

flatdiaphragm

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage7

31. Athermallythinbodyistheoneforwhich
A.

Biotnumberislessthan0.1.

B.

Gallileonumberislessthan0.1.

C.

Fouriernumberislessthan0.1.

D.

Fouriernumberisgreaterthan0.1.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Airrefrigerationcycleisusedintheaircrafts,becauseof
A.

lowtemperatureencounteredathighaltitude.

B.

itshighheattransferrate.

C.

itslowunitweightpertonofrefrigeration.

D.

itshighercoefficientofperformance(COP).

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Failureofamaterialisattributedto__________ifitfailsbelowitsyieldpoint.
A.

impactloading

B.

fatigue

C.

creep

D.

straining

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage7

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Protectionofshiphullsagainstseawatercorrosionisdonebycoatingwithzincbecauseof
thefactthatzinccomparedtoironis
A.

reducedpreferentially.

B.

cheaper.

C.

oxidisedpreferentially.

D.

lighter.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Whichofthefollowingpairsregardingtheeffectofalloyingelementsinsteelsarenot
matchedcorrectly?
A.

Cobalt:Itcontributestorerlhardnessbyhardeningferrite.

B.

Molybdenum:Itformsabrasionresistingparticles.

C.

Phosphorous:Itimprovesmachinabilityinfreecuttingsteels.

D.

Silicon:Itreducesoxidationresistance.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage8

36. Thephenomenonofstrainageingisgenerallyexperiencedwith
A.

castiron.

B.

lowcarbonsteel.

C.

highmanganesesteel.

D.

highcarbonsteel.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thecapacityofamaterialtoabsorbenergydependsuponbothitsstrength&stiffness.
Theterm'stiffness'ofamaterialistheoppositeofits
A.

flexibility

B.

plasticity

C.

hardness

D.

hardenability

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Fillermetalisnotusedinthe__________welding.
A.

seam

B.

electricspot

C.

projection

D.

alla,b&c

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Theheatreleasedbycoolingonemoleofcopperfrom400Ktoroomtemperature(300K)
is(assume:Cpofcopperis23JK1mole1)
A.

2300J

B.

4600J

C.

230J

D.

2.3x10 6J

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Suddenimmersion/dippingofredhotsteelbarinwatermakesit
A.

malleable&tough.

B.

ductile&soft.

C.

brittle&hard.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage9

41. Amaterialexpandingfreelyduetoheatingwilldevelop__________stress.
A.

no

B.

compressive

C.

tensile

D.

thermal

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Amachinehavingassumedlifeof20yearsispurchasedforRs32000/.Itsscrapvalueat
theendofitslifeisRs8000/.Ifthedepreciationiscalculatedbydiminishingbalance
method,thenpercentagereductioninitsvalueattheendoffirstyearis__________
percent.
A.

6.7

B.

7.6

C.

10.3

D.

15.2

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Morethan1000tonsrefrigerationcapacityplantsareusuallyof__________type.
A.

vapourcompression

B.

vapourabsorption

C.

airrefrigeration

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage9

44. Pickoutthewrongstatement.
A.

Inathinsphericalshellunderinternalpressure,hoopstressisequaltothehalfof
axialstress.

B.

ThermoplasticmaterialdoesnotfollowHooke'slawofelasticity.

C.

Componentsunderlongitudinalcompressioniscalled'struts'andtheloadunder
whichstrutfailsiscalledcripplingorbucklingload.

D.

Atlowtemperatures(subzero)inpressurevessels,theductilityofmetal
diminishesandbrittlefractureoccurswhileathightemperatureinpressure
vessels,embrittlementofmaterialmaytakeplace.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Theincreaseinhardnessofmetalduetoitscoldworkingistermedasthe__________
hardening.
A.

work

B.

age

C.

induction

D.

flame

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage10

46. Themaximumaxialcompressionstressduringcoldupsettingofacylindericalrodofradius
(r)occursat
A.

theouteredgeoftherod.

B.

r/3fromthecentre.

C.

r/2fromthecentre.

D.

thecentre.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Electrodepotentialisnotconcernedwiththemeasurmentof
A.

pHvalue

B.

temperature

C.

viscosity

D.

density

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. __________columnispreferredtobeused,whenahighliquidholdupisrequiredina
reactorforgasliquidreaction.
A.

Packed

B.

Bubble

C.

Spray

D.

Tray

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswersPage10

ViewAnswer

Workspace

Report

DiscussinForum

49. Tungsteninhighspeedsteelisresponsibleforits
A.

toughness&wearresistance

B.

coldhardness

C.

hothardness

D.

sharpcuttingedge

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswers

1. Outofthefollowingsubstances,onetonof__________willstorethemaximumheatfor
ariseof30Cintemperature.
A.

steel

B.

lignite

C.

water

D.

limestone

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Inwhichofthefollowingreactions,applicationofvacuumwillhelp?
A.

Numberofgasmoleculesintheproductsideismorethanthatonthereactant
side.

B.

Numberofgasmoleculesinthereactantsideismorethanthatontheproduct
side.

C.

Numberofgasmoleculesarethesameonboththereactant&theproductside.

D.

Noneoftheabove.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Inspectionofsurfaceandsubsurfacecracksinnonmagneticalloysisdoneby
__________testingmethod.
A.

Xray

B.

magneticparticle

C.

dyepenetrant

D.

ultrasonic

Answer&Explanation
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection11ChemicalEngineeringQuestionsandAnswers

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Pickoutthewrongstatement.
A.

B.

Theequivalentstiffnessoftwosprings(ofequalstiffness'S')inseriesisS/2while
inparallelis2S.
Forahelicalspring,deflectionisproportionaltoD3(D=meancoildiameter)or
d4(d=wirediameter)

C.

Crushingloadorcolumnsislessthanthebucklingload.

D.

Modulusofresilienceisproportionalto(stressatelasticlimit)2.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Whichofthefollowingexemplifiesresemblencewiththeextrusionprocess?
A.

Pneumaticejectionofabrasivesolidparticlesthroughanozzle.

B.

Toothpastepouringoutofthetube.

C.

Ejectionofabrasiveslurrythroughanopening.

D.

Viscouslubricantpouringoutthroughitscontainer'smouth.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage2

6. Fillermetalisusedin__________welding.
A.

braze

B.

electricspot

C.

projection

D.

seam

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Acetyleneshouldneverbeconveyedthrough__________pipe,asitformsanunstable
compoundthatdissociatesviolentlyattheslightestshock.
A.

stainlesssteel

B.

copper

C.

aluminium

D.

brass

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Whichofthefollowingcontainstheleastpercentageofcarbon?
A.

Pigiron

B.

Wroughtiron

C.

Castiron

D.

Malleableiron

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Electricarcfurnaceisemployedmainlyfortheproductionof__________steel.
A.

highcarbon

B.

alloy

C.

mild

D.

plaincarbon

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Heattreatmentofsteelisdonemainlytochangeits
A.

mechanicalproperties.

B.

physicalproperties,

C.

chemicalcomposition.

D.

all'a','b'&'c'.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage3

11. __________methodofdepreciationcalculationensuresthattheinterestischargedon
thecostofmachineasseteveryyearonthebookvalue,buttherateofdepreciation
remainsconstanteveryyear.
A.

Annuitycharging

B.

Atraightline

C.

Ainkingfund

D.

Noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. MainalloyingelementinElinvarusedinprecisioninstruments,hairspringsforwatches
etc.is
A.

chromium

B.

nickel

C.

zinc

D.

aluminium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Colorofbrasschangesfromyellowto__________afteritsdezincificationwhich
exemplifiesselectiveleaching.
A.

grey

B.

red

C.

orange

D.

violet

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage3

14. Heatdissipationincoolingtowersismainlyby
A.

conduction

B.

convection

C.

evaporation

D.

radiation

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. InBOF,desiliconisationisafirstorderreaction.Sothesiliconcontentofthemetal
decreases
A.

linearlywithtime.

B.

exponentiallywithtime.

C.

logarithmicallywithtime.

D.

inproportiontothesquarerootoftime.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage4

16. Hoope'scellispredominantlyusedfortheelectrolyticrefiningof
A.

zinc

B.

copper

C.

aluminium

D.

tin

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Leadpercentageinpuregalenaisabout
A.

8.6

B.

86.6

C.

35.8

D.

61.4

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Pickoutthewrongstatement.
A.

Erosioncorrosionwhichisidentifiedbysurfacegrooves,occursduetothe
combinedactionofcorrosiveenvironmentandmechanicalabrasion.

B.

Stresscorrosionoccursduetothecombinedactionofcorrosiveenvironmentand
thecompressivestress.

C.

Stainlesssteelispronetostresscorrosioninsolutioncontainingchlorideion.

D.

Incaseofstresscorrosion,thedirectionofcrackpropagationisperpendicularto
theappliedtensilestress.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage4

19. Thelifeofaballbearingisinverselyproportionalto
A.

(load)1

B.

(load)2

C.

(load)3

D.

(load)0.33

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Pickoutthewrongstatement.
A.

Partnershipissuitableformediumsizebusiness.

B.

Acertainminimumofsubscriptionofcapitalisrequiredforlegallystartinga
businessinaPublicLimitedJointStockCompany.

C.

PublicLimitedJointStockCompanyislegallyboundtoissueprospectusafter
registration.

D.

Asmallscaleindustryistheone,whichhasaminimumcapitalinvestmentofRs.
50lakhsandmaximum100lakhs.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage5

21. Stonewarepipesusedforsewersforcarryingsewagenormallyisjoinedby__________
joint.
A.

spigotandsocket

B.

flangediron

C.

collar

D.

expansion

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Whichofthefollowingparametersisactuallymeasuredduringtensiletestingofa
specimenusingUniversaltestingmachine?
A.

Load&elongation.

B.

Engineeringstress&strain.

C.

Truestress&strain.

D.

Poisson'sratio&Young'smodulus.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. 'Endcooler'or'aftercooler'isemployedinaircompressormainlyto
A.

removeoilvapourormoisturefromair.

B.

coolthedryairbeforeuse.

C.

reducethevolumetriccapacityofreceiver.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage5

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Streaklines,streamlines&pathlinesarealmostidenticalfor__________fluidflow.
A.

ideal

B.

uniform

C.

steady

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Thesuctionanddeliverypressureforatwostagecompressorare1and25atm
respectively.Theintermediatestagepressurewouldbearound__________atm.
A.

B.

10

C.

15

D.

20

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage6

26. Theterm'Value'invalueengineeringtechniquereferstothe__________costofthe
product.
A.

function(utility)

B.

selling

C.

production

D.

total

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Meltingpoint&boilingpointsofliquidoxygenarerespectively218.8C&183C,while
thesameforliquidnitrogenis210C&195.8Crespectively.Thedifferenceinmelting
pointsofliquidoxygen&liquidnitrogenisnotequalto8.8
A.

B.

C.

D.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Theentropychangeforaspontaneousprocessis
A.

>0forthesystem.

B.

<0forthesystem.

C.

>0forthesystem&thesurrounding.

D.

<0forthesystem&thesurrounding.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. MilligramofKOHrequiredtosaponify1gmofoiliscalledits__________number.
A.

saponification

B.

acid

C.

precipitation

D.

emulsion

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Pickoutthewrongstatementaboutafastbreederreactor.
A.

usesmoltensodiumasmoderator.

B.

convertsfertilefuelintofissilefuel.

C.

requireshighlyenrichedfuel.

D.

producesmorefuelthanitconsumes.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage7

31. Thespeedofsoundwillbemaximumin
A.

vacuum

B.

metal

C.

air

D.

water

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer
32.

Workspace

Report

DiscussinForum

Workdonebya/an__________processisdeterminedby
A.

adiabatic

B.

quasistatic

C.

isothermal

D.

isentropic

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Incaseofwater(Prandtlnumber6)flowingoveraflatplateheatedovertheentire
length,thethermalboundarylayerthicknessascomparedtohydrodynamicboundary
layerthicknessis
A.

less

B.

more

C.

equal

D.

unpredictable

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. __________numberissometimesusedinplaceofGrashoffnumberinfreeconvection
heattransfer.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage7

A.

Stanton

B.

Brinkman

C.

Rayleigh

D.

Nusselt

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Wroughtirondoesnothavethe
A.

uniformstrengthinalldirections.

B.

abilitytoholdprotectivecoating.

C.

highductility&corrosionresistance.

D.

easilyweldablecharacteristics.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage8

36. Nitridingofsteelisaprocessfor
A.

casehardening

B.

spheroidising

C.

normalising

D.

annealing

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Themaximumpercentageofchromiumthatcanbeaddedtosteelisabout
A.

12

B.

18

C.

24

D.

30

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Holesinaplateforrivettedjointsispreferablymadeby
A.

drilling

B.

tapping

C.

reaming

D.

punching

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Thetemperatureatwhichagas,whensubjectedtoJouleThomsonexpansion,neither
coolsorheatsup,istermedasthe__________temperature.Abovethistemperature
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage8

thegasheatsuponthrottlingandbelowthisthegascoolsdown.
A.

isotactic

B.

saturation

C.

inversion

D.

throttling

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Sourceofheatsupplyinacupolais
A.

coke

B.

charcoal

C.

lumpycoal

D.

pulverisedcoal

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage9

41. Machinetoolbodiesareusuallymadeof
A.

castiron

B.

mildsteel

C.

wroughtiron

D.

copperalloys

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Outofthefollowing,thebestmaterialcapableofwithstandingshock&vibrationwithout
thedangerofcrackingis
A.

malleableiron

B.

greycastiron

C.

chilledcastiron

D.

whitecastiron

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Onincreasingtheyieldstrengthofasteelfrom450to650MPa,its__________will
increase.
A.

ultimatetensilestrength(UTS)

B.

modulusoftoughness

C.

percentelongation

D.

modulusofresilience

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Therefractorybrickwhichhasgoodthermalshockresistanceathightemperaturebut
cracksoncoolingbelow400Cis
A.

magnesite

B.

chrome

C.

silica

D.

fireclay

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Thepathandmovementsfollowedbymen,materials&equipmentsinexecutingthe
activitiesisindicatedbythe
A.

travelcharts

B.

manmachinecharts

C.

stringdiagram

D.

flowdiagram

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage10

6. Nocuttingfluidisnormallyused,whilemachining
A.

castiron

B.

aluminium

C.

mildsteel

D.

stainlesssteel

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Anorthotropicmaterialisaspecialclassofanisotropicmaterial,whichisdescribedbytheir
propertiesinthreeperpendiculardirections.Anexampleoforthotropicmaterialis
A.

stainlesssteel

B.

castiron

C.

wood

D.

teflon

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. pHvalueofrainwaterinIndiarangesfrom
A.

5.5to7.5

B.

8to9.5

C.

3.5to5

D.

9.5to10.5

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Thecapital&runningcostsofsimilarmachineshavingunequalservicelifecanbe
comparedbythe__________method.
A.

equivalantannualcost

B.

rateofreturn

C.

presentnetworth

D.

capitalisedcost

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Picktheoddmanout.
A.

Austempering

B.

Martempering

C.

Cyniding

D.

Parkerizing

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswers

1. Withincreaseincarbonpercentageinsteel,its
A.

yieldstressdecreases.

B.

elongationpercentincreases.

C.

tensilestrengthincreases.

D.

impactstrengthincreases.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Percentageofgaungeismaximumintheoreof
A.

iron

B.

gold

C.

zinc

D.

copper

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Theformsinwhichvariousmetalsandnonmetalsoccurinnaturearecalledminerals.
Whichofthefollowingisnotametallicferrousmineral?
A.

Cassiterite

B.

Sphalerite

C.

Chalcopyrite

D.

Calcite

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Pickoutthewrongstatement.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection12ChemicalEngineeringQuestionsandAnswers

A.

Drybulbtemperature,wetbulbtemperature&dewpointarethesameincaseof
saturatedair.

B.

Dewpointisreachedbycoolingthehumidairatconstantmoisturecontent.

C.

Heatingofhumidairisdoneforitsdehumidification.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Themostcommonlyusedmaterialforsewersforcarryingsewageinthenormalsituation
is
A.

asbestoscement

B.

stainiesssteel

C.

stoneware

D.

castiron

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage2

6. Therefractoryliningofthebottominabasicelectricarcfurnaceismadeof
A.

silica

B.

alumina

C.

magnesia

D.

fireclay

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Alcoholsarenotsuitableasdieselenginefuelbecausethecetanenumberofalcoholsis
A.

verylowwhichpreventstheirignitionbycompression.

B.

veryhighwhichpreventstheirignitionbycompression

C.

zero.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Mattesmeltingisusedintheextractionof
A.

lead

B.

zinc

C.

aluminium

D.

copper

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Percentageofdifferentialpressurelostinaventurimeterwithataperingof15maybe
about
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage2

A.

B.

10

C.

25

D.

50

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Compresseddryairisusedasthecuttingfluid,whilemachining
A.

steel

B.

castiron

C.

aluminium

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage3

11. Oxidelayerformedonthenonferrousmetalsurfaceafteritsannealingis
A.

removedbyacidpickling.

B.

hammeredintothesurface.

C.

removedwithcoarseemerycloth.

D.

leftassuchtoprotectthesurface.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Siliconpercentageinsiliconsteelusedforelectricalequipmentsisabout
A.

B.

4.0

C.

D.

14

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Catalystusedinthe'catalyticconverter'employedinautomobileexhaustlinefor
completecombustion/oxidationofcarbonmonoxide,nitrogenoxidesandhydrocarbonsis
A.

alumina

B.

platinum

C.

vanadiumpentoxide

D.

ironoxide

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Liquidnitrogencontainerscanbemadefrom
A.

ferriticstainlesssteel

B.

HSLAsteel

C.

titanium

D.

austeniticstainlesssteel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Materialshaving__________latticestructureareusuallythemostductile.
A.

bodycentredcubic(bcc)

B.

hexagonalclosepacked(hcp)

C.

facecentredcubic(fcc)

D.

noneofthese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage4

16. Metalcuttingbyoxyacetyleneflameisaccomplishedbythe__________ofthemetal.
A.

burning

B.

intensiveoxidation

C.

evaporation

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Thematerialusedforcoatingtheweldingelectrodeistermedasthe
A.

flux

B.

slag

C.

protectivelayer

D.

binder

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Inanamorphousmaterial,atomsdefyanydefiniteatomicstructureandexistinrandom
patternjustlikeinliquid.Whichofthefollowingisanamorphousmaterial?
A.

Tin

B.

Lead

C.

Zinc

D.

Glass

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Eventhoughheattransfercoefficientsinboilingliquidsislarge,useoffinsis
advantageous,whentheentiresurfaceisexposedto__________boiling.
A.

film

B.

nucleate

C.

transition

D.

allmodesof

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. InNewton'slawofviscosity,whichstatesthattheshearstressisproportionaltothe
__________Coefficientofviscosityiscalleddynamicorabsoluteviscosity(where,V=
velocity,Vg=velocitygradient).
A.

V2

B.

1/V2

C.

1/Vg

D.

Vg

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage5

21. Whichofthefollowingmaterialshastheleastscrapvalue?
A.

Aluminium

B.

Stainlesssteel

C.

Brass

D.

Copper

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Forcebetweenthemoleculesofthesamesubstanceiscalled__________force.
A.

adhesive

B.

cohesive

C.

molecular

D.

VanderWalls

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Stressesencounteredinthemetalformingprocessesarelessthanthe__________of
thematerial.
A.

fracturestrength

B.

yieldstrength

C.

elasticlimit

D.

limitofproportionality

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage5

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Whichofthefollowingisnotaferromagneticmaterial?
A.

Nickel

B.

Cobalt

C.

Aluminium

D.

Iron

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Raindropsfallingthroughatmosphericairattainlimitedterminalvelocity,becauseof
A.

upwardthrustduetoair.

B.

viscousforceexertedbyair.

C.

surfacetensioneffectsofwater.

D.

forceofgravity.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage6

26. Additionofsilicontocastiron
A.

promotesgraphitemoduleformation.

B.

improvesitsductility.

C.

doesnotpromotegraphiteflakesformation.

D.

increasesthefluidityofmoltenmetal.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Leadispouredintothejointbetweentwo__________pipes.
A.

mildsteel

B.

concrete

C.

castiron

D.

asbestoscement

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. About__________tonofcokeisrequiredinacupolatoproduceonetonofcasting.
A.

0.03

B.

0.3

C.

0.8

D.

1.5

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage6

29. Thereareoneoctahedralvoidand__________tetrahedralvoidintheclosestpackingof
atoms.
A.

one

B.

two

C.

three

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Whichofthefollowingispronetocupandconefracture?
A.

Castiron

B.

Softbrass

C.

Roundspecimenofductilemetal.

D.

Flattensilespecimenofductilemetal.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage7

31. __________remainsconstantduringtheadiabaticcoolingofmoistair.
A.

Wetbulbtemperature

B.

Drybulbtemperature

C.

Relativehumidity

D.

Specifichumidity

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. __________jointisusuallyusedforjoiningcastironpipesmostlyusedfortemporary
pipelines,whereitmaybenecessarytodismantle&reassemblethepipelinevery
frequently.
A.

Collar

B.

Flanged

C.

BellandSpigot

D.

Expansion

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Outofthefollowing,thealloywhichhasequalpercentageofconstituents,is
A.

whitemetal

B.

gunmetal

C.

duralumin

D.

constanton

Answer&Explanation

Answer:OptionD
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage7

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Whichofthefollowingisthecorrectnatureofshearstressdistributionalongthecross
sectioninahorizontalcircularpipeundersteadystatefluidflowcondition?
A.

B.

C.

D.
Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Steelisweldedusingthe__________flame.
A.

carburising

B.

neutral

C.

oxidising

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage8

Pickoutthewrongstatement.
A.

Coldcrackingofaweldisduetothepresenceofhydrogengasintheweld.

B.

Truestressisgivenby,=E(1+E),whereEandEareengineeringstressand
engineeringstrainrespectively.

C.

Phosphorouscanbeeasilyrecoveredintheironblastfurnace.

D.

Highresidualstressatthesurfaceisbeneficialforfatiguepropertiesofamaterial.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Shampoosarecommerciallynotavailableintheformof
A.

powder

B.

gaseousmixture

C.

solution

D.

emulsion

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Agaswhichiscollectedoverwaterbecomesmoistenedduetowatervapor,exertsitsown
partialpressureatthegastemperature,whichistermedasits
A.

aqueoustension.

B.

saturatedhumidity.

C.

vaporpressure.

D.

absolutehumidity.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage8

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Carbonispresentintheformof__________ingreycastiron.
A.

spheroids

B.

nodularaggregatesofgraphite

C.

flakes

D.

cementite

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. In"ImperialSmeltingProcess"forextractionofzinc,zincvapourthusproducedis
quenchedintheexternalcondenserbytheuseofthefollowing:
A.

Jetofwaterathighpressure.

B.

Blastofair.

C.

Mixtureofwaterandair.

D.

Rainofmoltenlead.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage9

41. Thedewpointofmoistairbecomes__________withdecreaseinitsrelativehumidity.
A.

lessthanthewetbulbtemperature

B.

morethanthewetbulbtemperature

C.

morethanthedrybulbtemperature

D.

equaltowetbulbtemperature

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. HeatingofferromagneticmaterialstoatemperatureaboveCurietemperaturemakesit
A.

insulatorforheat&electricitytransmission.

B.

ferritic.

C.

behavelikeparamagneticmaterials.

D.

superconductor.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Lapjointsarepreferredoverbuttjointsinsoldering/brazing,becausethesejointsare
A.

weakerintensionbutstrongerinshear.

B.

weakerinshearbutstrongerintension.

C.

strongerinbothshearandtension.

D.

Thelapjointsareeasilymade.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Colourcomparatorisusedtomeasurethe
A.

pHvalue

B.

electrodepotential

C.

colourintensity

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Pickoutthewrongstatement.
A.

Forapressurevesseltobeclassifiedas'thinvessel',theratioofwallthicknessto
meanradiusislessthan0.1.

B.

Forcalculatingforcesandefficiencyofrivettedjoint,eitherrivetdiameterorrivet
holediameterisusedincaseofpressurevesselandinstructuralwork.

C.

Longitudinaljointisnormallymadebuttjointtomaintainthecircularityofthe
vessel.

D.

Maximumdiameteroftheopeningprovidedinapressurevessel,whichdoesnot
requireanycompensationis200mm.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage10

46. Anatombombworksontheprincipleof
A.

nuclearfission

B.

nuclearfusion

C.

boththenuclearfission&fusion

D.

ionisation

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Eutecticreactionforironcarbonsystemoccursatatemperatureof__________C.
A.

723

B.

959

C.

1147

D.

1493

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Whichofthefollowingisanexampleofstresscorrosion?
A.

Seasoncrackingofbrass.

B.

Causticembrittlementofsteel.

C.

Both(a)&(b).

D.

Neither(a)nor(b).

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswersPage10

49. FeO(s)+CO(g)=Fe(s)+CO2(g),k=0.435at1173EAtequilibrium,whatwillbe
thenumberofmolesofCOgasrequiredtoreduceonemoleofFeOat1173K?
A.

1.0

B.

1.3

C.

2.3

D.

3.3

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Fibrereinforcedplastic(FRP)are
A.

madeofglassfibreandthermoplasticresins.

B.

anisotropic.

C.

madeofthermosettingresinandglassfibre.

D.

both'b'&'c'

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswers

1. Maragingsteelsderivetheirstrengthfromthefollowingmechanism:
A.

Afine,highlydislocatedandstrongmartensite.

B.

FinedispersionsofintermetallicsofFe,Ni,Tietc.

C.

Finedispersionsofalloycarbidesinaferritematrix.

D.

FinedispersionsofFe3Cnucleatedondislocationsinaustenite.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Ceramiccompoundsascomparedtometalliccompounds
A.

crystallisefaster.

B.

resistgreatertensilestressatroomtemperature.

C.

havehighermeltingtemperature.

D.

arebetterconductorofelectricityathighertemperature.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Pressureexertedbyaliquiddependsuponits
A.

surfacetension

B.

density

C.

viscosity

D.

buoyancy

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection13ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Themostdetrimentalimpurityinhighpressureboilerfeedwateris
A.

suspendedsalt

B.

dissolvedsalt

C.

silica

D.

turbidity

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Pickoutthewrongstatement.
A.

Asoftmagneticmaterialshouldhavehighpermeabilityandsmallareaof
hysterisisloop.

B.

Poisson'sratioofhighmeltingpointmetalsismorethanunity.

C.

Soldersgenerallymeltatlessthan185C.

D.

SteelproducedbyB.O.Fprocessisideallysuitedformanufacturingflatproduct.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage2

6. Semiconductorsnormallyemploy__________bonding.
A.

coordinate

B.

ionic

C.

covalant

D.

metallic

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Highendurancelimitofcarburisedmachinepartsisbecauseofthefactthatcarburisation
A.

suppressesanystressconcentrationproducedintheparts.

B.

enhancestheyieldpointofthematerial.

C.

introducesacompressivelayeronthesurface.

D.

producesabettersurfacefinish.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. In__________process,thereisanincreaseinentropywithnodegradationofenergy.
A.

isothermalexpansion

B.

isochoricheataddition

C.

polytropicexpansion

D.

isobaricheataddition

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage2

9. Whichofthefollowingiscategorisedastheplasticwelding?
A.

Gaswelding

B.

Electricarcwelding

C.

Forgewelding

D.

Noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Inspiteoflargeheattransfercoefficientsinboilingliquids,finsareusedadvantageously,
wheretheentiresurfaceisexposedto__________boiling.
A.

film

B.

nucleate

C.

transition

D.

allmodesof

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage3

11. Whenwaterissprayedonair,passingthroughaninsulatedchambermaintainedata
temperaturehigherthanthedewpointofenteringairbutlowerthanitsdrybulb
temperature,thentheairis
A.

cooledanddehumified.

B.

heatedandhumidified.

C.

cooledandhumidified.

D.

heatedanddehumidified.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Thehardnessofthelathebedmaterialismeasuredbythe
A.

shoresceleroscope.

B.

Brinnelhardnesstester.

C.

Vicker'shardnesstester.

D.

Rockwellhardnesstester.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. RADARis
A.

acronymforRadioDetectionandRanging.

B.

nameoftechniqueforlocatingdistantobjects.

C.

nameofinstrumentforlocatingdistantobjects.

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionD
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage3

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Inthefloatationprocess,pineoilisusedasthe
A.

collector

B.

activator

C.

frother

D.

depressant

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Withincreasingcarbonpercentinsteelbeyond0.8%,itsultimatetensilestrength(UTS)
and__________isnotaffected.
A.

impactstrength

B.

percentelongation

C.

hardness

D.

both'b'&'c'

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage4

16. Pickoutthecorrectstatement.
A.

Abaseisalwayssolubleinwater.

B.

Hydrogenisreleasedwheneverametalreactswithanacid.

C.

Sodiumhydroxideisbothabaseandanalkali.

D.

Allindicatorsgiveredsolutionwithanacid.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Ageingofsteelreferstothe
A.

degradationofsteelbycorrosion.

B.

failureofsteelstructurebyoverstressing.

C.

returnofsharpyieldpointintemperrolledlowcarbonsheetafteraperiodoftime.

D.

decarburisationofsteelbyoverheating.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Whendrybulbtemperature&wetbulbtemperatureofmoistairisthesame,itmeans
thatthe
A.

partialpressureofwatervapourislessthanthetotalpressure.

B.

humidityis<100%&dewpointtemperatureofairhasnotreached.

C.

dewpointtemperatureofairhasnotreached&airisnotsaturatedfully.

D.

airisfullysaturated.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Whenmetalsareheatedtohightemperature,their__________increasesingeneral.
A.

atomicvibration

B.

creepstrength

C.

yieldstress&ultimatetensilestrength

D.

toughness&stiffness

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Africtionlighterisnormallyusedforlightinggasweldingtorch,becauseofthereason
that
A.

itsinitialcostisverylow.

B.

durationofsparkcreatedisverysmall.

C.

safetyofwelderisensured.

D.

itiseasiertooperate&maintain.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage5

21. __________isnotusedasamaterialofconstructioninthermocouples.
A.

Alumel

B.

Rhodium

C.

Constantan

D.

Duralumin

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Coarsegrainedsteelshave
A.

lowtoughness

B.

notendencytodistort

C.

highdensity

D.

veryhightoughness

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Steelballsaremanufacturedbycoldheading.Aftercoldforming,theyaresubjectedto
A.

tempering

B.

normalising

C.

stressrelieving

D.

artificialageing

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage5

24. Freeoxygenisremovedfromboilerfeedwater,becauseit
A.

reducesheattransfercoefficient.

B.

iscorrosive.

C.

causesexplosion.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Outofthefollowing,thematerialshavingmaximummagneticpermeabilityis
A.

siliconsteel(Si=4%)

B.

castiron

C.

wroughtiron

D.

mildsteel

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage6

26. Amaterialbeingtestedforendurancestrengthissubjectedtothe__________load.
A.

impact

B.

completelyreversed

C.

dynamic

D.

static&dynamic

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Pickoutthewrongstatement.
A.

Moleculeswithsymmetricalarrangements(.e.g.CH4orCCl4)arenonpolar.

B.

Generally,nonpolarcompoundsarechemicallyinactive,conductelectricitypoorly
anddonotionise.

C.

Mostofthehydrocarbonsarenonpolar.

D.

noneofthese.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Oldcyclehandlesarecoatedwithnickelusing
A.

cementation.

B.

spraycoating.

C.

galvanisingprocess.

D.

tinningprocess.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage6

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. CANDUtypenuclearreactorusingnaturaluraniumasfuelistheextensivelyusednuclear
reactorbecauseofthefactthatthe
A.

specificfuelconsumptionisverylowduetotheuseofheavywater.

B.

fuelcostismuchlowerthanthatusedinpressurisedwaterorboilingwater
reactor.

C.

heavywaterisusedbothascoolantaswellasmoderator.

D.

both'b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Pickoutthewrongconversionofabsolute&kinematicviscosities.
A.

1stoke=1cm2/sec.

B.

1N.sec/m2=10paise.

C.

1stoke=1m2/sec.

D.

1m2/sec=10 4stokes.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage7

31. Unitmolarsolutionof__________isthebestconductorofelectricity.
A.

sodiumchloride

B.

aceticacid

C.

sulphuricacid

D.

sucrose

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Acoalwithhigh__________contentwillignitemosteasily.
A.

hydrogen

B.

oxygen

C.

volatilematter

D.

fixedcarbon

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Theweightofabodyatthecentreoftheearthis
A.

infinite.

B.

zero.

C.

sameasonthesurfaceoftheearth.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage7

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Forthesameheatinput&compressionratio,efficiencyofOttocycleishigherthanthatof
dieselcycle,becauseinOttocycle.
A.

heatrejectionislower.

B.

expansion&compressionareisentropic.

C.

maximumtemperatureishigher.

D.

combustionisatconstantvolume.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Thesinglemostimortantrequirementforaturbinebladematerialis
A.

damping

B.

resilience

C.

creepresistaned

D.

DBTT

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage8

36. Incoldworkingofmetalascomparedtoitshotworking
A.

cracksandblowholesareeliminated.

B.

ductilityandimpactstrengthimproves.

C.

appreciablestrainhardeningisproduced.

D.

yieldstress,hardnessandfatiguestrengthisnotatallaffected.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. __________istheprocessusedforsettingupcompressivestressesinthesurfaceofa
metaltoimproveitsfatiguestrength.
A.

Lancing

B.

Shotpeening

C.

Slugging

D.

Spinning

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Mho'sscaleofhardness,whichconsistsof10standardmineralsisusedforthe
measurementof__________hardness.
A.

scratch

B.

indentation

C.

dynamic

D.

rebound

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Whichofthefollowingisaweakacid?
A.

HF

B.

HCl

C.

HI

D.

HBr

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Pigironisaproductof
A.

electricarcfurnace

B.

cupola

C.

blastfurnace

D.

openhearthfurnace

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage9

41. Flywheelisprovidedinamachineto
A.

providestructuralstrengthtotheshaft.

B.

smoothenthepowerimpluses.

C.

helpinquickstartingofthemachine.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Nickelisa__________material.
A.

ferromagnetic

B.

semiconductor

C.

paramagnetic

D.

ferroelectric

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Greycastiron(usedformakingundergroundwaterpipesandmanholecovers)as
comparedtosteelhashigher
A.

ductility

B.

impactstrength

C.

machinability

D.

meltingpoint

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. L.D.convertersaregenerallylinedwith
A.

magnesite

B.

fireclay

C.

chromemagnesite

D.

silica

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Whentheweightofaballinsidetheballmillisjustbalancedbythecentrifugalforce,
A.

theballabandonsitscircularpathforaparabolicpath.

B.

theballabandansitsparabolicpathforacircularpath.

C.

theballcontinuestomoveonacircularpath.

D.

theballcontinuestomoveonaparabolicpath.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage10

46. __________isnotaheattreatmentprocess.
A.

Cyaniding

B.

Pakerising

C.

Austempering

D.

Martempering

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Aningotishotforgedtoa60%reductionincrosssectionarea.Thepercentagereduction
inthevolumefortheaboveprocessis
A.

B.

60

C.

30

D.

20

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Volutecasingofacentrifugalpumpdoesnotfacilitate
A.

uniformflowoffluidcomingoutoftheimpeller.

B.

increaseinthepumpefficiency.

C.

conversionofthepartofthevelocityheadtothepressurehead.

D.

conversionofthepartofthepressureheadtovelocityhead.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Desertaircoolersbeingrenderedineffectiveinrainyseasonisdueto
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswersPage10

A.

lowhumidity

B.

lowtemperature

C.

highhumidity

D.

sunnyweather

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Thehydraulicradiusofacircularpipeofdiameter'd'flowingfullis
A.

d/4

B.

d/2

C.

2d/3

D.

d/3

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswers

1. Safetymatchesisproducedusing
A.

redphosphorus

B.

yellowphosphorus

C.

blackphosphorus

D.

elementalsulphur

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Calorificvalueof__________arealmostsame.
A.

lignite&anthracitecoal

B.

lignite&coalgas

C.

petrol&diesel

D.

coalgas&naturalgas

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Whichofthefollowingpairsisnotcorrectlymatched?
A.

Uranium233:Fertilematerial.

B.

Bindingenergy:Massdefect.

C.

Scattering:Absorptioncrosssection.

D.

Numberofnucleons:Massnumber.

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/27/2015

ChemicalEngineeringBasicsSection14ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Commonlyusedfluxforbrazingis
A.

zincchloride

B.

borax

C.

ammoniumchloride

D.

rosin

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Ironhasgot__________isotopes.
A.

no

B.

four

C.

three

D.

two

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage2

6. Aboyweighing110lbclimbsupa50fthighverticaldestinationin100seconds.Horse
poweroftheboyis__________hp.
A.

0.1

B.

0.5

C.

0.8

D.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Enduranceisameasureoffatiguelimitofametal.Fatiguecrackinnitridedmachineparts
originates
A.

atthesurface.

B.

withinthecore.

C.

justbelowthesurface.

D.

anywhereonthesurface.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Carbonpercentageinhighspeedsteeltoolmaterialis0.6to1.0.Thehardnessofcarbon
toolsteelsisincreased,whenitisalloyedwith
A.

vanadium&chromium

B.

silicon

C.

tungsten

D.

manganese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Draftallowancegiventopatternsisfor
A.

compensatingtheliquidstateshrinkage.

B.

easyremovalofpatternfromthemoldcavity.

C.

providingsupportforthecoreplacement.

D.

compensatingthesolidificationshrinkage.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Whichofthefollowingweldingprocessesemploysthehighestweldingtemperature?
A.

Arcwelding

B.

Gaswelding

C.

Thermitwelding

D.

Resistancewelding

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage3

11. Thebestcriterionforanalysinganeconomicinvestmentisthe
A.

rateofreturncriterion.

B.

presentvaluemethod.

C.

salvagevalue.

D.

futurevaluemethod.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Deformationbandisabsentinmaterialshaving__________latticecrystalstructure.
A.

fcc

B.

bcc

C.

hcp

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Outofthefollowing,therayshavingthelowestwavelengthisthe
A.

radiowaves

B.

ultrasonicwaves

C.

infraredrays

D.

Xrays

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage3

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Afinegrainedgrindingwheelshouldnotbeusedforgrinding__________materials.
A.

hard

B.

brittle

C.

soft&ductile

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Whatistheeffectontheperformanceoftheeconomiserinthethermalpowerplant
boiler,ifthefeedwatertemperatureisverylowduetopreheatersbeingoutforrepairsor
starvingofsteamsupply?
A.

Itresultsincorrosionduetothecondensationonthefluegassideofthe
economisertubesduetohandlingoflowtemperaturewater.

B.

Economisertubelifeincreasesduetohandlingoflowtemperaturewater.

C.

Heattransferefficiencyofeconomiserincreasesduetopickinguphighheatfrom
thefluegases.

D.

Scaleformationrateoneconomisertubesincreases.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage4

16. ThebulkmodulusofamaterialwithPoisson'sratioof0.5isequalto
A.

3xYoung'smodulus

B.

Young'smodulus

C.

infinity

D.

zero

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. CompressionratioofanI.C.engineistheratioofthe
A.

clearancevolumetothevolumesweptbypistonperstroke.

B.

volumeofairincylinderbeforecompressiontothataftercompression.

C.

pressureaftercompressiontothatbeforecompression.

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Twostrokeenginecomparedtoafourstrokeenginehas
A.

higherefficiency.

B.

lessfuelconsumption.

C.

higherpowertoweightratio.

D.

lowerinitialcost.

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Ferritesare__________magnetic.
A.

anti

B.

para

C.

ferri

D.

ferro

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. ThepHvalueisthemeasureofhydrogenionconcentrationinasolution.ThetermpH
standsforthe__________inthesolution.
A.

powerofhydrogenionconcentration

B.

percentageofhydrogenions

C.

presenceofhydrogenions

D.

noneofthese

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage5

21. TheAl2O3contentofcryoliteinHallHeroult'scellismaintainedbetween__________
percent.
A.

25

B.

1820

C.

1215

D.

612

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Numberofelectronsintheoutermostshellofasemiconductormaterialis
A.

B.

C.

D.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Thevelocityatwhichindividualparticlesfromafluidisedbedarecarriedawaybythefluid
passingthroughit,isdefinedasthe
A.

minimumfluidisationvelocity.

B.

terminalvelocity.

C.

elutriationvelocity.

D.

superficialvelocity.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage5

24. Tipofthematchstickcontainsamixtureof
A.

K+S

B.

K+S+K2Cr2O7

C.

S+K2Cr2O7+WhiteP

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Whichofthefollowingisnotanoreofaluminium?
A.

Troosite

B.

Kaolin

C.

Alunite

D.

Cryolite

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage6

26. Mechanism/phenomenoninvolvedintheimprovementoffatiguestrengthofamaterialby
shotpeeningisthe
A.

inductionofresidualcompressivestressonthesurface.

B.

removalofstressconcentrationfromthesurface.

C.

grainrefinement.

D.

surfacepolishing.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Springsarenotmadeof
A.

phospherbronze.

B.

nickelsteel.

C.

monel.

D.

carbonsteel(c0.5%).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Pickoutthewrongstatement.
A.

InParke'sprocess,zincisaddedtoremovesilverfromlead.

B.

InthePidgeonprocessofproducingmagnesium,powderedferrosilconisusedas
thereducingagent.

C.

Moltenleadisusedforshockcoolingofthezincvapoursinthezincblastfurnace.

D.

Purecopperelectrodesareusedasanodeforelectrorefinningofcopper.

Answer&Explanation

Answer:OptionD
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Monazitedepositsconstituteanimportantsourceforthefollowingmetal.
A.

Thorium

B.

Titanium

C.

Molybdenum

D.

Noneoftheabove

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. raysare
A.

negativelycharged.

B.

positivelycharged.

C.

neutral.

D.

sameasXrays.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage7

31. Heattreatmentofsteelisdonetomainlychangeits__________properties.
A.

physical

B.

chemical

C.

mechanical

D.

surface

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Normaldosageofchlorineinpublicwatersupplyschemerangesfrom__________ppm.
A.

0.5to1

B.

10to15

C.

300to500

D.

1000to1500

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Castironhastheuniquepropertyofhigh
A.

ductility

B.

dampingcharacteristics

C.

hardness

D.

malleability

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage7

34. Thermalshockproducedbycoolingismoredengerous/deleteriousthanthatproducedby
heatingasurface,becauseofthereasonthat
A.

coolingproducestensiononthesurface.

B.

coolingproducescompressiononthesurface.

C.

heatingdoesnotproducesanythermalstress.

D.

heatingproducescompressiononthesurface.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Thehardnessofagrindingwheelisspecifiedbythe
A.

alphabeticalletter.

B.

Rockwellhardnessnumber.

C.

Brinellhardnessnumber.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage8

36. Scalingoccursinboilertubesduetothefactthat,thesolubilityofCa(OH)2__________
withincreasingtemperature.
A.

increases

B.

decreases

C.

showsinversionofsolubility

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Whiletherecrystallisationtemperatureforpuremetalsis0.3Tm,thesameforalloysis
equalto__________xTm(where,TmMeltingtemperature).
A.

0.25

B.

0.45

C.

0.70

D.

0.95

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Thefactorofsafetyforbrittlematerials(havingelongation<5%)isbasedonthe
__________stress.
A.

yield

B.

proof

C.

ultimate

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Carburettorinasparkignitionengineisusedto
A.

mixairfuelinthedesiredratio.

B.

maintainaconstantspeedatvaryingloads.

C.

adjustthestrokelength.

D.

increasethecompressionratio.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. __________arenotemittedbyradioactivesubstances.
A.

rays

B.

rays

C.

protons

D.

positrons

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage9

41. Agoodabrasive
A.

shouldbefriable.

B.

shouldhavelowrefractoriness.

C.

ismadeupoflargesizeofcrystals.

D.

shouldbesoft.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Outofthefollowing,__________pipeistheleastcorrosionresistant.
A.

mildsteel

B.

copper

C.

wroughtiron

D.

stainlesssteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Inordertoprotecttheaquaticcreatures,thedissolvedoxygencontentinfreshwater
streamshouldneverbelessthan__________PPm.
A.

0.5

B.

C.

D.

20

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. Forwhichpairofthefuelgases,calorificvalue(C.V.)ofonefuelisalmostdoublethatof
theotheronvolumebasis(i.e.,kcal/Nm3)whiletheC.V.issameonweightbasis(i.e.,
kcal/kg)?
A.

Propaneandacetylene

B.

PropaneandLPG

C.

Sewagegasandgobargas

D.

B.Fgasandcokeovengas

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Sheardisingprocessisusedfor
A.

surfacecoating.

B.

heattreatmentofhighspeedsteel.

C.

coldworkingonmetals.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage10

46. Thepredominantmodeofheattransferwhichtakesplacefromboilerfurnacetowater
wallsofaboileris
A.

conduction

B.

convection

C.

both'a'&'b'

D.

radiation

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Whichofthefollowingisaninedibleoil?
A.

Cornoil

B.

Tallowoil

C.

Oliveoil

D.

Cottonseedoil

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Lightyearistheunitof
A.

distance

B.

time

C.

intensityoflight

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Ingrannularcorrosionoccurs__________stainlesssteel.
A.

inalltypesofsteelsexcept

B.

atthesurfaceof

C.

alonggrainboundariesof

D.

inthecoreof

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Incaseoffluidmovingmachineries,therelationshipbetweensaturationtemperatureand
pressuredecidestheprocessof
A.

waterhammer

B.

cavitation

C.

flowseparation

D.

turbulentmixing

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswers

1. Additionofberylliumtocopperisdonemainlytoproducea/an__________alloy.
A.

nonsparking&nonmagnetic

B.

highstrength

C.

precipitationhardenable

D.

corrosionresistant

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Theproductoutfromacupolaiscalled
A.

wroughtiron

B.

pigiron

C.

castiron

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Resilienceofamaterialisimportant,whenitissubjectedto
A.

creep

B.

fatigue

C.

shockloading

D.

galvanising

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

27/04/2015

ChemicalEngineeringBasicsSection16ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Existenceofvelocitypotentialimpliesthatthefluidis
A.

irrotational

B.

ideal

C.

compressible

D.

incontinuum

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Thevelocityofsoundinairisindependentofchangesinits
A.

humidity

B.

pressure

C.

temperature

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage2

6. AdummyactivityisusedinPERTnetworktodescribethe
A.

precedencerelationship.

B.

resourceidleness.

C.

resourcerestriction.

D.

necessarytimedelay.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whichofthefollowingisnotacharacteristicobservedinmaterialfailurebyfatigue
fracture?
A.

Plasticdeformationofmaterialdoesnotoccur.

B.

Initiationofcrackfrombelowthesurfacedoesnotoccur.

C.

Initationofcrackoccursonthesurfaceofthemachinepart.

D.

Presenceofbothrough&smoothzonewithconchoidalmarkingsinsmoothzone
ofthesurface.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Apolymeristermedasan'elastomer',ifitspercentageelongationismorethan100%.An
elastomeristermedas'rubber'ifitspercentageelongationismorethan__________
percent.
A.

150

B.

200

C.

300

D.

400

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Currentemployedinresistanceweldingrangesfrom__________kVA/cm2.
A.

1.2to2.5

B.

4.5to6.2

C.

7.5to8.5

D.

10.5to15.5

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Brittlenessinducedduetothepresenceofsulphurinsteelcanbereducedbyadding
A.

manganese

B.

magnesium

C.

vanadium

D.

copper

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage3

11. Fibrousfractureisnormallyencounteredinthe__________materials.
A.

hard

B.

elastic

C.

ductile

D.

brittle

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Badodourinsanitarylatrinesisreducedbyperiodicallysprinkling
A.

bleachingpowder.

B.

limepowder.

C.

aluminiumsulphate.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. __________hasthehighestmeltingpointoutofthefollowing.
A.

Tungsten

B.

Zirconium

C.

Molybdenum

D.

Tantalum

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Theonlysuitablemethodforhardeningthelowcarbonsteeliscasehardening.Whichof
thefollowingisacasehardeningprocess?
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage3

A.

Cyaniding

B.

Sheardising

C.

Spherodising

D.

Noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Annealingofcastiron
A.

softensittofacilitatemachining.

B.

decreasesthefreecarbon.

C.

increasesthestrength.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage4

16. Coatingthicknessincaseofgalvanisingofsteelsheetgenerallycorrespondstothe
depositionof__________gmsofzincperm2ofsteelstrip.
A.

510

B.

10001500

C.

120500

D.

15003000

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Chlorineactsasableachingagentonlyinthepresenceof
A.

dryair

B.

pureoxygen

C.

moisture

D.

sunlight

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Coronadischargeisrelatedtotheoperationofa/an
A.

inductionmotor.

B.

electrostaticprecipitator.

C.

fastbreederreactor.

D.

magnetohydrodynamicgenerator(MHD).

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Plasticsasamaterialofconstructionsufferfromthedrawbackoflow
A.

machinability

B.

density

C.

strength

D.

plasticdeformation

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Outofthefollowing,thebestmaterialcapableofwithstandingshock&vibrationwithout
thedangerofcrackingis
A.

malleableiron

B.

greycastiron

C.

chilledcastiron

D.

whitecastiron

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage5

1. Factorofsafetyistheratioofthe__________stresstotheworkingstress.
A.

tensile

B.

compressive

C.

yield

D.

bearing

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Themajoritychargecarriersinptypesiliconare
A.

freeelectrons

B.

ions

C.

conductionelectrons

D.

holes

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Referringtotheperiodictableofelements,itisfoundthatwithincreasingatomicnumber.
Theatomicsizeinthesame
A.

periodincreases.

B.

perioddecreases.

C.

groupincreases.

D.

both'b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage5

ViewAnswer

Workspace

Report

DiscussinForum

24. Withincreasein__________Knockingtendencyinasparkignitionpetrolengine
decreases.
A.

supercharging

B.

walltemperature

C.

compressionratio

D.

enginespeed

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Between230and370C,bluebrittlenessiscausedinmildsteelbecauseofthe
A.

immobilityofdislocation.

B.

strainageing.

C.

increaseinYoung'smodulus.

D.

strainhardening.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage6

26. Siliconpercentageinthesiliconsteelusedforelectricalappliances/equipmentsis
A.

0.30.4

B.

1214

C.

34

D.

2025

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Whichofthefollowingisnotadielectricmaterial?
A.

Cotton,silkandpaper.

B.

Asbestos,glass,porcelainandmica.

C.

Rubberandpolymericresins.

D.

Allrefractorymaterials.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Magneticpermeabilityofironisincreasedbyits
A.

decarburising.

B.

alloyingwithcobalt.

C.

purification.

D.

alternateheating&cooling.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage6

29. Thematerialswhichfractureevenatsmallstrainsaretermedasbrittle,whilethose
materialswhichexhibitanappreciabledeformationbeforefailurearetermedas
A.

rigid

B.

tough

C.

ductile

D.

plastic

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Materialofconstructionoffoundarycrucibleis
A.

lead

B.

stainlesssteel

C.

graphite

D.

castiron

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage7

31. Boilingpointofwatergetsloweredathighaltitudes(e.g.,hills),because
A.

temperatureislow.

B.

atmosphericpressureislow.

C.

atmosphericpressureishigh.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Withincreaseintemperature,theelectricalconductivityofsemiconductors
A.

increases.

B.

decreases.

C.

remainconstant.

D.

either(a)or(b),dependsonthetypeofsemiconductor.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Whichofthe,followingisnotassociatedwiththefunctioningofapetrolengine?
A.

Compressionignitionsystem

B.

Sparkplug

C.

Carburettor

D.

Ottocycle

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage7

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. MinimumnumberofmembersrequiredtoformaPublicLimitedJointStockCompanyis
A.

B.

10

C.

12

D.

17

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Inaneutecticsystem,twoelementsarecompletely
A.

solubleinsolidstate.

B.

insolubleinliquidstate.

C.

insolubleinbothsolid&liquidstate.

D.

solubleinliquidstate.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage8

36. 'Cryogenics'isconcernedwiththegeneration&useoflowtemperatureintherangeof
A.

0Kto123K

B.

0Cto123C

C.

0Cto273C

D.

0Kto273K

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Thecapacityofaspringtostoreenergyiscalledthespringformcoefficient.Stiffnessofa
springismeasuredbythe
A.

abilitytoabsorbshock.

B.

capacitytostoreenergy.

C.

ratioofthewire&coildiameters.

D.

loadtoproduceunitdeflection.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Whichofthefollowingmaterialshasthemaximumshrinkageallowance?
A.

Brass

B.

Castiron

C.

Lead

D.

Aluminiumalloy

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Vibrationupto100kilohertzcanbemostaccuratelymeasuredbya__________type
accelerometer.
A.

preloadedspring

B.

piezoelectric

C.

bondedstraingauge

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Normalisingdoesnot__________ofametal.
A.

improvemachinability&tensilestrength

B.

removeinternalstresses

C.

refinethestructure

D.

removestrainscausedbycoldworking

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage9

41. Boilertubesizeisspecifiedbyitsthicknessand__________diameter.
A.

outside

B.

inside

C.

mean

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Breakevenpointrepresentsthecondition,whenthecompanyrunsundernoprofitno
losscondition.Inbreakevenanalysis,totalcostcomprisesoffixedcost
A.

only.

B.

plusvariablecost.

C.

plusoverheadcost.

D.

plussellingexpenses.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. UnitofsurfacetensioninS.I.unitis
A.

Watt/m

B.

Joule/m2

C.

Newton/m2

D.

Joule/m

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. Thejointforsolderingissupportedbybindingwiremadeof
A.

mildsteel

B.

copper

C.

softiron

D.

stainlesssteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Themainreducingagentinironblastfurnaceis
A.

carbondioxide

B.

carbonmonoxide

C.

oxygen

D.

air

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage10

46. Young'smodulusofamaterialisthemeasureofits
A.

stiffness

B.

malleability

C.

creepresistance

D.

tensilestrength

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Whichofthefollowingisnotusedasabearingmaterial?
A.

Copperleadalloys

B.

Babbits

C.

Bronzes

D.

Cermets

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Brasspartswithhighresidualtensilestressatthesurfacearesusceptibletoseason
cracking(i.e.spontaneouscrackingoccuringonexposuretoatmosphericcorrosion),ifits
zincpercentageismorethan
A.

B.

10

C.

20

D.

35

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswersPage10

ViewAnswer

Workspace

Report

DiscussinForum

49. Waterflowintheriverduringfloodcanbecategorisedasthe__________flow.
A.

unsteadyuniform

B.

unsteadynonuniform

C.

steadyuniform

D.

steadynonuniform

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Basicity[%Cao+%MgO/%SiO2)oftheslaginIndianblastfurnaceisintherangeof
A.

0.71.0

B.

1.11.4

C.

1.51.8

D.

2.02.5

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswers

1. Yieldstrengthofamaterialisdeterminedbythe__________test.
A.

creep

B.

tension

C.

compression

D.

endurance

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Influidflow,andheatandmasstransfer,oneencounters(i)kinematicvelocity(),(ii)
moleculardiffusivity()andthermaldiffusivity().Theunitsofthesequantitiesare.
A.

,andallhaveunitsofm/s.

B.

,andallhaveunitsofm2/s.

C.

andhaveunitsofm2/s,whilehasunitofm/s.

D.

andhaveunitsofm/s,whilehasunitofm2/s.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Windowpanesofaeroplanesarenormallymadeof
A.

perspex(PMMA)

B.

teflon(PTFE)

C.

bakelite(phenolformaldehyde)

D.

polystyrene

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection17ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4. __________fluxisusedfortheextractionofmetalfromitsselffluxingores.
A.

No

B.

Acid

C.

Basic

D.

Neutral

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Gooddesignofthecasingofacentrifugalpumpaimsatminimisingthe
A.

cavitation

B.

frictionallosses

C.

kineticenergyloss

D.

statichead

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage2

6. Leadismostreadilydissolvedin
A.

aceticacid

B.

hydrochloricacid

C.

nitricacid

D.

sulphuricacid

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whichofthefollowingisasyntheticabrasive?
A.

Corundum

B.

Emery

C.

Pumice

D.

Siliconcarbide

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Dezincificationisaformofcorrosion,whichspecificallyappliesto
A.

steel

B.

brass

C.

stainlesssteel

D.

babbitmetal

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Waterhammerinpipelinesresults,whentheflowingfluid
A.

hasveryhighvelocity.

B.

hasveryhighpressure.

C.

isbroughttorestbygraduallyclosingavalve.

D.

issuddenlybroughttorestbyclosingavalve.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Thepreferredalloyingelementforlowtemperatureapplicationsofsteelis
A.

Cr

B.

C.

Mo

D.

Ni

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage3

11. Outofthefollowing,thedimensionlessquantityis
A.

specificweight

B.

viscosity

C.

Machnumber

D.

density

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Whenacopperballisheated,thelargestpercentageincreasewillbeinits
A.

radius

B.

area

C.

mass

D.

volume

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Whichofthefollowinghardnesstestsusesthedepthofpenetrationcausedbythe
indentorastheparameterforarrivingatthehardnessvalueofamaterial?
A.

Shoresceleroscopetest.

B.

Vicker'shardnesstest.

C.

Brinellhardnesstest.

D.

Rockwellhardnesstest.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Themostcommonlyusedmoderatorinnuclearpowerplantis
A.

graphite

B.

lightwater

C.

heavywater

D.

berellium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Inanisochoricprocess,
A.

thereisnotransferofmassandenergy.

B.

freeexpansionofanidealgasoccurs.

C.

nomechanicalworkisdonebythesystem.

D.

all'a','b'&'c'.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage4

16. Cokeisaddedintheblastfurnaceto
A.

reduce&melttheironore.

B.

increasethefluidityofslag.

C.

removesulphur&phosphorusfrommoltenmetal.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Abalanceddraughtboilerfurnaceemploys__________draughtfan.
A.

induced

B.

forced

C.

both'a'&'b'

D.

neither'a'nor'b'

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Aluminiumoxide(anabrasive)isusedforgrinding
A.

ceramics

B.

highspeedsteel

C.

cementedcarbide

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Inacasting,coldshutdefectiscausedby
A.

lowpounhgtemperature.

B.

meltmouldreactions.

C.

faultygatingsystem.

D.

verylowmouldpermeability.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Evenminutepresenceofimpuritiesincopperimpairsitselectricalconductivityseriously.
Electrolyticrefinningofblistercopperisresortedto,when
A.

cheapelectricityisavailable.

B.

thepreciousmetalcontentofcopperishigh.

C.

thereisademandforultrapure(99.99%)electrolyticcopper.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage5

21. Whichofthefollowingmetalscanbeextractedfromitsorebybothpyrometallurgicalas
wellashydrometallurgicalmethods?
A.

Copper

B.

Zinc

C.

both'a'&'b'

D.

neither'a'nor'b'

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Ifaheattransfersurfaceispockmarkedwithanumberofcavities,thenascomparedto
asmoothsurfacetheheattransferby__________willnotincrease.
A.

convection

B.

nucleateboiling

C.

radiation

D.

conduction

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Piezoelectricisamaterial
A.

whosepropertiesismidwaybetweentheconstituentmaterials.

B.

whichgetspolarised,whenstressed.

C.

inwhichmagnetisingforcereduceswhencurrentflowingthroughitisincresed.

D.

whichchangesdimensionsduetoappliedfield.

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage5

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Oxygencontentbelow__________percentinaircontaminatedwithnitrogendoesnot
supportcombustionandisunsafeforhumaneexposure.
A.

18

B.

16

C.

14

D.

12

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Moistairiscooledalongthelineofconstant__________,whenitispassedoveracold&
drycoolingcoil,suchthatnocondensationoccurs.
A.

enthalpy

B.

relativehumidity

C.

wetbulbtemperature

D.

dewpointtemperature

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage6

26. ProductionofonetonofsteelplateinamodernintegratedsteelplantinIndiaconsumes
about__________kWhofelectricity.
A.

50

B.

250

C.

450

D.

850

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Ceramictipsforthecuttingtoolarepreparedfrom__________powder.
A.

carbon

B.

siliconcarbide

C.

aluminiumoxide

D.

tungsten

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Fatiguestrengthofametalisimprovedby
A.

overstressing.

B.

scratchingthesurface.

C.

raisingthetemperature.

D.

understressing.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage6

ViewAnswer

Workspace

Report

DiscussinForum

29. Saturatedsteamatapressureof25kg/cm2isthrottledtoattain5kg/cm2.Thenthe
outcomingsteamwillbe
A.

wet

B.

saturated

C.

superheated

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. An"orangepeel"effectisobserved
A.

asadefectduringmetalcasting/welding.

B.

duringdeepdrawingofmetallicsheethavinglargegrainsize.

C.

duringfaultyheattreatmentofsteel.

D.

duringextrusionofmetalthroughadie.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage7

31. Themagnitudeofwaterhammercausedinpipeflowisindependentofthe
A.

pipelength.

B.

fluidflowstoppagerate.

C.

fluidtemperature.

D.

timeofvalveclosure.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Ametalloidpossessesthecharacteristicsofboththemetalsandnonmetals.Whichofthe
followingisnotametalloid?
A.

Arsenic

B.

Antimony

C.

Lead

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Nocuttingfluidisnormallyused,whilemachining
A.

castiron

B.

aluminium

C.

mildsteel

D.

stainlesssteel

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage7

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. TwosolutionsA1&A2havepHvalueof2&6respectively.Itimpliesthatthesolution
A.

A1ismorealkalinethansolutionA2.

B.

A1ishighlyacidic.

C.

A2isveryslightlyacidic.

D.

both(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Whichofthefollowingisadisaccharide?
A.

Lactose

B.

Starch

C.

Cellulose

D.

Fructose

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage8

36. Hardness&tensilestrengthofausteniticstainlesssteelcanbeincreasedby
A.

martempering

B.

coldworking

C.

normalising

D.

hardening

ViewAnswer

Workspace

Report

DiscussinForum

37. Whichofthefollowingmetalsoccursinnatureintheirfreemetallicstate?
A.

Au&Ag

B.

Pb&Zn

C.

Cu&Ni

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Themostsuitablematerialforasewerforcarryingstormwateris
A.

asbestoscement

B.

castiron

C.

mildsteel

D.

cementconcrete

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Inatotallyirreversibleisothermalexpansionprocessforanidealgas,E=0,H=0.
ThenQandSwillbe
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage8

A.

Q=0,S=0

B.

Q=0,S=+ve

C.

Q=0,S=ve

D.

Q=+ve,S=+ve

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Sulphurismeltedinthesulphuricacidplantmostcommonlybyemploying
A.

electricalheater

B.

steamheater

C.

directfueloilfiredheater

D.

gasfiredfurnace

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage9

41. In1841highspeedsteel,18,4&1respectivelydenotethepercentageof
A.

chromium,tungsten&vanadium.

B.

tungsten,chromium&vanadium.

C.

tungsten,vanadium&chromium.

D.

tungsten,chromium&molybdenum.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Roleofa"collector"infrothfloatationisto
A.

formawaterrepellingfilmonthemineralsurface.

B.

createandstabilisethefroth.

C.

actasasurface.

D.

collectthemineralsaccordingtotheirspecificgravity.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Fortherunningofpowergeneratingturbines,thesteamusedshouldbe
A.

wet

B.

superheated

C.

atordinarypressure

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Creepconsiderationisthemostimportantincaseofthe
A.

bladesofgasturbines.

B.

steamengineflywheel.

C.

castironpipes.

D.

cyclechains.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. ThediffusioncoefficientofNiinCuat1000Kis1.93x10 16m2.S1anditis1.94x


10 14m2S1at1200K.Theactivationenergy(ink.J.mole1)forthediffusionofNiin
Cuis
A.

130

B.

180

C.

230

D.

250

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage10

46. Whichofthefollowinghasrotteneggysmell?
A.

Hydrogensulphide

B.

Styrene

C.

Phenol

D.

Dimethylamine

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Freezingof35%oleumduringitsshipmentinwinterisavoidedbytheadditionofsmall
amountof
A.

hydrochloricacid

B.

methylalcohol

C.

formicacid

D.

nitricacid

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Inhotworking,dynamicrecoveryoccursin
A.

metalsoflowstackingfaultenergy.

B.

metalsofhighstackingfaultenergye.g.iron.

C.

singlecrystalofNibasedsuperalloys.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Whichofthefollowingmanufacturingprocessesproducesthestrongestcomponents?
A.

Forging

B.

Coldrolling

C.

Hotrolling

D.

Diecasting

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Castironcomparedtosteelisbetterin
A.

ductility

B.

strength

C.

malleability

D.

fluidity&castability

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswers

1. Sewageisnotanexcellentmediumforthegrowthof
A.

aquaticcreatures.

B.

protozoa.

C.

virus.

D.

pathogenicbacteria.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Whichofthefollowingpairiscorrectlymatched?
A.

Heattransfer:Thermaldiffusivity.

B.

Masstransfer:Diffusioncoefficient.

C.

Momentumtransfer:Kinematicviscosity.

D.

all'a','b'&'c'arecorrectlymatched.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Rateofchemicalreactionisnotmuchaffected,ifthereactantsarein__________form.
A.

solids

B.

liquids

C.

either(a)or(b)

D.

gaseous

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection18ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Materialsusedformakingpermanentmagnetscontainingironandnickelaremadeby
__________technique.
A.

powdermetallurgy

B.

casting

C.

forging

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Lubricationisdonetocontrol
A.

friction

B.

wear

C.

temperature

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage2

6. Thedeliverypressureofboilerfeedwaterpumpcomparedtotheboilersteampressureis
A.

same

B.

slightlyless

C.

slightlymore

D.

muchmore

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Theexcessairrequiredforthecombustionofpulverisedcoalisoftheorderofabout
__________percent.
A.

B.

15

C.

30

D.

45

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Pickoutthewrongstatement.
A.

Completeunityofcommandexistsinalineorganisation.

B.

Lineorganisationisnetsuitableforexpansionandgrowthofanindustry.

C.

Inlineandstafforganisation,"line"executesand"staffdirects.

D.

noneofthese.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. __________ofaustenitedecreasesthehardenabilityinsteel.
A.

Finegrains

B.

Coarsegrains

C.

Homogeneity

D.

Dissolvedelements(exceptcobalt)

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Ajigisusedwhile__________ahole.
A.

boring

B.

counterboring

C.

drilling

D.

enlarging

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage3

11. At100%relativehumidity,thedewpointtemperatureofmoistairis
A.

lessthanthewetbulbtemperature.

B.

morethanthewetbulbtemperature.

C.

equaltothewetbulbtemperature.

D.

equaltotheambienttemperature.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Whichoneisneutralincharacter?
A.

N2O4

B.

N2O

C.

N2O5

D.

N2O3

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Gagepressurewithinasphericaldropletofafluidis'p'.Whatwillbegagepressurewithin
abubbleofthesamesize&ofthesamefluid?
A.

B.

2p

C.

0.5p

D.

0.25p

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Whilethebincardsareusedintheeffectivestoresmanagement,thequeingtheoryis
associatedwiththe__________time.
A.

waiting

B.

idle

C.

inspection

D.

toolreplacement

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Diameteroftherivettobeprovidedona20mm.thickboilerplatewillbe__________
mm.
A.

10

B.

20

C.

30

D.

40

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage4

16. Halflifeofaradioactiveisotopecorrespondstothetimerequiredforhalfofthe
__________todecay.
A.

atoms

B.

neutrons

C.

nucleons

D.

electrons

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Theproductofacommercialdirectreductionprocessis
A.

liquidiron

B.

solidiron

C.

spongeiron

D.

ironsaturatedwithcarbon

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Inthedivingapparatus,heliumisusedalongwithoxygen,becauseitis
A.

easilyavailable.

B.

notsolubleinbloodathighpressure.

C.

lighterthannitrogen.

D.

completelymisciblewithoxygen.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Materialshavingresistivityrangingfrom1to100ohm.cmistermedas
A.

conductor

B.

insulator

C.

semiconductor

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Duringsensiblecoolingofair,itswetbulbtemperature
A.

decreasesbutdewpointremainsconstant.

B.

increasesbutdewpointremainsconstant.

C.

increases&thedewpointdecreases.

D.

decreases&thedewpointincreases.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage5

21. WhichofthefollowingemissionsintheexhaustgasofanI.C.enginecausesthe
formationofphotochemicalsmog?
A.

Nitrogenoxides

B.

Hydrocarbons

C.

both'a'&'b'

D.

Carbonmonoxide

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. IfReynoldsnumberisgreaterthan1,thenthe
A.

viscousforceislargerthantheinertiaforce.

B.

inertiaforceislargerthantheviscousforce.

C.

inertiaforceislargerthanthesurfacetensionforce.

D.

inertiaforceislargerthanthegravitationalforce.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Thetypeofpumpusedforliftinglargequantityofsewageisa__________pump.
A.

gear

B.

centrifugal

C.

reciprocating

D.

plunger

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage5

ViewAnswer

Workspace

Report

DiscussinForum

24. Whichofthefollowingmetalsisnotsubjectedtoelectrolyticrefinning/purification?
A.

Copper

B.

Zinc

C.

Tin

D.

Aluminium

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Themostimportantfunctionofawasheristoprovidebearingareaandwashersare
normallyspecifiedbytheirholediameters.Thediameterofwasherascomparedtothe
nutis
A.

more

B.

less

C.

same

D.

morebutlessthanthediameterofbolt

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage7

31. Amaterialiscapableofresistingsofteningathightemperature,becauseofitsproperty
termedas
A.

hottemper

B.

hothardness

C.

fatigue

D.

creep

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Cascadecontrolis
A.

thecontinuousadjustmentofthesetpointindexofanautomaticcontrolloopby
aprimary(master)controller.

B.

usedwhenchangesinprocessconditionscauseseriousupsetsinthecontrolled
variable.

C.

usefultocontrolflowfromtemperature.

D.

all'a','b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Softeningofhardnedsteelisdonebyits
A.

normalising

B.

tempering

C.

annealing

D.

carburising

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. Air/fuelratiobyweightforcombustionofmethanewiththeoreticalquantityofairwillbe
about
A.

9:1

B.

17:1

C.

23:1

D.

29:1

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Whichofthefollowingalloyingelementsispresentinmaximumpercentageinhighspeed
steel.
A.

Molybdenum

B.

Chromium

C.

Tungsten

D.

Vanadium

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage8

36. __________isanonvolatilefilmformingconstituentofapaint.
A.

Thinner

B.

Dryer

C.

Dryingoil

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Accordingtomaximumshearstressfailurecriterion,yieldinginmaterialoccurs,whenthe
maximumshearstressisequalto__________timestheyieldstress.
A.

0.5

B.

C.

D.

3/2

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Transformercoresarenormallymadefrom
A.

softferrites

B.

highpurityiron

C.

grainorientedFeSialloy

D.

AlNiCoalloy

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. __________testistheappropriatetesttodeterminewhetheramaterialisductileor
brittle.
A.

Impact

B.

Cupping

C.

Hardness

D.

Tensile

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Mainconstituentofboneashis
A.

ammoniumphosphate.

B.

calciumphosphate.

C.

animalcharcoal.

D.

ammoniumsulphate.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage9

41. Temperingofamaterialdoesnotimproveits
A.

machinability

B.

toughness

C.

internalstresslevel

D.

softness

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Highrelativehumiditydecreasestheevaporativeprocessandasthetemperatureis
increased,therelativehumiditydecreases.Thecomfortrangeforhumanbodyisthe
ambienttemperatureof22to27Cwithrelativehumidityrangingfrom__________
percent.
A.

5to10

B.

15to25

C.

45to50

D.

75to80

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. WhichofthefollowingperformancecharacteristicsofaS.Iengineisnotaffectedbythe
frontendvolatilityofthepetrolused?
A.

Vapourlocking.

B.

Hotstarting.

C.

Sparkplugfouling.

D.

all'a','b'&'c'.

Answer&Explanation
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage9

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. __________glassisusedinthemercuryinglassthermometermeantformeasuringa
temperatureof500C.
A.

Borosilicate

B.

Highsilica

C.

Supermax

D.

Lead

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Heatreleaseduringphasechangeisobservedincaseofa/an
A.

boiler

B.

condenser

C.

evaporator

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage10

46. Thehardenabilityofsteeldecreaseswith
A.

decreaseindislocationdensity.

B.

increaseinsolutionisingtemperature.

C.

increaseinstrength.

D.

decreaseingrainsize.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Pickoutthecorrectstatementaboutthecondensation.
A.

Filmwisecondensationgivesalowerheattransferratethanthedropwise
condensation.

B.

Suitablecoatingorvapouradditiveisusedtopromotefilmwisecondensation.

C.

Ifacondensingliquiddoesnotwetthesurfacedropwise,eventhencondensation
willtakeplaceonit.

D.

Reynoldsnumberofcondensingliquidisbasedonitsmassflowrate.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Changeinvolumeofmetalsfromabsolutezerotemperaturetotheirmeltingpointsis
A.

almostsameforallmetals.

B.

differentfordifferentmetals.

C.

lessforlowmeltingpointmetals.

D.

lessforhighmeltingpointmetals.

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswersPage10

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Wohlertestisadestructivetesttofindoutthe__________strengthofapreparedmetal
specimen.
A.

creep

B.

fatigue

C.

endurance

D.

tensile

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Alloypowdermanufacturedbythefollowingprocesshavesphericalshapes.
A.

Electrochemicaldeposition.

B.

Gaseousreduction.

C.

Atomisation.

D.

Mechanicalattrition.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/28/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswers

1. Whichofthefollowingisaboileraccessoryi.e.,notaboilermounting?
A.

Blowoffcock

B.

Feedcheckvalve

C.

Feedwaterpump

D.

Stopvalve

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Whichofthefollowingforcesdoesnotactonafluidatrest?
A.

Viscousforce

B.

Gravityforce

C.

Hydrostaticforce

D.

Surfacetensionforce

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Densityinthesolidstateisslightlylessthanthatinitsliquidstate,incaseof
A.

carbondioxide

B.

water

C.

mercury

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

4/28/2015

ChemicalEngineeringBasicsSection19ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Strainhardeningeffectinmetalssubjectedtocoldworkingisduetothe__________
mechanism.
A.

slip

B.

fracture

C.

winning

D.

dislocation

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. __________numberdetermineswhetherthefluidflowinanopenchannelis
supercritical,criticalorsubcritical.
A.

Mach

B.

Reynolds

C.

Froude

D.

Weber

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage2

6. Whichofthefollowingisnotanoreofiron?
A.

Chalcopyrite

B.

Magnetite

C.

Hemetite

D.

Limonite

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whichisthemostlethalweapon?
A.

Atom(fusion)bomb

B.

Hydrogenbomb

C.

Cobaltbomb

D.

Neutronbomb

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Reynoldsnumberofafluidflowinginacircularpipeis10000.WhatwillbetheReynolds
numberwhenthefluidvelocityisdecreasedby30%&thepipediameterisincreasedby
30%?
A.

9100

B.

13000

C.

7000

D.

2550

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage2

9. Anexampleofunsteadynonuniformflowistheflowofliquidunderpressurethrougha
A.

taperingpipeatconstantflowrate.

B.

taperingpipeateitherdecreasingorincreasingflowrate.

C.

longpipelineofconstantdiameter.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Whichofthefollowingcontributesmaximumasmainsourceofsulphurintheblast
furnacecharge?
A.

Sinter

B.

Coke

C.

Ironore

D.

Limestone

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage3

11. Acolloidalsystem,inwhichaliquidisdispersedingasiscalleda/an
A.

gel

B.

aerosol

C.

foam

D.

emulsion

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Blastfurnaceisa
A.

countercurrentreactor

B.

cocurrentreactor

C.

crosscurrentreactor

D.

combinationofallthethree

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Speedofasubmarineindeepsea&thatofanaeroplaneismeasuredbya/an
A.

pitottube

B.

hotwireanemometer

C.

rotameter

D.

stroboscope

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage3

14. Theprimarystrengtheningmechanismin70:30brassisthe
A.

solidsolutionstrengthening.

B.

precipitationhardening.

C.

dispersionstrengthening.

D.

orderhardening.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Xraysdonotexhibitthepropertyof
A.

reflection

B.

scattering

C.

diffraction

D.

dispersion

Answer&Explanation

Answer:OptionB
Explanation

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage4

16. Killedsteels
A.

arefreefromoxygen.

B.

containnoteventracesofsulphur&phosphorous.

C.

areproducedbyL.D.processonly.

D.

containminimumimpuritylevel.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Whichofthefollowingphenomenon/phenomenais/arediffusioncontrolled?
A.

Dislocationclimb

B.

Crossslip

C.

Twinning

D.

Recrystallisation

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. JouleThomsoncoefficientistheratioof
A.

pressurechangetotemperaturechangeoccuringduringadiabaticcompressionof
agas.

B.

pressurechangetotemperaturechangeoccuringduringadiabaticthrottlingofa
gas.

C.

temperaturechangetopressurechangeoccuringduringadiabaticcompressionof
agas.

D.

temperaturechangetopressurechangeoccuringduringadiabaticthrottlingofa
gas.

Answer&Explanation
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage4

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Expansiondeviceusedinawindowairconditionerisa/an
A.

automaticexpansionvalve.

B.

thermostaticexpansionvalve.

C.

floatvalve.

D.

capillarytube.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Theunitofgcis
A.

B.

C.

D.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage5

21. IntheacidBessemerprocess,thehotmetalshouldhavethefollowingcompositon.
A.

S<0.05%andP<0.05%.

B.

S<0.05%andP<1.5%.

C.

S<0.05%andP>1.5%.

D.

S>1.5%andP<0.05%.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Whichofthefollowingdoesnotcomeunderthecategoryofelectrochemicalcorrosion?
A.

Corrosioninorganicliquids.

B.

Atmosphericcorrosioninmoistgasorair.

C.

Soilcorrosionasinthecaseofundergroundpipes.

D.

Corrosioninseawaterandmoltenmetals.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Unbreakablecrockeriesaremadefrom__________polymers.
A.

polystyrene

B.

melamine

C.

polystyrene

D.

polyurathane

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage5

24. Cupolaproduces__________iron..
A.

pig

B.

cast

C.

wrought

D.

carbonfree

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Eulernumberisdefinedastheratioofinertiaforceto__________force.
A.

pressure

B.

elastic

C.

gravity

D.

viscous

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage6

26. Holesforrivettingpurposesshouldbepreferablymadeby
A.

cuttingtorch

B.

drilling

C.

punching

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Oneofthemethodsofpurificationofleachliquorisionexchange,whichinvolves
A.

exchangebetweentwoliquidphases.

B.

exchangebetweenagaseousphaseandaliquidphase.

C.

exchangebetweenaliquidphaseandanorganicresinphase.

D.

exchangebetweenasolidphaseandagasphase.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Asteampipeisintendedtobeinsulatedwithtwolayersofinsulatingmaterialsofdifferent
thermalconductivities.Forminimumheattransfertotakeplace
A.

thebetterinsulationmaterialshouldbeputjustnexttopipe(i.e.,inside).

B.

thebetterinsulatingmaterialshouldbeputoutside.

C.

eitheroftheinsulatingmaterialcouldbeputoneitherside.

D.

steamtemperatureisconsideredbeforedecidingastowhichinsulatingmaterialis
tobeputinside(i.e.,justnexttothepipe).

Answer&Explanation

Answer:OptionA
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Largediametershaftsaremanufacturedby
A.

hotrolling.

B.

colddrawing.

C.

castingandturningtosize.

D.

forgingandturningtosize.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. CommonsaltisproducedfromseawaterinIndiagenerallybythe__________method.
A.

freezedrying

B.

solarevaporation

C.

electrolytic

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage7

31. Batchprocessispreferredovercontinuousprocess,whenthe
A.

productyieldsandqualitycannotbeachievedincontinuousprocess,becauseof
longresidencetime.

B.

salesdemandofproductisnotsteady.

C.

sameequipmentcannotbeusedforseveralprocessesofthesamenature.

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Whichofthefollowingisapermanentfastening?
A.

Rivets

B.

Bolts

C.

Screws

D.

Keys

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Hot&coldworkingofmaterialcausesits__________deformation.
A.

viscoelastic

B.

isotropic

C.

elastic

D.

plastic

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Theratioofthermal&electricalconductivityissameforallthemetalsatthesame
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage7

temperatureandataroundroomtemperature,thisratioisproportionalto(where,T=
absolutetemperature,K)
A.

B.

1/T

C.

T2

D.

1/T2

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Inafuelcell,chemicalenergyisconvertedinto
A.

electricalenergydirectly.

B.

mechanicalenergy.

C.

electricalenergyandstoredtherein.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage8

36. Whichofthefollowingisnotacupronickelalloy?
A.

Germansilver

B.

Monelmetal

C.

Muntzmetal

D.

Noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Electrochemicalcorrosionoccurs
A.

wheretheliquidelectrolytescontainingfreeionsarepresent.

B.

onlyinalloys.

C.

onlyinpuremetals.

D.

duetodirectchemicalactionofmetalwithoxygen.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Theabilityoftoolsteeltoresistsofteningathightemperaturesistermedas__________
hardness.
A.

red

B.

extended

C.

super

D.

extreme

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Improvementinmechanicalpropertiesofmetalsinitshotworkingisduetothegrains
A.

recrystallisation

B.

refinement

C.

growth

D.

recovery

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Young'smodulusofelasticityofamaterialistheslopeoftheinitiallinearportionofthe
stressstraincurve.Itdecreasesappreciablyby
A.

alloyingadditions

B.

heattreatment

C.

coldwork

D.

increasingtemperature

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage9

41. Venturimeterisusedtomeasuretheflowrateoffluidsinpipes,whenthepipeisin
__________position.
A.

horizontal

B.

vertical

C.

inclined

D.

any

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Oftenearingdefectsarefoundduringdeepdrawingoperation,becausethe
A.

surfacefinishofthesheetispoor.

B.

sheetmaterialhasbeengivensubstantialspringback.

C.

startingsheethasplaneranisotropyduetoitstexture.

D.

startingsheethasnormalanitropyduetoitstexture.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. __________isnotacasehardeningprocess.
A.

Carburising

B.

Nitriding

C.

Cyaniding

D.

Annealing

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Whichonecanbedirectlysolidifiedfromgaseousstatewihtoutenteringintoliquidstate?
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage9

A.

Helium

B.

Oxygen

C.

Carbondioxide

D.

Noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Whichofthefollowingistermedastheboilermounting?
A.

Superheater

B.

Economiser

C.

Blowoffcock

D.

Feedpump

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage10

46. Shockresistingsteelsshouldpossesshigh
A.

hardness

B.

toughness

C.

tensilestrength

D.

wearresistance

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Fatiguelifeisexpectedtoincreaseby
A.

increasingthesizeofthesample.

B.

smoothpolishingofthesurfaceofthesample.

C.

havingcompressiveresidualstressesatthesurface.

D.

havingtensileresidualstressesatthesurface.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Specific__________isadimensionlessquantity.
A.

heat

B.

humidity

C.

weight

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. __________isnotusedasthecontrolrodmaterialinanuclearreactor.
A.

Cobalt

B.

Hafnium

C.

Cadmium

D.

Boron

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Superheatedvapourbehaveslike
A.

drysteam

B.

gasapproximately

C.

anordinaryvapor

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswers

1. Theinstrumentbasedonthefollowingprincipleisusedforthemeasurementofoxygen
onlyinthefluegases.
A.

Chemicalabsorption.

B.

Thermalconductivity.

C.

Infraredabsorption.

D.

Paramagnetism.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Workstudydealswiththe__________study.
A.

time

B.

motion

C.

both(a)&(b)

D.

neither(a)nor(b)

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Maximumchangeinthehardnessofmartensiteoccursinthecarboncontentrangeof
__________percentinsteel.
A.

0.01to0.10

B.

0.2to0.4

C.

0.5to0.7

D.

0.8to1.0

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

28/04/2015

ChemicalEngineeringBasicsSection20ChemicalEngineeringQuestionsandAnswers

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Knockingtendencyinapetrolenginedecreaseswithincreasing
A.

supercharging

B.

compressionratio

C.

walltemperature

D.

enginespeed

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Hooke'slaw
A.

appliestoelasticdeformation.

B.

appliesbeyondlimitofproportionalityinstressstraincurve.

C.

statesthatstressisinverselyproportionaltostrainuptoelasticlimit.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage2

6. Themomentofinertiaofabodycomesintoplayin__________motion.
A.

curvilinear

B.

linear

C.

rotational

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Thermoplasticsarenevermouldedusing
A.

injectionmoulding

B.

blowmoulding

C.

extrusion

D.

compressionmoulding

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Pickoutthewrongstatement.Ifthenetpositivesuctionhead(NPSH)requirementofa
pumpisnotsatisfied,then
A.

itwilldeliverlowdischargeofliquid.

B.

itsefficiencywillnotbeaffected.

C.

itwillnotdevelopsufficientheadtoraisewater.

D.

itwillbecavitated.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Whilethethermosettingpolymersareamorphousinnature,thethermoplasticpolymers
areeitheramorphousorcrystalline.Thecrystallinepolymersarecharacterisedbythe
A.

lowimpactstrength.

B.

highflexibility.

C.

betterfinishandsurfaceappearance.

D.

highplasticdeformation.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Thestressatwhichametalfailsbyfatiguelies
A.

nearthefracturepointofthestressstraincurve.

B.

intheplasticrange.

C.

intheelasticrange.

D.

noneofthese.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage3

11. Annealingofamaterialdoesnot
A.

permititsfurthercoldworking.

B.

softenit.

C.

casehardenit.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Whichofthefollowingisnotanoreofaluminium?
A.

Troosite

B.

Kaolin

C.

Alunite

D.

Cryolite

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Boilerdraughtof10mmwatercolumnisequivalentto
A.

1kgf/m2

B.

10kgf/m2

C.

10kgf/mm2

D.

1kgf/mm2

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Thefugacityofliquidwaterat298Kisapproximately3171Pa.Consideringtheidealheat
ofvaporisationas43723J/gmmole,itsfugacityat300Kwouldbe
A.

3171Pa

B.

3567Pa

C.

1.01x10 5Pa

D.

5000Pa

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. ThelegofabarometriclegpumpislongerthantheToricellianleg,whichisabout
__________metres.
A.

B.

C.

34

D.

10

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage4

16. Commonlyemployedcoolantforhighpressureturbogeneratoris
A.

air

B.

carbondioxide

C.

hydrogen

D.

water

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Slightdisplacementofafloatingbodyinliquidmakesittooscillateaboutits
A.

centreofpressure.

B.

centreofgravity.

C.

metacentre.

D.

centreofpressure.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Buoyancyforcedependsonthe__________theliquid.
A.

depthofimmersionin

B.

displacedmassof

C.

surfacetensionof

D.

viscosityof

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. "EncyclopaediaofChemicalTechnology"hasbeen
A.

authoredbyKirkOthmer.

B.

editedbyPerryandChilton.

C.

editedbyKirkOthmer.

D.

authoredbyPerryandChilton.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Statisticalqualitycontrolwasdevelopedby__________,anAmericanscientistduring
worldwarII.
A.

Watershewhart

B.

FredricTaylor

C.

JohnWright

D.

Woolmer

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage5

21. Productionofahollowproductbyinflationofatubeorparisoniscalledthe__________
process.
A.

blowmoulding

B.

calendering

C.

extrusion

D.

injection

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Asparkignitionpetrolenginehas
A.

throttlevalve

B.

carburettor

C.

both(a)&(b)

D.

neither(a)nor(b)

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Outofthefollowing,thehighestemfforagiventemperatureisgeneratedbythe
__________thermocouple.
A.

chromelalumel

B.

ironconstantan

C.

platinumplatinum+rhodium

D.

copperconstantan

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage5

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Whichistheonlymetalthatexistsinliquidstateatroomtemperature?
A.

Sodium

B.

Mercury

C.

Lithium

D.

Strontium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Anapproximately__________processexemplifiestheflowofagasthroughaverylong
pipeofuniformcrosssection.
A.

adiabatic

B.

isothermal

C.

isentropic

D.

isochoric

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage6

26. AmetalhavingaPoisson'sratio=0.3iselasticallydeformedunderuniaxialtension.Ifthe
longitudinalstrain=0.8,thenthemagnitudeofthicknessstrainis
A.

0.8

B.

0.8

C.

+0.08

D.

0.24

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Thequantityofelectricityrequiredtodepositonegmequivalentofanysubstanceisone
A.

ampere

B.

coulomb

C.

microfaraday

D.

faraday

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Surfacetensionisduetothe__________forces.
A.

viscous

B.

adhesive

C.

cohesive

D.

differencebetweenadhesive&cohesive

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Atabsolutezerotemperature,foranyreactioninvolvingcondensedphases
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage6

A.

G=0,H=0

B.

H=0,S=0

C.

S=0,E=0

D.

S=0,Cp=0

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Metalsingeneralhavealowvalueofthermal
A.

conductivity

B.

diffusivity

C.

inertia

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage7

31. __________oftestspecimensisnotinvolvedinanyhardnesstestingmethod.
A.

Fracture

B.

Indentation

C.

Wear

D.

Scratch

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Outofthefollowing,themostductilematerialis
A.

mildsteel

B.

copper

C.

nickel

D.

aluminium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Whathappens,whenSO2ispassedthroughasolutionofH2Sinwater?
A.

Precipitationofsulphurtakesplace.

B.

H2SO3isformed.

C.

Oleumisformed.

D.

Noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage7

34. Whichofthefollowingwillresistmaximumshock&vibrationwithoutcracking?
A.

Greycastiron

B.

Whitecastiron

C.

Malleableiron

D.

Graphite

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Surfacetensionofaliquid
A.

isduetointermolecularforcesofcohesion.

B.

decreaseswithriseintemperature.

C.

isresponsibleforthesphericalshapeofanisolatedliquiddrop.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage8

36. Fordynamicstrainmeasurement,thewheatstonebridgeusedisof__________type.
A.

voltagesensitivenull

B.

voltagesensitivedeflected

C.

currentsensitivedeflected

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Whichdrugismadefromvegetables?
A.

Pencilin

B.

Aspirin

C.

Quinine

D.

Insulin

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Whichofthefollowingaremadeoutofthecarbonsteelhavingcarboncontentof0.9to
1%?
A.

Smallpunches,broachesreamersandsprings.

B.

Cutlery,screws,rivetsandfiles.

C.

Mandrels,twistdrills,smalllathetoolsandrazors.

D.

Forgingslikecanshaft,structuralsteelplate,threadingdiesanddrawingdies.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Materialofconstructionofsurveyingmetallictapesis__________whichhaslow
coefficientofexpansion&enoughstrength.
A.

constantan

B.

invar

C.

pewtermetal

D.

monelmetal

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Weldedjointissuperiortorevettedjointinrespectofeaseoffabrication,weightand
strength.Whichofthefollowingjointsisthemostsuitableforpipescarryingfluidsunder
highpressureandtemperature?
A.

Flangedjoint

B.

Expansionjoint

C.

Bellandspigotjoint

D.

Noneofthese

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage9

41. Siliconpercentageinacidresistantcastironisabout
A.

B.

C.

14

D.

20

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Thermalexpansionofsolidisemployedinthetemperaturemeasurementbya
A.

bimetallicthermometer.

B.

thermocouple.

C.

mercurythermometer.

D.

resistancethermometer.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Stressandstrainarerelatedby__________elasticconstantsforalinearlyelastic,
homogeneous&isotropicmaterial.
A.

one

B.

two

C.

three

D.

four

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Thebehaviourofametalspecimen,whichwhenplasticallystrainedintensionreducesits
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage9

yieldstressincompressionandviceversaistermedasthe
A.

workhardening.

B.

Bauschingereffect.

C.

creepingeffect.

D.

stressrecoveryeffect.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Functionoffusiblepluginaboileristo
A.

drainoutwaterandsludgefromtheboilerduringrepair.

B.

putofffireinthefurnacewhenwaterlevelintheboilerfallstounsafelimit.

C.

guardtheboilerincaseofabnormalriseinsteampressure.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage10

46. Whatistherangeoftemperingtemperature(C)formostofthematerials?
A.

75100

B.

200300

C.

350450

D.

500600

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Absorptivityofagreybodyvarieswiththe
A.

wavelengthoftheincidentray.

B.

temperature

C.

both'a'&'b'

D.

neither'a'nor'b'

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Inradiativeheattransfer,agreysurfaceistheone,whichhas
A.

emissivityindependentofwavelength.

B.

greyappearancetotheeye.

C.

zeroreflectivity.

D.

equalbrightnessinalldirections.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswersPage10

49. Overheatingofsatellitesduringreentrytoearthiscontrolledby
A.

thickinsulation.

B.

ceramiclining.

C.

coolingbyflowofairoverthesurface.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Themostabundantmetalpresentintheearth'scrustis
A.

iron

B.

copper

C.

titanium

D.

aluminium

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswers

1. Toughnessofamaterialismeasuredbythe
A.

Vicker'shardnesstest.

B.

scratchtest.

C.

universaltestingmachine.

D.

notchedbartest.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Pickoutthewrongstatementaboutnucleateboiling.
A.

Bubblegenerationisbyexpansionofentrappedgas/vapouratsmallcavitiesinthe
surface.

B.

Surfacetemperatureisgreaterthanthesaturationtemperatureoftheliquid.

C.

Heattransferfromthesurfaceoftheliquidislessthanthatinfilmboiling.

D.

Thetemperatureislessthanthatoffilmboiling.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. L.D.(LinzDonawitz)converterisusedintheproductionof
A.

copper

B.

steel

C.

zinc

D.

aluminium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

28/04/2015

ChemicalEngineeringBasicsSection21ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4. Turning/machiningof__________usuallydoesnotrequireanycuttingfluid.
A.

castiron

B.

stainlesssteel

C.

mildsteel

D.

copper

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Powdermetallurgyprocessingcanbeusedformaking
A.

dispersionstrengthenedcopperrod.

B.

selflubricatingbearingandcementedcarbide.

C.

connectingrod.

D.

piston.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailablefor

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage2

6. Whichofthefollowingalloyingelementswhenaddedinsteeldoesnotimproveits
lachinability?
A.

Sulphur

B.

Phosphorous

C.

Copper

D.

Lead

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Largestapplicationoflaserweldingisin__________welding.
A.

microspot

B.

underwater

C.

preciousmetals

D.

heavystructure

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Whichofthefollowingisaneutralfluxusedinthepyrometallurgyofmetalextraction?
A.

Quartz

B.

Flourspar

C.

Dolomite

D.

Manganeseore

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Thecriticalpressureatwhichthelatentheatofvaporisationofsteambecomeszerois
__________Kg/cm2.
A.

273.15

B.

225.65

C.

100.03

D.

373.15

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Valueofamaterialisusuallyconsideredasarelationshipbetween
A.

costandprofit.

B.

utilityandappearance.

C.

utilityandcost.

D.

reliabilityandutility.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage3

11. Whichofthefollowingisnotanoreofzinc?
A.

Cerrusite

B.

Franklinite

C.

Calamine

D.

Troosite

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Pressuregaugesareneverconnecteddirectlytothelivesteamlineratheraloopor
syphonisinterposedascloseaspossibletothepressuregauge.Thisisdoneto
A.

avoidtheoverheatingofthetubes&bellowswhichoperatethemtominimise
erroranddamage.

B.

formasealofwaterbysteamcondensatetofillthetubeorbellowsatthe
pressurebeingmeasured.

C.

both'a'&'b'.

D.

avoidthestaticheaderrorintroducedbysteamentry.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Phosphorousisaddedtocoppermeltto
A.

removehydrogen.

B.

deoxidisethemetal.

C.

improvefluidity.

D.

reduceshrinkage.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Whichofthefollowingisnotasuitablesolidlubricant?
A.

Talc

B.

Molybdenumdisulphide

C.

Graphite

D.

Noneofthese

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Onanaverage__________fastneutronsareproducedbynuclearfissionofeachatom
ofuranium235.
A.

B.

2.5

C.

3.5

D.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage4

16. Castabilityofaluminiumisincreasedbytheadditionof__________init.
A.

silicon

B.

manganese

C.

bismuth

D.

lead

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Additionof__________tosteelcannotimpartithighstrengthatelevatedtemperature.
A.

nickel

B.

magnesium

C.

silicon

D.

manganese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Hardmagneticmaterialshavehigh
A.

coerciveforce.

B.

residualmagneticinduction.

C.

both'a'&'b'.

D.

neither'a'nor'b'.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Thedifferenceinthepropertiesofasubstanceinthreestatesofmatterdependsuponthe
A.

bindingenergyofatoms.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage4

B.

differenceinmolecularshape.

C.

differenceinintermolecularforces.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Ignitionoffuelinadieselengineisby
A.

spark

B.

hotcompressedair

C.

fuelinjection

D.

noneofthese

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage5

21. Whatisthecriticalradiusofinsulation(cms)forametalliccylinder,iftheconvectiveheat
transfercoefficientwiththeambientatmosphereis5W/m2.K?Thermalconductivity
ofmetalandinsulationmaterialare40and0.1W/m.Krespectively.
A.

B.

C.

10

D.

20

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Whichsetofmaterialsisusedasamoderatorinnuclearreactor?
A.

Zircalloy&berrylium.

B.

Zircalloy&heavywater.

C.

Zirconium&berrylium.

D.

Heavywater&berrelium.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Malleabilisationheattreatmentisperformedon
A.

caststeel

B.

greycastiron

C.

whitecastiron

D.

spheroidalgraphitecastiron

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage5

ViewAnswer

Workspace

Report

DiscussinForum

24. Forhardeninghighalloysteel,itistobeheatedslowlyanduniformlytoavoid
A.

localhardening

B.

scaleformation

C.

segregation

D.

warpage

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Disposablepatternsaremadeof
A.

metal

B.

polystyrene

C.

rubber

D.

wood

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage6

26. Thetypeofwaterfilternormallyemployed/preferredfortreatingsmallquantitiesofwater
inrailwaystationsandindividualindustriesisthe__________filter.
A.

rapidsand

B.

pressure

C.

gravity

D.

slowsand.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Theradioactiveisotopeofhydrogenis
A.

deuterium

B.

tritium

C.

protium

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Refrigerativecoolingemployedduringlongdistancetransportationoffoodstuffsis
normallydoneby
A.

ice

B.

liquidnitrogen

C.

liquidoxygen

D.

vacuumevaporation

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage6

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Internalcracksindrawnbarsaredueto
A.

secondarytensilestresses.

B.

temperaturegradientintheworkpiece.

C.

heateddiesandgrips.

D.

internalcompressiveresidualstress.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Yieldstrengthofapolycrystallinemetalwithanaveragegrainsize,d,isproportionalto
A.

d1/2

B.

d1/2

C.

D.

d1

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage7

31. Apipelineburiedinsoiliscommonlyprotectedfromcorrosionby
A.

anodicprotection.

B.

cathodicprotection.

C.

usinginhibitors.

D.

usingaspecialalloyresistanttocorrosion.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Circulationofliquidmetal(i.e.moltensodium)inaliquidmetalcoolednuclearreactoris
donebya/an__________pump.
A.

electromagnetic

B.

axialflow

C.

diaphragm

D.

reciprocating

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Titaniumisproducedby__________ofTiCl4.
A.

electrolyticreduction

B.

calciumreduction

C.

magnesiumreduction

D.

thermaldissociation

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage7

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. __________straingaugeisthemostsensitivesensingelementforstrainmeasurement.
A.

photoelastic

B.

semiconductor

C.

wireresistance

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Asimpleclosedgrindingcircuitmayconsistof
A.

aballmillandaclassifier.

B.

arodmillandahydrocyclone.

C.

ajawcrusherandahydrocyclone.

D.

aballmillandafrothfloatationcell.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage8

36. Inatitrationinvolvingweakacidandstrongbase,thepreferredindicatoris
A.

Methylorange

B.

Phenolphthalein

C.

Ethylorange

D.

Fehling'ssolution

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Solidificationtimeofamoltenmetalinacastingisproportionalto(where,V=volumeof
metal&A=itssurfaceareainthecasting)
A.

V/A

B.

V/A2

C.

V2/A

D.

V2/A2

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Pickoutthewrongstatement.
A.

Annealingtwinsarenotobservedinpurealuminium,becauseithashigherstrain
energy.

B.

Loadduringcoldrollingcanbeloweredbytheapplicationoffronttension.

C.

Veryfinegrainstructureisdesirableforhightemperaturecreepapplicationof
materials.

D.

Softmagneticmaterialsarethosewhichhavelessareawithinthehysterisisloop.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Minimumdiameterofthetubeusedformakingwatermanometershouldbe
__________mmtoavoidacorrectionfortheeffectofcapillarity.
A.

B.

2.5

C.

D.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Whichofthefollowingheattreatmentprocessesisusedforsofteningthehardened
material?
A.

Normalising

B.

Tempering

C.

Annealing

D.

Noneofthese

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage9

41. Duringbrazing,ifthefluxesareentrapped,itresultsinthe
A.

distortionofbrazedjoints.

B.

crackingofjoints.

C.

presenceofgaspockets.

D.

corrosion.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Maximumheatdissipationoccursfromasteelwire(k=0.5W/m.k)of15mmdiameter
exposedtoair(h=20W/m2.k),whentheinsulationthicknessis__________mm.
A.

15

B.

25

C.

10

D.

30

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Allmodesofheattransferi.e.,conduction,convection&radiationoccurincaseofthe
A.

condensationofsteaminapartialcondenser.

B.

boilerfurnace.

C.

insulatedpipecarrayinghighpressuresteam.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. Thestandardinstrumentusedforcalibratingtheloadappliedbyuniversaltestingmachine
iscalled
A.

extensometer

B.

springbalace

C.

dynamometer

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. ThereductantusedintheextractionofmagnesiumfromcalcineddolomiteviaPidgeon's
processis
A.

purecarbon

B.

puresilicon

C.

ferrosilicon

D.

ferromanganese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage10

46. Withincreaseinpressure,thesaturationtemperatureofsteam
A.

increasesrapidlyfirstandthenslowly.

B.

increasesslowlyfirstandthenrapidly.

C.

firstincreasesandthendecreases.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. 'Sterilisedzone'aroundahazardouschemicalindustryisanareawith__________km
radiusaroundit,inwhichthetotalpopulation/inhabitantsshouldbelessthan20000
preferablyintheupwinddirection.
A.

0.5

B.

C.

25

D.

50

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Pickoutthewrongstatement.Terminationofpolymerisationreactionoccurs,ifthe
A.

catalystsupplyisstopped.

B.

monomersupplyisexhausted.

C.

impuritiespresentinmonomersinterferewiththechemicalreaction.

D.

twoendsofachainofmoleculesjoin.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswersPage10

ViewAnswer

Workspace

Report

DiscussinForum

49. Athin,flat&squareplatemeasuring2mx2misfreelyhanginginambientairat25C.
Itisexposedtothesolarradiationfallingononesideoftheplateattherateof500
W/m2.Theplatetemperaturewillremainconstantat30C,iftheconvectiveheat
transfercoefficientis__________W/m2C.
A.

50

B.

100

C.

150

D.

200

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Themaximumvalue,whichtheresidualstressinamaterialcanreachisthe
__________ofthematerial.
A.

elasticlimit

B.

plasticlimit

C.

yieldstress

D.

breakingstress

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswers

1. Pickoutthewrongstatement:
A.

Softwaterismorecorrosivethanthatcarryingcalciumsalts.

B.

Thecorrosionofbrasscondensertubeshandlingbrinesolutionisalsotermedas
'dezincification'.

C.

Nonannealedbrassishighlysusceptibletoseasoncracking(i.e.,intercrystal
corrosionduetointernalstresses).

D.

Purecopperishighlysusceptibletostresscorrosion.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Thetensilestrengthofplasticsrangesfrom__________kg/mm2.
A.

10to50

B.

50to100

C.

0.01to0.1

D.

0.1to10

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Ceramictipsforthecuttingtoolarepreparedfrom__________powder.
A.

carbon

B.

siliconcarbide

C.

aluminiumoxide

D.

tungsten

Answer&Explanation

Answer:OptionC
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection22ChemicalEngineeringQuestionsandAnswers

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Grainhardnessismeasuredbythe__________hardnesstestingmethod.
A.

Knoop

B.

RockwellF

C.

Shoresceleroscope

D.

Vicker's

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Thethermalefficiencyofaheatenginegivinganoutputof4KWwithaninputof10000
Joules/secis__________percent.
A.

40

B.

80

C.

10

D.

25

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage2

6. Numberofelectronsintheoutermostorbitofasemiconductoris
A.

B.

C.

D.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Theconditionofdiffractionfromacrystalisgivenby
A.

n=2dSin

B.

=dSin2

C.

=2dSin2

D.

n=dSin

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Galenaisanoreof
A.

iron

B.

copper

C.

lead

D.

aluminium

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Areductionprocessisaccompaniedwithincreaseinthe
A.

numberofelectrons.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage2

B.

oxidationnumber.

C.

both(a)&(b).

D.

neither(a)nor(b).

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Draughtproducedbyatallchimneyduetodensitydifferencebetweenhotfluegasinside
theChimneyandatmosphericairoutsidethechimneyismoreappropriatelyknownasthe
__________draught.
A.

natural

B.

induced

C.

forced

D.

chimney

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage3

11. Firstempiricaltemperaturescaleconceivedisthe__________temperaturescale.
A.

Absolute

B.

Reaumer

C.

Farenhite

D.

Celcius

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Incontinuouscastingofliquidsteel,themouldismadeof
A.

watercooledsteel

B.

watercooledcopper.

C.

refractoryoxide.

D.

siliconcarbide.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Diamonddoesnotconductelectricity,because
A.

itsstructureisverycompact.

B.

nofreeelectronsarepresent.

C.

itisofcrystallinenature.

D.

thereareonlycarbonatomspresent.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage3

14. __________cannotbeforged.
A.

Highspeed/carbonsteel

B.

Castiron

C.

Wroughtiron

D.

Mildsteel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Materialhavingmaximumdensityis
A.

plutonium

B.

osmium

C.

titanium

D.

uranium

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage4

16. Whichofthefollowingisnotfoundinironcarbonequilibriumdiagram?
A.

Curiepoint

B.

Peritecticpoint

C.

Eutecticpoint

D.

Eutectoidpoint

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Whichofthefollowingmetalscannotbeextractedbypyrometallurgicalprocessfromits
sulphideore?
A.

Copper

B.

Mercury

C.

Lead

D.

Noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Nitrogencompoundsarenotusedinthemanufactureof
A.

fertilisers

B.

gunpowder

C.

tipofmatchsticks

D.

explosive

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Stelliteisatradenameforthe
A.

cermets.

B.

ferrouscastalloys.

C.

nonferrouscastalloys.

D.

productsmadebypowdermetallurgytechniques.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Needlesareproducedby
A.

forging

B.

swaging

C.

extrusion

D.

machining

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescripti

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage5

21. Aromaticsaredesiredconstituentsof
A.

lubricatingoil

B.

diesel

C.

kerosene

D.

petrol

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Galvaniccorrosion
A.

occursinabimetalcouple.

B.

occursinhighlystressedmetallicpartsonly.

C.

isexemplifiedbycausticembrittlementofboilertubes.

D.

isalsocalleddezincification.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Increasingthetemperatureofamaterialmakesit
A.

harder

B.

softer

C.

tougher

D.

stronger

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage5

24. Whichofthefollowingabsorbsmaximumheatinahighpressureboiler?
A.

Economiser

B.

Steamsuperheater

C.

Airpreheater

D.

Furnacewaterwall

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Thelaminarboundarylayerthicknessinzeropressuregradientflowoveraflatplatealong
thexdirectionvariesasx0.5whilethethicknessofturbulentboundarylayervariesas
(where,x=distancefromtheleadingedge)
A.

x1.5

B.

x0.8

C.

x1.5

D.

x0.8

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage6

26. __________cycleisthemostefficientthermodynamiccycle.
A.

Diesel

B.

Otto

C.

Rankine

D.

Carnot

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Dewpointofairindicatesits
A.

moisturecontent

B.

dryness

C.

latentheat

D.

coolness

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Outofthefollowing,__________waveshavethelargestwavelength.
A.

radio

B.

light

C.

Xray

D.

Gammaray

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Picktheoddmanoutofthefollowing.
A.

Calorising

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%22%3E%3Ctable%2

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage6

B.

Packcarburising

C.

Nitriding

D.

Cyaniding

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Afurnaceismadeofarefractorybrickwallofthickness0.5metreandthermal
conductivity0.7W/m.KForthesametemperaturedropandheatloss,thisrefractory
wallcanbereplacedbyalayerofdiatomaceousearthofthermalconductivity0.14W/m.K
andthickness__________metre.
A.

0.01

B.

0.1

C.

0.25

D.

0.5

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%22%3E%3Ctable%2

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage7

31. Hotworkingofleadiscarriedoutat
A.

75C

B.

373K

C.

150C

D.

roomtemperature

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Anengineer'shammerismadeofhigh__________steel.
A.

carbon

B.

speed

C.

silicon

D.

chromium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Impeller&casingofcentrifugalpumphandlingcorrosiveliquidandfrequentlyrunning
undercavitationconditionismostproneto__________corrosion.
A.

uniform

B.

oxygendiffusion

C.

pitting

D.

intergranular

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage7

ViewAnswer

Workspace

Report

DiscussinForum

34. Isotropicmaterialshavethesame__________inallthedirections.
A.

thermalproperties

B.

elasticproperties

C.

stresses

D.

all(a),(b)&(c)

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Thegasesusedinthetreatmentofasthmaisamixtureof__________andoxygen.
A.

helium

B.

argon

C.

neon

D.

noneofthese

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage8

36. Grindingwheelmadeofsiliconcarbideismostsuitableforgrindingmaterialsoflowtensile
strength(e.gtoughbronze).Grindingisa__________operation.
A.

turning

B.

dressing

C.

forming

D.

surfacefinishing

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Whichofthefollowingisthemosteffectiveinhibitorofgraingrowth,whenaddedinsmall
quantityinsteel?
A.

Manganese

B.

Vanadium

C.

Cobalt

D.

Copper

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Acontrolleractioninwhichthereisacontinousrelationbetweenthevaluesofcontrolled
variableandtherateofchangeofconrolledoutputsignaliscalledthe__________
action.
A.

proportional

B.

integral

C.

derivative

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage8

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Anidealfluidis
A.

viscous&incompressible.

B.

nonviscous&compressible.

C.

nonviscous&incompressible.

D.

viscous&compressible.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Whendrybulbtemperature&wetbulbtemperatureofmoistairisthesame,itmeans
thatthe
A.

partialpressureofwatervapourislessthanthetotalpressure.

B.

humidityis<100%&dewpointtemperatureofairhasnotreached.

C.

dewpointtemperatureofairhasnotreached&airisnotsaturatedfully.

D.

airisfullysaturated.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage9

41. High__________ofcastironmakesitsuitableforuseinmachinebeds.
A.

compressivestrength

B.

endurancestrength

C.

dampingcapacity

D.

tensilestrength

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Whichofthefollowingalloyingelementsreducestheformationofironsulphideinsteel?
A.

Cobalt

B.

Nickel

C.

Manganese

D.

Vanadium

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Inagehardenablealloys,maximumductilityisobtained
A.

inascaststate.

B.

immediatelyaftersolutiontreatmentandsubsequentquenching.

C.

afteroptimumageing.

D.

afteroverageing.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage9

44. Prandtlmixinglengthinturbulentflowsignifiesthe
A.

averagedistanceperpendiculartothemeanflowcoveredbythemixingparticles.

B.

wavelengthcorrespondingtothelowestfrequencypresentintheflowfield.

C.

ratioofmeanfreepathtocharacteristiclengthoftheflowfield.

D.

magnitudeofturbulentkineticenergy.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Magnesiumadditiontocastironincreasesits
A.

corrosionresistance.

B.

creepstrength.

C.

ductilityandstrengthintension.

D.

hardness.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage10

46. ThedimensionsofPlanck'sconstantisthesameasthatofthe
A.

kineticenergy

B.

momentum

C.

electrostaticpotential

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. 1%concentrationofwatervaporinairisequivalentto__________ppm(partsper
million).
A.

10000

B.

1000

C.

100

D.

10

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Theratioofcoildiametertowirediameterofaspringiscalledthespring
A.

index

B.

deflection

C.

formcoefficient

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswersPage10

ViewAnswer

Workspace

Report

DiscussinForum

49. Theminimumtemperaturetowhichthewatercanbecooledinacoolingtoweristhe
__________temperatureofair.
A.

ambient

B.

drybulb

C.

dewpoint

D.

wetbulb

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Dialysisistheprocessofseparatingsubstancesinthe
A.

colloidalstatefromthosepresentinthetruesolutions.

B.

colloidalstatefromthosepresentinthesuspensions.

C.

suspensionfromthosepresentinthesolutions.

D.

noneofthese.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswers

1. Whichofthefollowingiscapableofactingbothasanacidfluxaswellasabasicfluxinthe
metalextractionfromitsore?
A.

Silica

B.

Lime

C.

Alumina

D.

Fluorite

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Whichisthemostsuitablejointforthepipes,witharelaidsubmergedunderwater,
wherethebottomoftheriverbedisuneven?
A.

Collarjoint

B.

Flexiblejoint

C.

Flangedjoint

D.

Expansionjoint

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Floatingcontrolaction
A.

movesthefinalcontrolelementatconstantspeedineitherdirectioninresponse
toanerrorsignal.

B.

changesthepositionofthefinalcontrolelementfromontooff.

C.

isusedtocounteractrapidloadchanges.

D.

noneofthese.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection23ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4. Boilerratingisnormallydoneintermsof
A.

steamtemperature&pressure.

B.

steamoutput(tons/hr).

C.

heattransferrate(kcal/hr).

D.

heattransferarea(m2).

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Thepressuredropperunitlengthforlaminarflowoffluidthroughalongpipeis
proportionalto(where,A=crosssectionalareaofthepipe&D=Diameterofthepipe)
A.

B.

C.

1/A

D.

1/A2

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescripti

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage2

6. Uptothecriticalradiusofinsulation,addedinsulation,will
A.

increasetheheatloss.

B.

decreaseheatlossandwillhavenoeffectbeyondthat.

C.

decreaseheatflux.

D.

reduceconvectionheatlosscomparedtoconductionheatless.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Limestoneisaddedintheblastfurnace(duringpigironmanufacture)to
A.

formslagbycombiningwithimpurities.

B.

supplyheatbyundergoingexothermicreactionwithimpurities.

C.

reducethecokeconsumption.

D.

reduceslagviscosity.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Cementiteisinthelamellarforminthe__________phaseofsteel.
A.

martensitic

B.

bainitic

C.

pearlitic

D.

ferritic

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage2

9. Toimprovethemachinabilityofsteel,itisgenerallysubjectedto
A.

spherodising

B.

tempering

C.

normalising

D.

annealing

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Siliconinsteel
A.

makesitusableinalmostallmagneticcircuitswherealternatingcurrentisused.

B.

increasesitselectricalresistivityanddecreasesthehysteresisloss.

C.

ispresentupto5%&4%respectivelywhenusedintransformers&motor
armatures.

D.

all'a','b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescripti

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage3

11. Dislocationsare__________defects.
A.

point

B.

line

C.

volume

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Thethicknessofoxidefilmisyattimet.IfK1,K2andK3arethetemperaturedependent
constants,theparaboliclawofoxidationisgivenby
A.

y2=2k1t+k2

B.

y=k1ln(k2t+k3)

C.

y=k1t+k2

D.

y=k1t3+k2

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Whichofthefollowinghastheleastvalueofultimatetensilestrength(UTS)?
A.

Mediumcarbonsteel

B.

Highcarbonsteel

C.

Castiron

D.

Wroughtiron

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage3

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Whichofthefollowingisacommonlyusedmanometricliquidforlowpressurerange?
A.

Ethylalcohol

B.

Carbontetrachloride

C.

Glycerol

D.

Ethyleneglycol

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Thehigheststressthatamaterialcanwithstandforaspecifiedlengthoftimewithout
excessivedeformationiscalledthe__________strength.
A.

creep

B.

endurance

C.

fatigue

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage4

16. Temperatureprofilealongthelengthofagasgascounterflowheatexchangeriscorrectly
representedby

A.

B.

C.

D.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Metalshotsusedinshotblastingaremadeof
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/3

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage4

A.

stellite

B.

steel

C.

bronze

D.

lead

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Atthepointofboundarylayerseparationinfluidflow,the
A.

shearstressismaximum.

B.

velocitygradientisflat.

C.

densityvariationismaximum.

D.

shearstressiszero.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. BrinellHardnessNumber(BHN)fortalcisapproximatelyintherangeof
A.

15

B.

2030

C.

100150

D.

200250

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Aspringmaterialshouldhavelow
A.

elasticlimit

B.

deflectionvalue

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/3

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage4

C.

fatigueresistance

D.

noneofthese

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

3/3

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage5

21. Specificgravityofametal,whichweighs5kginairand4kgwhensubmergedinwater,
willbe
A.

B.

1.25

C.

2.5

D.

3.75

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. WhichofthefollowingisanacidicconstituentofB.F.slag?
A.

SiO2

B.

FeO

C.

MgO

D.

CaO

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Alumina,silica,limeandironoxidearethebasicrawmaterialforthemanufactureof
portlandcement.ThecomponentofPortlandcementwhichfirsthardensis
A.

5CaO.3Al2O3

B.

3CaO.Al2O3

C.

3CaO.SiO2

D.

2CaO.SiO2

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage5

24. Materialofconstructionoftheelectrodeusedintheelectricresistanceweldingis
A.

stainlesssteel

B.

graphite

C.

copper

D.

steel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Inpractice,thecompressionratioofcompressionignition(CI)enginerangesfrom
A.

15to25

B.

5to10

C.

40to55

D.

60to70

Answer&Explanation

Answer:OptionA
Explanat

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage6

26. __________propertyofsteelincreasesbyadditionoflargeamountofsiliconinit.
A.

Mechanical

B.

Machining

C.

Magnetic

D.

Refractory

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. __________stresscannotbesustainedbyafluidinequilibrium.
A.

Shear

B.

Tensile

C.

Compressive

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. __________testcanbetermedasthesemidistructivetest.
A.

Impact

B.

Torsion

C.

Hardness

D.

Charpy

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Uniformrammingofsandingreensandmouldingprocessleadsto
A.

reducedchanceofgasporosity.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage6

B.

greaterdimensionalstabilityofthecasting.

C.

uniformflowofmoltenmetalintothemouldcavity.

D.

lesssandexpansiontypeofcastingdefect.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Theyieldpointphenomenonobservedinannealedlowcarbonsteelisduetothepresence
ofthefollowingelement.
A.

Silicon

B.

Carbon

C.

Phosphorous

D.

Chromium

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage7

31. Thenoblemetals
A.

areexemplifiedbyNa,KandLi.

B.

donotresistcorrosionverystrongly.

C.

arethelowermostintheelectrochemicalseriesofmetals.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Whichofthefollowingisanexampleofcathodicprotectionofmetalsagainstcorrosion?
A.

Paintedsteel

B.

Galvanisediron

C.

Casehardenedsteel

D.

Leadlinedreactor

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Thermalefficiencyofaninternalcombustionengineisaround__________percent.
A.

B.

35

C.

65

D.

80

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage7

34. Pickoutthecorrectcombinationabouttheroleofvariousadditivesusedinpolymers.
A.

Plasticiser:increasesthepolymerstrength.

B.

Heatstabiliser:increasesthemaximumservicetemperature.

C.

Fillers:Doesnotaffectthepropertyofpolymerbutincreasesitsweight.

D.

Lubricants:increasestheflexibilityofpolymers.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Thelightestnoninflammablegasis
A.

H2

B.

He

C.

Ar

D.

O2

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage8

36. Siliconcrystalcanbeconvertedtoptypesemiconductorbydopingwith
A.

phosphorous

B.

nitrogen

C.

carbon

D.

boron

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Largediameterreinforcedcementconcrete(RCC)pipesaregenerallyjoinedby
__________joint.
A.

flangediron

B.

collar

C.

flexible

D.

expansion

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Increaseintheentropyofasystemrepresentsthe
A.

degradationofenergy.

B.

decreaseinsystempressure.

C.

increaseintheavailabilityofenergy.

D.

increaseinthetemperature.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Propertyresponsibleforthetalcumpowdertoclingtotheskinisthe
A.

capillaryaction

B.

adhesion

C.

cohesion

D.

surfacetension

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. __________hasanegativecoefficientoflinearexpansion.
A.

Iron

B.

Copper

C.

Rubber

D.

Nickel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionav

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage9

41. WavelengthofXraysisabout1angstron,howeveritcannotpassthroughasheetof
A.

paper

B.

cloth

C.

lead

D.

aluminium

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. AlloyingelementspresentinHaynessstellite,whichhassuperiorperformancethanhigh
speedsteel,are
A.

nickel,cobalt&chromium.

B.

tungsten,chromium&cobalt.

C.

manganese,chromium&cobalt.

D.

tungsten,molybdenum&nickel.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. TheminimumandthemaximumnumberofmembersrequiredtoformaPrivateLimited
JointStockCompanyarerespectively
A.

7and30

B.

10and50

C.

2and50

D.

13and55

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage9

ViewAnswer

Workspace

Report

DiscussinForum

44. TheleachingsolventusedinBaeyer'sprocessforthepurificationofbauxiteis
A.

ammoniumhydroxide

B.

sodiumcarbonate

C.

sodiumhydroxide

D.

ammoniumcarbonate

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Austemperingprocessresultsintheformationof__________structure.
A.

martensitic

B.

bainitic

C.

carburised

D.

stressed

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage10

46. Volumeofblastfurnaceslagisabout__________timesthevolumeofhotmetal(pig
iron)ofthesameweight
A.

1.5

B.

C.

D.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Basicopenhearthfurnace(BOF)isnotusedforproducing__________steel.
A.

killed

B.

rimming

C.

highalloy

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. PrincipalalloyingelementinElinvar(usedformakinghairspringsforwatches)is
A.

copper

B.

aluminium

C.

nickel

D.

zinc

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Thevalueofy=cp/cv.at<500Cforair&mostcommongasescanbesafelyassumed
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswersPage10

tobe
A.

0.8

B.

C.

1.4

D.

1.8

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Teslametreperampere(T.m/A)istheunitforthemeasurementof
A.

magneticsucceptibility.

B.

magneticmoment.

C.

permeabilityoffreespace.

D.

fluxdensity.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

4/29/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswers

1. Thefunctionofneutralfluxusedinthepyrometallurgyofmetalextractionistoincrease
the__________oftheslag.
A.

fluidity

B.

basicity

C.

acidity

D.

viscosity

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Thethermodynamiclaw,PVy=constant,isnotfollowedbythe
A.

freeexpansionofanidealgas.

B.

adiabaticexpansionofsteaminturbine.

C.

adiabaticcompressionofair.

D.

idealcompressionofair.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Pickoutthewrongstatementaboutthemachinabilityofmetals.Machinabilityofametal
A.

decreaseswithincreaseinstrainhardeningtendencies.

B.

decreaseswithincreaseinhardness,ingeneral.

C.

dependsonthecomposition,microstructureandphysical&mechanicalproperties.

D.

decreaseswithincreasesintensilestrength&decreaseingrainsize.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20565px%3B%20color%3A%20rgb(0%2C%200%2

1/2

4/29/2015

ChemicalEngineeringBasicsSection24ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4. Therefrigerantfreon12ischemically
A.

CCl2F2

B.

CCl3F

C.

CClF3

D.

CCl4F

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Whichofthefollowingphenomenonwillexhibittheminimumheattransfer?
A.

Boiling.

B.

Forcedconvectioninair.

C.

Freeconvectioninair.

D.

Conductioninair.

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20565px%3B%20color%3A%20rgb(0%2C%200%2

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage2

6. Pickoutthecorrectstatement
A.

Jetenginecanwork,wherethereisnoatmosphere.

B.

Rocketenginescannotwork,wherethereisnoatmosphere.

C.

Rocketenginescarryoxygenrequiredforthecombustionintheformofoxidiser.

D.

Jetenginesalsocarryoxidiser.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Ammoniagascanbedriedby
A.

PCl5

B.

quicklime

C.

CaCl2

D.

concentratedH2SO4

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Consumableelectrodesareusedinthe__________welding.
A.

gas

B.

arc

C.

thermit

D.

resistance

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Magnesiumispresentin
A.

haemoglobin

B.

chlorophyll

C.

hyposolution

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Thepassagebetweenthenozzleandthe__________iscalled'sprue'incaseofinjection
moulding.
A.

runner

B.

cylinder

C.

mold

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage3

11. Theamountofdifferentsubstancesproduced,whenthesamequantityofelectricityis
passedthroughdifferentsolutionsareproportionaltotheir
A.

equivalentweight.

B.

(equivalentweight)2.

C.

molecularweight.

D.

(molecularweight)2.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Amaterialhavinggooddampingpropertyislikelytohave
A.

greaterdefectdensity.

B.

finegrainedstructure.

C.

lesserdefectdensity.

D.

hightensilestrength.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Exposureto__________accelaratesthedegradationofplastics.
A.

ultravioletradiation

B.

highatmospherictemperature

C.

highambienttemperature

D.

dampatmosphere

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage3

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Steelproducedfromphosphaticironis__________innature.
A.

malleable

B.

ductile

C.

brittle

D.

tough

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. __________istheprocessofcoatingthesurfaceofsteelwithaluminiumoxide,thereby
impartingitincreasedresistancetocorrosion&oxidationuptoatemperatureof700C.
A.

Vaneering

B.

Galvanising

C.

Electroplating

D.

Calorising

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage4

16. Whichofthefollowinghastheleastoiliness?
A.

Mineraloils

B.

Vegetableoils

C.

Greases

D.

Animaloils

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Surfacefinishofcastingdoesnotdependuponthe
A.

sandfineness.

B.

patternfinish.

C.

moulddressings.

D.

metaltemperature.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Loadcellsusedforthemeasurementofweighthas
A.

compact&ruggedconstructionwithanaccuracyof0.1to1%.

B.

nomovingpartsandincursnegligibledeflectionunderload.

C.

provisionofthermalcompensationandishermeticallysealed.

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage4

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

19. Whiletheoxyacetyleneflameproducesatemperatureof3200C,thetemperature
producedbyoxyhydrogenflameisabout__________C.
A.

1800

B.

2000

C.

2400

D.

3000

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. FortheStoke'slawtobevalidinthecaseofafallingsphereinafluid,the
A.

Reynoldsnumber(basedonspherediameter)shouldbe<1.

B.

flowaroundthesphereshouldbeinturbulentregion.

C.

spheremustbemetallic.

D.

fluiddensityshouldbeconstant.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage5

21. Coldchiesel&hammersaremadeof
A.

highspeedsteel

B.

highcarbonsteel

C.

forgedsteel

D.

mildsteel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Whichofthefollowingdoesnotlowerthesurfacetensionofliquids?
A.

Fat

B.

Soap

C.

Detergent

D.

Surfactant

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. __________propertyofamaterialisdeterminedbytheHerbertPendulumdevice.
A.

Hardness

B.

Tensile

C.

Toughness

D.

Compressive

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Cathodicprotectioniswidelyusedincontrollingcorrosionin
A.

highpressurevessels.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage5

B.

marinestructure&undergroundpipelines.

C.

overheadfuelgaspipelines.

D.

overheadwaterpipelines.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Methylorangeindicatorturns
A.

orangeyellowinalkalinemedium.

B.

orangeyellowinacidicmedium.

C.

colourlessinacidicmedium.

D.

colourlessinbasicmedium.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage6

26. Outofthefollowing,themostmelleablematerialis
A.

copper

B.

aluminium

C.

wroughtiron

D.

lead

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Additionofsilicontoaluminiumimprovesits
A.

corrosionresistance

B.

machinability

C.

castability

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Whichofthefollowingpropertiesofasolidisnotdependentoncrystalimperfection?
A.

Ductility

B.

Semiconductiyity

C.

Meltingpoint

D.

Yieldstress

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage6

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Inagoodrimmingsteel
A.

carbonandsiliconshouldbelow.

B.

siliconshouldbelowbutcarbonshouldbehigh.

C.

bothsilicon&carbonshouldbehigh.

D.

siliconshouldbehighbutcarbonshouldbelow.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. "'Dikes'arelowheightwallsmadearoundthestoragevesselsmeantforstoring
hazardous&inflammablematerial(e.g.,petroleumproducts).Volumeofdikesisequalto
(where,V=volumeofthestoragevessel)
A.

B.

V/2

C.

2V

D.

3V

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage7

31. Additionof__________tosteeldoesnothelpinimprovingitsmachinability.
A.

sulphur

B.

silicon

C.

lead

D.

phosphorous

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. Chalcopyriteisanoreof
A.

lead

B.

aluminium

C.

copper

D.

zinc

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Thefollowingisemployedassacrificialanodetoprovidecathodicprotectiontoships,
pipelinesandstoragetanks.
A.

Iron

B.

Copper

C.

Nickel

D.

Magnesium

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

34. Heattransferby__________isalmostabsentincaseoffluidisedbeddryingoperation.
A.

radiation

B.

conduction

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage7

C.

convection

D.

both(b)&(c)

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Increasingthecarboncontentofsteel
A.

reducestheuppershelfenergy.

B.

increasingtheductilitytransitiontemperature.

C.

decreasesbrittleness.

D.

decreaseshardness.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage8

36. __________metalisusedasabearinglinermaterial.
A.

Pewter

B.

White

C.

Babbit

D.

Gun

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Foranidealgas,CpCvis
A.

B.

C.

D.

(3/2)R

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Sandusedtostopthegreensandfromstickingtothepatternistermedasthe
__________sand.
A.

parting

B.

synthetic

C.

loam

D.

dry

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Brazingfillermetalusedforjoiningsteelplates
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage8

A.

meltsbelowthemeltingpointsofbasemetals.

B.

meltsbelow300C.

C.

iscopperphosphorousalloy.

D.

iscopper.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. Finegrainsizeinmetallicmaterialwill
A.

increasetheyieldstrength.

B.

increasethecreepstrength.

C.

increasethefatiguestrength.

D.

decreasetheimpactstrength.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage9

41. Electrometallurgicalmethodsofmetalextractionisnormallyusedforthosemetals
A.

whoseoxide/oreisnotreducedbycarbon.

B.

whichfallinthecategoryofalkali&alkalineearthmetals.

C.

whichstandshigherintheelectrochemicalseriesofthemetal.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Loweringofrecrystallisationtemperatureofmetalscanbeachievedbyits
A.

grainrefinement.

B.

purification.

C.

workingatlowertemperature.

D.

alla,b&c.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Anexampleofabuffersolutionis
A.

mercury

B.

limewater

C.

humanblood

D.

concentratednitricacid

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Asolidaluminiumball,whenquenchedinawaterbathmaintainedat40C,coolsdown
from550Cto450Cin20seconds.Theexpectedtemperatureoftheballafternext20
secondsmaybeabout__________C.
A.

370

B.

340

C.

320

D.

300

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Namethesafetydeviceusedtoprotecttheboiler,whenthewaterlevelfallsbelowa
minimumlevel.
A.

Blowdownvalve

B.

Blowoffcock

C.

Fusibleplug

D.

Safetyvalve

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage10

46. Coldchiesel'shammersaremadeof
A.

highspeedsteel

B.

highcarbonsteel

C.

forgedsteel

D.

mildsteel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. IntheXrayradiographytechnique,thetubevoltageforthickerplatesascomparedto
thinplates,shouldbe
A.

higher,asitgiveshigherwavelength.

B.

lower,asitgiveshigherwavelength.

C.

higher,asitgivesshorterwavelength.

D.

lower,asitgivesshorterwavelength.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Atomic__________isawholenumberforanelement.
A.

number

B.

weight

C.

radius

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Workrequiredforcompressionofagascontainedinacylinderis7000kJ.During
compression,heatinteractionof3000kJcausesthesurroundingstobeheated.Internal
energychangeofthegasduringthecompressionis__________kJ.
A.

+4000

B.

4000

C.

10000

D.

10000

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Highestcuttingspeedisachievedbythe__________toolmaterial.
A.

highspeedsteel

B.

carbide

C.

castalloy

D.

plaincarbonsteel

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswers

1. Earingisadefectfoundinsteelsafterthefollowingmetalworkingoperation(s).
A.

Deepdrawing

B.

Rolling

C.

Extrusion

D.

Wiredrawing

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Forasmallscaletoyfactory,thefixedcostpermonthisRs.5000/.Thevariablecostper
toyisRs.20andsalespriceisRs.30pertoy.Thebreakevenproductionpermonthwill
be__________toys.
A.

250

B.

500

C.

1000

D.

3000

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Hydrogencanbe
A.

usedinI.C.enginesasfuel.

B.

liquefied&storedundercryogenicconditions.

C.

producedbyelectrolysisofwater.

D.

all(a),(b)&(c).

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection25ChemicalEngineeringQuestionsandAnswers

ViewAnswer

Workspace

Report

DiscussinForum

4.
InternalenergyofagasobeyingVanderwall'sequationofstate,

dependsuponits
A.

pressure&temperature.

B.

pressure&specificvolume.

C.

temperature&specificvolume.

D.

temperatureonly.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. __________wireisneverusedformakingtheheatingelement.
A.

Nichrome

B.

Kanthal

C.

Invar

D.

Noneofthese

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage2

6. Incontinuouscastingprocess,graphitemouldsareusedwithaviewtoproviding
A.

heatresistingmedium.

B.

selflubricatingqualities.

C.

nonwettingsurfaces.

D.

chillingeffect.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Energyrequiredtocompressahotgasascomparedtocoldgaswillbe
A.

more.

B.

less.

C.

same.

D.

moreorlessdependinguponthenatureofthegas.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Inthecommercialproductionofwhichofthefollowingmetals,matallothermicreduction
isused?
A.

Copper

B.

Zinc

C.

Zirconium

D.

Nickel

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage2

ViewAnswer

Workspace

Report

DiscussinForum

9. Newwaterwellsaredisinfectedwithchlorineintheformof
A.

sodiumchloride

B.

sodiumhypochlorate

C.

bleachingpowder

D.

aluminiumchloride

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Inaboundarylayerdevelopedalongtheflow,thepressuredecreasesinthedownstream
direction.Theboundarylayerthicknessinthiscasewill
A.

decreasegradually.

B.

increasegradually.

C.

increaserapidly.

D.

remainconstant.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage3

11. Velocityofagasinsoundisnotproportionalto(where,T=Absolutetemperatureofthe
gas.P=Absolutepressureofthegas.y=Ratioofspecificheats(Cp/Cv)=specific
weightofthegas)
A.

B.

1/

C.

D.

1/

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Amateriallackingintoughnessisusuallytermedas
A.

plastic

B.

malleable

C.

brittle

D.

ductile

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Thebasicconstituentofvegetableoilsis
A.

triglyceride

B.

fattyacids

C.

fattyalcohol

D.

monoesters

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage3

ViewAnswer

Workspace

Report

DiscussinForum

14. Latentheatofdrysteamatatmosphericpressureis539Kcal/kgwhich__________
withincreaseinthepressureofsteam.
A.

decreases

B.

increases

C.

remainssame

D.

mayincreaseordecrease

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Whichofthefollowingterminologyisusedforthetemperatureatwhichnewgrainsare
formedinametal?
A.

Eutectictemperature.

B.

Lowercriticaltemperature.

C.

Recrystallisationtemperature.

D.

Uppercriticaltemperature.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage4

16. Whenatuningforkvibrates,thewavesproducedintheforkare
A.

stationary

B.

longitudinal

C.

progressive

D.

transverse

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Fatiguelimitofamaterialshouldnotbeincreasedby
A.

shotpeening

B.

surfacedecarburisation

C.

understressing

D.

coldworking

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Forafixedcrosssectionalarea,themosteconomicalchannelsectionhasmaximum
A.

wettedperimeter.

B.

fluiddischargerate.

C.

fluidvelocity.

D.

depthofflowingfluid.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage4

19. Pelletsarenotaspopularaburdenassinterintheironblastfurnace,becauseoftheir
A.

shape.

B.

swellingtendency.

C.

poorreducibility.

D.

lowmechanicalstrength.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Aformofstresscorrosionfailuretermedas'seasoncracking'isgenerallyobservedin
A.

thermosettingpolymers.

B.

highcarbonsteels.

C.

brasses.

D.

borosilicateglasses.

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage5

21. Amaterialsubjected__________musthavehighresilience.
A.

shockloading

B.

vibration

C.

fatigue

D.

tension

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Triplepointofwateris
A.

0F

B.

492R

C.

0K

D.

273C

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Soluteatomswhichcauseyieldpointphenomenoninmildsteelare/is
A.

aluminium

B.

boron

C.

carbon

D.

nitrogen

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. __________pipeisthemostsuitableforcarryingsanitarydrainage.
A.

stainlesssteel

B.

Reinforcedcementconcrete

C.

Castiron

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage5

D.

Asbestoscement

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Liquorpoisoninggenerallyoccursduetothepresenceof__________init.
A.

ethylalcohol

B.

impurities

C.

methylalcohol

D.

carbonicacid

Answer&Explanation

Answer:OptionC

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage6

26. Pickoutthewrongstatement.
A.

Ductilefractureofastressedmaterial,whichexhibitsalargeplasticdeformationis
commonlycausedbytheformationandcoalescenceofvoidsintheneckedregion.

B.

Brittlefractureiscausedbythepropagationofpreexistingcracksinthematerial
andinvolvesminimumplasticdeformation.

C.

Fatiguefractureofamaterialisalwaysbrittleinnatureandtakesplaceduetothe
existenceoflineimperfections.

D.

Brittlematerialsaregenerallytestedintension.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Morethan95%of__________ispresentincorrundum.
A.

SiO2

B.

A1 2O3

C.

CaSiO2

D.

MgO

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Blowoffcockisprovidedinsteamboilerto
A.

guardtheboilerincaseofabnormalriseinsteampressure.

B.

drainoutwaterandsludgeduringitsrepair.

C.

regulatethesupplyofwaterinboiler.

D.

putoutthefireinthefurnacewhenthewaterlevelintheboilerfallstounsafe
limit.

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage6

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Workhardeningofamaterial
A.

decreasesitstensilestrength.

B.

decreasesitsductility.

C.

increasesitsductility.

D.

doesnotaffectitsductility.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Blastingoftrinitrotoluene(TNT)isdonebymixingitwithammonium
A.

nitrate

B.

sulphate

C.

carbonate

D.

chloride

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage7

31. Thermitweldingiscategorisedasthe__________welding.
A.

forge

B.

fusion

C.

resistance

D.

arc

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. AgashavinganegativeJouleThompsoncoefficient,whenthrottled,will
A.

becomehotter.

B.

becomecooler.

C.

remainunchanged.

D.

liquefy.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Annealingofmetaldoesnot
A.

precedeitswiredrawing.

B.

inducesoftnessandremovesstresses&dissolvedgases.

C.

refinethecrystallinestructure&produceadefinitemicrostructure.

D.

altertoughness,ductilityandmagnetic&electricalorotherphysicalproperties.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage7

34. Whichofthefollowingisacommonconstituentofbothpaintandoilvarnish?
A.

Extender

B.

Pigment

C.

Thinner

D.

Dryingoil

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Lithiumisausefulalloyingadditiontoaluminium,becauseit
A.

ischeap.

B.

impartssolidsolutionstrengthening.

C.

lowersdensityandcontributestoagehardening.

D.

improvesthecorrosionresistanceofaluminium.

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage8

36. Whichofthefollowingrepresentsthecorrecttimetemperaturecurvewhenablockof
metalisheatedaboveroomtemperature&thenlefttocoolintheroomfollowing
Newton'slawofcoolinginwhichtherateoftemperaturedropwillgoondecreasingwith
thepassageoftime.

A.

B.

C.

D.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Pickoutthewrongstatementaboutcoating/electroplatingofmetals.
A.

Phosphatecoatingisusedasanexcellentbaseforpaints&enamels.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/3

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage8

B.

Phosphatecoatingislesscorrosionresistantthanchromatecoating.

C.

Thebasemetaltobeelectroplatedisnormallymadethecathodeoftheelectrolytic
cellandcoatingmetalismadetheanode.

D.

Calorisingistheprocessofcoatingsteelwithchromium.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Incaseofa,centrifugalpump,theratioh 1/h 2istermedasthe__________efficiency


(where,h 1=actualmeasuredhead&h 2=headimpartedtothefluidbyimpeller).
A.

mechanical

B.

overall

C.

volumetric

D.

impeller

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

39. Brinellhardnessnumber(BHN)ofamaterialisanumber,whichhas
A.

nodimension.

B.

unitoflength.

C.

unityofforce/area.

D.

unitofforce/length.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/3

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage8

40. Vanadiumadditiontosteelimprovesits
A.

hightemperatureoxidationresistance.

B.

fatiguestrength.

C.

heattreatabilitybyquenching.

D.

hardenability.

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

3/3

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage9

41. PlantsproducecarbohydratesfromtheCO2presentintheatmosphereby
A.

polymerisation.

B.

photochemicalreaction.

C.

oxidation.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Identifythecorrectstatementwithreferencetotheextractivemetallurgyofaluminium.
A.

TheelectrolyteconsistsofmoltenNa3AlF6withapproximately1to8%Al2O3.

B.

Approximately80%ofthealuminiumdepositedonthecathodecomesfrom
cryolite.

C.

Sodiumisdepositedalongwithaluminium,butisimmediatelyvaporised.

D.

Anodeeffectsetsinwhenthecryoliteconcentrationgoesbelow40%.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. AparticleissettlinginaliquidunderStokesianconditions.Thefreefallingvelocityofthe
particleisproportionalto
A.

particlediameter

B.

particlediameter

C.

(particlediameter)2

D.

(particlediameter)3

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage9

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Whichofthefollowingisnotusedasanalloyingelementinsteelusedformaking
permanentmagneticmaterial?
A.

Tungsten

B.

Chromium

C.

Vanadium

D.

Cobalt

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Pickoutthewrongstatement.
A.

Geothermalenergyisanonconventionalsourceofenergy.

B.

Massisconvertedintoenergyinbothnuclearfission&fusionreaction.

C.

Inhalationofmercuryvapourisnotharmfulforhumanbeings.

D.

Inhalationofarseniccausescancer.

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage10

46. Thefatigueresistanceofamaterialisimprovedbythefollowingtechnique.
A.

Anodising

B.

Carburising

C.

Ionnitriding

D.

Shotpeening

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Increaseintemperature,ingeneralresultsinthe
A.

decreaseintheviscositiesofbothliquids&gases.

B.

increaseintheviscositiesofbothliquids&gases.

C.

increaseintheviscosityofliquidsanddecreaseinthatofgases.

D.

decreaseintheviscosityofliquidsandincreaseinthatofgases.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Whichofthefollowingcanbemanufacturedusingpowdermetallurgytechniques?
A.

Brakelinings

B.

Bearings

C.

Carbidetooltips

D.

All'a','b'and'c'.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. Removalofnoncondensablesfromsteamorothervapouristermedasthe__________
process.
A.

condensation

B.

dearation

C.

scavanging

D.

exhaust

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Coldheadingorupsettingiscategorisedasthe__________process.
A.

extrusion

B.

bending

C.

rolling

D.

forging

Answer&Explanation

Answer:OptionD

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswers

1. Tinplatedironandgalvanisedironaregenerallyproducedby
A.

vaporising

B.

hotdipping

C.

electroplating

D.

spraying

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Inadrillingprocess,themetalisremovedbybothshearing&extrusion.Generalpurpose
drillsaremadeof
A.

stainlesssteel

B.

mildsteel

C.

highspeedsteel

D.

highcarbonsteel

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Dezincificationisaformofcorrosionespeciallyapplicableto
A.

brass

B.

nichrome

C.

stainlesssteel

D.

monel

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection26ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Whichofthefollowingmaterialsisnotsuitableasadiematerialforwiredrawing?
A.

Diamond

B.

Tungstencarbide

C.

Toolsteel

D.

Bronze

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. ByXraydiffraction,itisnotpossibletodeterminethe
A.

preferredorientation.

B.

residuallocalisedstresses.

C.

particlesize.

D.

orderedarrangementofmagneticmoments.

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage2

6. Mildsteelhas__________crystallatticestructure.
A.

facecentredcubic(fcc)

B.

bodycentredcubic(bcc)

C.

orthorhombic

D.

cubic

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Whichofthefollowingdoesnothaveasharpmeltingpoint?
A.

Thoria

B.

Glass

C.

Ice

D.

Pigiron

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Aluminiumisextractedfrom
A.

chalcocite

B.

bauxite

C.

galena

D.

noneofthese

Answer&Explanation

Answer:OptionB
Explanation:
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage2

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. __________fluidforceisnotconsideredintheNavierStokesequation.
A.

Turbulent

B.

Viscous

C.

Gravity

D.

Pressure

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Whatisthevalueofentropyat273K?
A.

B.

C.

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage3

11. Tinisnotpresentasanalloyingelementin
A.

phosphorbronze

B.

gunmetal

C.

fusiblemetal

D.

whitemetal

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Thermitweldingusesthefollowingenergysource.
A.

Electricalenergy.

B.

Chemicalenergy.

C.

Energyofhighvelocityelectrons.

D.

Heatgeneratedbyfriction.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Thefrictionfactorfortheturbulentfluidflowinaroughpipedoesnotdependuponthe
A.

piperoughness&pipediameter.

B.

fluidvelocity.

C.

typeofflowingfluid.

D.

both'b'&'c'.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage3

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

14. Fluegasespassthroughthefollowingboileraccessoriesinahighpressurenatural
circulationboiler.
A.InduceddraftfanB.EconomiserC.AirpreheaterD.Steamsuperheater
Whichofthefollowinggivesthecorrectsequenceofflowofthefluegasesthroughthe
abovementionedboileraccessories?
A.

A,C,B,D

B.

D,B,C,A

C.

D,C,B,A

D.

D,A,B,C

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. Casehardeningofamaterialis
A.

followedbytemperingorcarburising.

B.

precededbyitstempering.

C.

donetogetasoftductileinteriorwithaveryhardsurface.

D.

carriedouttogetextremehardnessinitscore.

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage4

16. ThedifferenceinoneunitofRockwellhardnessnumbercorrespondstoadifferenceinthe
depthofindentationof__________mm.
A.

0.001

B.

0.01

C.

0.002

D.

0.02

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Steelballsaremanufacturedby
A.

sintering

B.

casting

C.

coldheading

D.

spinning

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. __________temperatureremainsconstantduringadiabaticsaturationprocessof
unsaturatedair.
A.

Dewpoint

B.

Drybulb

C.

Wetbulb

D.

Noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage4

ViewAnswer

Workspace

Report

DiscussinForum

19. Thebestlubricantsforamachineworkingathightemperature&loadis
A.

grease

B.

solidlubricant

C.

animaloils

D.

mineraloils

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Onefaceofafurnacewallisat1030Candtheotherfaceisexposedtoroom
temperature(30C).Ifthethermalconductivityoffurnacewallis3W.m1.k1andthe
wallthicknessis0.3m,themaximumheatloss(inW/m)is
A.

100

B.

900

C.

9000

D.

10000

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage5

21. RungaKuttamethodisusedtosolvea/an
A.

ordinarydifferentialequationofnthorder.

B.

simultaneousnonlinearequation.

C.

lineardifferentialequation.

D.

noneofthese.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Recrystallisationtemperatureofsteelis__________C.
A.

50

B.

300

C.

500

D.

800

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Pressurerequiredtoincreasethedensityofwaterbyabout1%is__________
atmosphere.
A.

10

B.

50

C.

200

D.

1000

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

24. Eliminationofbrittlenessresultingfromweldingofsawbladesisdoneby__________of
data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage5

theweldedportion.
A.

annealing

B.

toughening

C.

workhardening

D.

tempering

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

25. Themaximumstressbelowwhichamaterialcanwithstandaninfinitenumberofcycleof
stress,istermedasthe
A.

fatiguestrength

B.

creepstrength

C.

resilience

D.

endurancelimit

Answer&Explanation

Answer:OptionD
Explanation:

data:text/htmlcharset=utf8,%3Ctable%20cellspacing%3D%220%22%20cellpadding%3D%220%22%20border%3D%220%22%20style%3D%22fontfamily%3

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage6

26. Thebestguidetojudgethegeneralqualityofwateristhemeasurementofits
A.

pHvalue.

B.

electricalconductivity.

C.

turbidity.

D.

dissolvedoxygencontent.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

27. Wroughtironisnot
A.

ductile&resistanttocorrosion/rusting.

B.

weldableeasily.

C.

havinguniformstrengthinalldirections.

D.

havingmaximumtensilestrengthalongthelinesofslagdistribution.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

28. Whichofthefollowingisthelargestquantumofpressure?
A.

1kg/cm2

B.

1bar

C.

1atmosphere

D.

1kiloPascal

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%22%3E%3Ctable%2

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage6

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

29. Whichofthefollowingisnotachargematerialforcupola?
A.

Limestone

B.

Ironscrap

C.

Ironore

D.

Pigiron

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

30. Whichofthefollowingisanundesirablepropertyofslagproducedduringthe
pyrometallurgicalmethodofmetalextractionfromitsore?
A.

Highfusibility&fluidity.

B.

Highthermalconductivity.

C.

Lowdensity.

D.

Highchemicalactivity.

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%22%3E%3Ctable%2

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage7

31. In__________process,ionsofsaltsreactwithwatertoproduceacidityoralkalinity.
A.

hydration

B.

hydrolysis

C.

electrolysis

D.

dialysis

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

32. __________isusedfortyingthesteelcoloumnstoconcretefoundation.
A.

Grouting

B.

Eyebolt

C.

Anchorbolts

D.

Refractorycastables

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

33. Fatigueresistanceofamaterialismeasuredbythe
A.

elasticlimit.

B.

ultimatetensilestrength.

C.

Young'smodulus.

D.

endurancelimit.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage7

34. __________isthetradenameassignedtoanonferrouscastalloycomposedofcobalt,
chromium&tungsten.
A.

Stellite

B.

Highspeedsteel

C.

Cermet

D.

Alnico

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

35. Adensestructureofgrindingwheelisnotusedforthe
A.

ductilematerial.

B.

hardmaterials.

C.

brittlematerials.

D.

finishingcuts.

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage8

36. Whichofthefollowingisnotaprincipalalloyingelementforthestructuralsteel?
A.

Molybednum

B.

Nickel

C.

Manganese

D.

Chromium

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

37. Metalloids
A.

aregoodconductorofheat&electricity.

B.

actaselectrondonorswithmetals&aselectronacceptorwithnonmetals.

C.

arenotnecessarilysolidsatroomtemperature.

D.

arecompoundsthatexhibitbothmetallic&nonmetallicpropertiestosome
extentandareexemplifiedbyelementslikegermanium,silicon&boron.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

38. Pickoutthewrongstatement
A.

Processingofthemosettingplasticsisideallydonebyinjectionmoulding.

B.

Processingofthermoplasticsisideallydonebycompressionmoulding.

C.

Massproductionofseamlesspipesaredonebyelectricalresistancewelding(ERW).

D.

Stretchformingisaprocessofcolddrawing.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage8

ViewAnswer

Workspace

Report

DiscussinForum

39. Leadispouredintothejointsbetweentwo__________pipes.
A.

castiron

B.

steel

C.

concrete

D.

plastic

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

40. 'Icepoint'isdesignatedonFarenhitetemperaturescaleby
A.

B.

32

C.

62

D.

212

Answer&Explanation

Answer:OptionB
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage9

41. Maximumhardenabilityofsteeldependsuponits
A.

chemicalcomposition

B.

carboncontent

C.

grainsize

D.

alloyingelementscontent

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

42. Blastfurnaceslagismainlymolten
A.

sand

B.

magnesiumsilicate

C.

calciumsilicate

D.

ironpyrite

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

43. Ajetengineturbinebladeisnormallymanufacturedby
A.

forging.

B.

shellmoulding.

C.

investmentcasting.

D.

pressurediecasting.

Answer&Explanation

Answer:OptionC
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage9

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

44. Stainlesssteelisweldedusing
A.

oxyacetyleneflame.

B.

oxyhydrogenflame.

C.

arcwelding.

D.

inertgasarcwelding.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

45. Thecoolingraterequiredtofreeze1tonofwaterat0Cintoiceat0Cin24hoursis
__________BTU/hr.
A.

100

B.

200

C.

1000

D.

2000

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage10

46. Thephenomenonoccurringduringexplosionofahydrogenbombis
A.

nuclearfission.

B.

nuclearfusion.

C.

acombinationofbothnuclearfission&fusion.

D.

noneofthese.

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

47. Squaresteelkeyisnormallystronginfailurebyshear&crushing.Keysarenormally
madeof__________steelbars.
A.

hotrolledmild

B.

coldrolledmild

C.

forged

D.

machinablestainless

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

48. Nitridingofasteelpartdoesnotincreaseits
A.

grainsize.

B.

fatiguelimit.

C.

surfacehardness.

D.

wearresistance.

Answer&Explanation

Answer:OptionA
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswersPage10

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

49. __________ofgreycastironproduceswhitecastiron.
A.

Tempering

B.

Rapidheating

C.

Rapidcooling

D.

Slowcooling

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

50. Asthefluidflowrateincreases,thefloatoftherotameter
A.

risesinthetube.

B.

rotatesathigherspeed.

C.

rotatesatlowerspeed.

D.

dropsdowninthetube.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswers

1. Titaniumisaddedtomoltenaluminiumalloysbeforecastingforthepurposeof
A.

grainrefinement.

B.

increasingcorrosionresistance.

C.

reducingporosity.

D.

improvingfluidity.

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Cementedcarbidetoolsarenotsuitableforcutting
A.

aluminium

B.

brass

C.

castiron

D.

steel

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Thedifferencebetweengross&netcalorificvaluesoffuelisduetothe
A.

sensibleheatcarriedawaybythefluegases.

B.

heatcarriedawaybythesteamfromthemoisturecontentofthefuel.

C.

heatlostbyradiation.

D.

heatcarriedawaybysteamfromthecombustionofhydrogeninthefuel.

Answer&Explanation

Answer:OptionD
Explanation:
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

29/04/2015

ChemicalEngineeringBasicsSection27ChemicalEngineeringQuestionsandAnswers

Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

4. Whichofthefollowingispreferredforrivetting?
A.

Lapjoint

B.

Buttjoint

C.

Either(a)or(b)

D.

Neither(a)nor(b)

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Heatingthehypoeutectoidsteelsto30Cabovetheuppercriticaltemperatureline,
soakingatthattemperatureandthencoolingslowlytotheroomtemperaturetoforma
pearlite&ferritestructureiscalled
A.

tempering

B.

hardening

C.

annealing

D.

normalising

Answer&Explanation

Answer:OptionC
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage2

6. Outofthefollowing,whichwillfracturemostreadity,whenhitwithahardhammer?
A.

Brass

B.

Bronze

C.

Germansilver

D.

Castiron

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

7. Apycnometerisusedforthemeasurementof
A.

flowrateofmoltenmetal.

B.

specificgravityofaliquid.

C.

compositionofalloys.

D.

concentrationofasolution.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

8. Forinfiniteparallelplaneshavingemissivities1&2,theinterchangefactorforradiation
fromsurface1tosurface2isgivenby
A.

(1+2)/1.2

B.

1.2/(1+21.2)

C.

1.2

D.

1+2

Answer&Explanation

Answer:OptionB
data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage2

Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

9. Workingoflinearvariabledifferentialtransducer(LVDT)isbasedontheprincipleof
variable
A.

capacitance

B.

resistance

C.

mutualinductance

D.

noneofthese

Answer&Explanation

Answer:OptionC
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

10. Ahighlyelasticmaterialisdeformedleastonloadingandretainsitsoriginalformon
removaloftheload.Whichofthefollowingisthemostelasticmaterial?
A.

Steel

B.

Glass

C.

Rubber

D.

Brass

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage3

11. Maximumpermissiblesulphurcontentinsteelis__________percent.
A.

0.015

B.

0.055

C.

0.505

D.

0.805

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

12. Thedimensionalformulaofbulkmodulusofelasticityissameasthatofthe
A.

pressure

B.

density

C.

force

D.

noneofthese

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

13. Ferromagneticmaterialowetheirpropertiesto__________innersubshells.
A.

completelyfilled

B.

partiallyfilled

C.

equallyfilled

D.

vacant

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage3

14. Whichofthefollowingmetalsisthemostpronetoworkhardening?
A.

Brass

B.

Aluminium

C.

Copper

D.

Lead

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

15. 'Amortization'inrespectoffinancialobligationofacompanymeansthe
A.

liquidationoffinancialobligationsoninstalmentbasis.

B.

commitmentoffinancialobligationonpriority.

C.

liquidationofalltheobsoleteequipmentsofthecompany.

D.

modernisationoftheplantequipments.

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage4

16. Differenceatanyinstantbetweenthevalueofthecontrolledvariableandthesetpointis
calledthe
A.

deviation

B.

derivativetime

C.

errorratio

D.

differentialgap

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

17. Theexpectedefficiencyofasinglerivettedlapjointisoftheorderof50%.Ifthe
thicknessoftheplateisincreasedfourtimes,thentherivetdiameterwillhavetobe
increased__________times.
A.

two

B.

four

C.

six

D.

eight

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

18. Nickeland__________arethealloyingelementaddedinsteeltoincreaseitstoughness.
A.

molybdenum

B.

chromium

C.

vanadium

D.

silicon

Answer&Explanation

Answer:OptionD
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage4

19. Whichofthefollowingequipmentsisusedforliquiddispersion?
A.

Packedcolumn

B.

Venturiscrubber

C.

Bubblecapplatecolumn

D.

Wettedwallcolumn

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

20. Eutectoidcompositionofcarbonsteelatroomtemperatureis
A.

cementite

B.

pearlite

C.

martensite

D.

ferrite

Answer&Explanation

Answer:OptionB

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswersPage5

21. Midrexprocessofspongeironproductionusesreformednaturalgasasthereducing
agent,whichusesironoreintheformof
A.

lumps

B.

pellets

C.

briquettes

D.

sinter

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

22. Corrosionis
A.

aphysicalphenomenon.

B.

achemicalphenomenon.

C.

sameaserosion.

D.

anuncontrollablephenomenon.

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

23. Whichofthefollowingisnotanoreofcopper?
A.

Cryolite

B.

Azurite

C.

Chalcopyrite

D.

Malachite

Answer&Explanation

Answer:OptionA

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/1

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswers

1. Additionof__________tosteeldoesnotimparthardness.
A.

nickel

B.

copper

C.

chromium

D.

silicon

Answer&Explanation

Answer:OptionB
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

2. Foraspontaneousnaturalprocessatconstanttemperatureandpressure,thefreeenergy
ofthesystemalways
A.

increases.

B.

decreases.

C.

remainsconstant.

D.

increasestoamaximumbeforedecreasing.

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

3. Inertialforcesareobtained,whentheelasticforcesaremultipliedby__________
number.
A.

Mach

B.

Froude

C.

Reynolds

D.

Euler

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

1/2

30/04/2015

ChemicalEngineeringBasicsSection28ChemicalEngineeringQuestionsandAnswers

4. Temperatureofhotgasesflowinginapipeismeasuredbyathermocoupleinsertedinthe
thermalwell.Thethermalwellmadeof__________willfacilitatethemostaccurate
measurementofthetemperature.
A.

copper

B.

steel

C.

aluminium

D.

brass

Answer&Explanation

Answer:OptionA
Explanation:
Noanswerdescriptionavailableforthisquestion.Letusdiscuss.

ViewAnswer

Workspace

Report

DiscussinForum

5. Wavelengthofradiationemittedbyabodydependsonthe__________ofitssurface.
A.

temperature

B.

area

C.

nature

D.

all'a','b'&'c'

Answer&Explanation

Answer:OptionA
Explanation:

data:text/htmlcharset=utf8,%3Cdiv%20class%3D%22bixdivcontainer%22%20style%3D%22width%3A%20564.799987792969px%3B%20color%3A%20rgb(

2/2