Вы находитесь на странице: 1из 446

Proyecto de Desarrollo de la

Industria de las Tecnologas de la


Informacin

Fortalecimiento y desarrollo de capacidades


de empresas en materia de comercio
electrnico y las TI"

Curso Introductorio al Comercio Electrnico

Interiores.indd 1

5/9/13 6:28 PM

Interiores.indd 2

5/9/13 6:28 PM

NDICE
__________________________________
I. Plan de trabajo
II. Investigacin inicial y diagnstico de necesidades
III. Diseo instruccional
a. Temario
b. Lecciones 1-20 (Plan de leccin, Contenido, Ejercicios de prctica)
IV. Creacin y transformacin de contenido didctico a video
a. URL
b. Explicacin de los componentes de la plataforma educativa Mayahii
V. Reporte final
a. Resultados, recomendaciones y generacin de estadstica
Anexo I. Contenido didctico en video

Interiores.indd 3

5/9/13 6:28 PM

Interiores.indd 5

5/15/13 1:24 PM

I. Plan de Trabajo
Interiores.indd 4

5/9/13 6:28 PM

Interiores.indd 5

5/9/13 6:28 PM

El presente proyecto comprende el desarrollo de los contenidos de capacitacin en


materia de comercio electrnico para las empresas mexicanas, a fin de fomentar la
incorporacin a las prcticas nacionales de los empresarios los modelos ms eficientes
en el desarrollo del comercio y la economa digital y as se sienten las bases para
generar un mayor desarrollo econmico y competitivo en el pas.
I. Objetivo general
Generar los contenidos de capacitacin para empresas en los temas de comercio
electrnico, as como tambin los mensajes clave para el sector empresarial, a fin
de promover su uso y aprovechamiento.
II. Objetivos especficos
1. Generar los contenidos de capacitacin para empresas en los temas de
comercio electrnico, incluyendo al menos los temas de ventajas del ecommerce, contrataciones electrnicas, proteccin de datos personales,
firma electrnica, factura electrnica, certificados digitales, propiedad
intelectual, proteccin al consumidor, seguridad de la informacin y delitos
informticos.
2. Generar los mensajes clave para el sector empresarial a fin de promover y
generar los materiales de difusin que contemplen los beneficios y
caractersticas de implementacin del comercio electrnico.
A continuacin se presenta el plan de trabajo a seguir, as como el cronograma de
actividades detallando el trabajo semanal, de acuerdo al tiempo estimado de duracin
del proyecto y respetando los tiempo de entrega establecidos.

Interiores.indd 6

5/9/13 6:28 PM

Plan de trabajo
I. Planeacin
a. Establecer el plan de trabajo: Desglosar las actividades a realizar para el
logro de los objetivos establecidos, as como el cronograma a seguir de
acuerdo a los tiempo establecidos en los Trminos de Referencia.
II. Marco Terico
a. Revisin de la bibliografa: Reunir y consultar una variedad de fuentes
acadmicas (libros, artculos y publicaciones diversas) que permitan
fundamentar los temas que se desarrollarn en el programa.
b. Anlisis de principios relacionados al comercio electrnico: Analizar y
explicar los distintos principios relacionados al comercio electrnico que
se incorporarn al programa con el fin de fundamentarlo y establecer su
enfoque.
c. Anlisis conceptual de elementos principales: Definir los distintos
conceptos relacionados al comercio electrnico con el fin de establecer
las bases para el programa de capacitacin.
d. Desarrollo de mensajes clave: Analizar la situacin actual del e-commerce
en Mxico y, a partir de esta, especificar los mensajes clave necesarios
para fomentar su incorporacin en las prcticas de las empresas
mexicanas.
e. Copia final marco terico: Con base a la revisin de la bibliografa, reunir
los incisos b,c y d en un marco terico que permita fundamentar los
principios bajo los cuales se desarrollar el programa de capacitacin.
III. Diseo Instruccional
a. Definir objetivo general: Establecer el objetivo general que determinar el
resultado final que se pretende obtener a travs del programa de
capacitacin.
b. Definir objetivos especficos: Desglosar el objetivo general en objetivos
especficos, que permitan establecer el avance que debe darse a lo largo
de la capacitacin para lograr el objetivo general.
c. Organizacin de contenidos: Enlistar los temas y subtemas que se
desarrollarn en la capacitacin, atendiendo al objetivo general y los
objetivos especficos.
d. Desarrollo de contenidos (planes de leccin): Desarrollar los contenidos
para cada una de las lecciones (cada leccin corresponder a un video).
El plan de leccin contendr el objetivo especfico de la leccin, el
esquema de los temas de la leccin y el contenido relacionado a stos.
e. Copia final del diseo instruccional: Reunir el esquema general de los
temas y subtemas, el objetivo general y especficos, as como cada una
de los planes de leccin (con su objetivo y contenido correspondiente).

Interiores.indd 7

5/9/13 6:28 PM

IV. Produccin de videos


a. Proceso de pre-produccin: Seleccionar a actores que participarn en los
videos, prepararlos para la grabacin de las cpsulas, seleccionar fondos
y escenografas adecuadas.
b. Grabacin: Coordinar a la empresa productora en la grabacin de las
cpsulas.
c. Edicin y post-produccin: Coordinar a la empresa productora en el
proceso de edicin y post-produccin (seleccin de material, subtitulado,
elementos audiovisuales, efectos especiales, aplicacin de fondos, etc.).
d. Videos editados: 10 horas de video en aproximadamente 20 lecciones de
30 minutos cada una.

V. Reporte Final
a. Habilitacin del curso en la plataforma: Dar acceso al curso que estar
disponible en la plataforma de Mayahii.
b. Recomendaciones y anlisis de implementacin: Desarrollar una serie de
recomendaciones para obtener una participacin ptima y que al
implementar el curso se logren los objetivos instruccionales propuestos.
c. Indicadores analticos: Dar acceso a los indicadores que permitan
conocer el nmero de visitas, el cumplimiento y avance de los usuarios
del curso.
d. Copia final de reporte final: Reunir las recomendaciones para la
implementacin en un reporte final. Este tambin mencionar los
indicadores analticos disponibles en la plataforma.

Interiores.indd 8

5/9/13 6:28 PM

Cronograma de Actividades
Semana:

10

11

12

13

14

15

16

Tarea:
1. FASE PLANEACIN
Establecer plan
de trabajo
2. MARCO TERICO
Revisin de la
bibliografa
Anlisis de
principios
relacionados al
comercio
electrnico
Anlisis
conceptual de
elementos
principales
Desarrollo de
mensajes clave
Copia final Marco
Terico
3. DISEO INSTRUCCIONAL
Definir objetivo
general
Definir objetivos
especficos
Organizacin de
contenidos
Desarrollo de
contenidos
(planes de
leccin)
Copia final Diseo
Instruccional

Interiores.indd 9

5/9/13 6:28 PM

4. PRODUCCIN DE VIDEOS Y HABILITACIN DEL CURSO


Pre-Produccin
Grabacin
Edicin y PostProduccin
Videos editados
Habilitacin del
curso en la
plataforma
6. REPORTE FINAL
Resultados del
proyecto
Recomendaciones
y anlisis de
implementacin
Indicadores
analticos
Copia final
Reporte Final

Interiores.indd 10

5/9/13 6:28 PM

Interiores.indd 5

5/15/13 1:24 PM

Interiores.indd 11

5/9/13 6:28 PM

II. Investigacin Inicial y


Diagnstico de Necesidades

Interiores.indd 12

5/9/13 6:29 PM

NDICE

1. Qu es el comercio electrnico?
1.1. Definicin..3
1.2. Ventajas del e-commerce...5

2. Componentes del comercio electrnico


2.1. El Internet..7
2.2. Creando una presencia en lnea...9
2.2.1. Enfoque sistmico....9
2.2.2. Infraestructura tecnolgica de un sitio web13
2.2.3. Elementos clave en un sitio web de comercio electrnico...15
2.2.3.1.

Catlogo en lnea

2.2.3.2.

Carrito de compra y One click payment

2.2.3.3.

Procesamiento de pagos

2.2.3.4.

Envos

2.2.3.5.

Sistema de Inventario

2.2.3.6.

Atencin al consumidor

2.3. Medios de pago.....18


2.3.1. Formas de pago..18
2.3.2. Contracargos21
2.3.3. Contrataciones electrnicas..22
2.3.4. Factura electrnica.23
2.4. Seguridad24
2.4.1. Seguridad de la informacin y delitos informticos..24
2.4.2. Firma electrnica.25
2.4.3. Certificados digitales..27
2.4.4. Proteccin al consumidor..27
2.4.5. Proteccin de datos personales..28
2.5. Modelos de Negocio en lnea..30
2.5.1. B2C31

Interiores.indd 13



5/9/13 6:29 PM

2.5.2. B2B32
2.5.3. Otros (P2P,C2C).33
2.6. Online marketing33
2.6.1. El consumidor..34
2.6.2. Publicidad en lnea.34
2.6.3. Redes sociales y comunidades en lnea.36
2.6.4. Tecnologa de marketing y Data mining.37
2.7. Leyes y tica en el comercio electrnico...38
2.7.1. Privacidad y Proteccin de datos personales38
2.7.2. Propiedad intelectual..39

3. Mxico y el comercio electrnico


3.1. Situacin actual en Mxico..41
3.2. Mensajes clave para el sector empresarial mexicano.44

4. Referencias...46

Interiores.indd 14



5/9/13 6:29 PM

1. Qu es el comercio electrnico?
Definicin

El comercio electrnico es definido por la Asociacin Mexicana de Internet (AMIPCI)


como el intercambio de bienes y servicios realizado a travs de las Tecnologas de la
Informacin y las Comunicaciones, habitualmente con el soporte de plataformas y
protocolos estandarizados (Glosario de trminos AMIPCI, s.f.). A grandes rasgos, el
comercio electrnico, o e-commerce, se puede definir como la ejecucin de una
transaccin comercial a travs de Internet y esto puede incluir vender bienes o servicios
que son entregados fsicamente, as como productos o servicios digitales, entregados
en lnea. El e-commerce se puede agrupar en tres formas bsicas: transacciones de
negocio a negocio, transacciones de negocio a consumidor, y transacciones de
consumidor a consumidor (Organizacin para la Cooperacin y Desarrollo Econmicos,
2009).

El uso del Internet para transacciones comerciales comenz a despegar en 1995


(OCDE, 2000). Laudon y Guercio (2012), sealan que el comercio electrnico comienza
a partir de la aparicin del primer banner publicitario, publicado a finales de 1994 por
AT&T, Volvo, Sprint, entre otros y la venta de espacio publicitario en la red, iniciada por
Netscape e Infoseek a principios de 1995. Estudios revelan que la aceptacin del
Internet como una opcin para realizar compras ha crecido rpidamente. Antes del
2000 los consumidores utilizaban el Internet para investigar los costos y disponibilidad
de los productos y realizar comparaciones entre las opciones disponibles. Para el 2007
las ventas en lnea haban incrementado drsticamente.

A nivel mundial, entre los sectores productivos ms favorecidos por los consumidores
se encuentran: libros, ropa, videos, DVDs, juegos, boletos de avin y equipo
electrnico. En el 2007 los bienes antes mencionados, fueron los que ms se
compraron en lnea a nivel mundial (The Nielsen Company, 2008). Segn la AMIPCI
(2012), el comercio electrnico es una de las funciones ms extendidas del Internet.

Interiores.indd 15



5/9/13 6:29 PM

Para entender el comercio electrnico en su totalidad, es necesario considerar tres


temas interrelacionados: tecnologa, negocio, y sociedad (Laudon y Guercio, 2012). El
e-commerce es sobre todo un fenmeno dirigido por la tecnologa, en su centro, el
Internet y la Red, o World Wide Web. Adems existen tecnologas complementarias,
como lo son las computadoras personales, telfonos inteligentes, la nube, entre otros.
Estas tecnologas han permitido el desarrollo de aplicaciones de negocios como
sistemas de administracin de la cadena de suministro, sistemas de planeacin de los
recursos de manufactura, y sistemas de administracin de relaciones con clientes.
Existen otros componentes tecnolgicos como protocolos, plataformas digitales
mviles, servidores web, herramientas de programacin de software que permiten
comprender el e-commerce a profundidad. Mientras que la tecnologa provee la
infraestructura para el comercio electrnico, es la parte de negocio lo que lo ha hecho
interesante (Laudon y Guercio, 2012). Las nuevas tecnologas han permitido a negocios
y emprendedores reorganizar las formas de produccin y transaccin. Por esto, es
necesario considerar nuevos modelos de negocio, analizar el comportamiento de
consumidores en el mercado digital, los bienes digitales, la estructura de la industria,
entre otros factores que cambian el mercado tradicional. Por otra parte, el Internet ha
tenido un impacto significativo y global, con ms de 2 mil millones de usuarios en el
mundo. Por ello, se requiere reflexionar sobre temas sociales impactados por el
comercio electrnico como: privacidad individual, propiedad intelectual y polticas de
bienestar pblico.

Como se mencion anteriormente, existen diferentes tipos de comercio electrnico, en


relacin a las partes que participan en la transaccin. Considerando lo anterior,
podemos distinguir tres principales tipos de comercio electrnico: Negocio a
Consumidor (B2C), Negocio a Negocio (B2B) y Consumidor a Consumidor (C2C). El ecommerce de Negocio a Consumidor es el ms comn y se refiere a aquellos negocios
en lnea que venden directamente a consumidores individuales. Dentro de este
esquema hay muchos modelos de negocio que se discutirn ms adelante. En el
comercio electrnico de Negocio a Negocio se encuentran todos aquellos proveedores

Interiores.indd 16



5/9/13 6:29 PM

que se enfocan en vender sus productos y servicios a otros negocios. Por ltimo,
existen las transacciones de Consumidor a Consumidor, en las que el Internet ofrece
una plataforma en la que los consumidores pueden vender sus productos los unos a los
otros a travs de subastas o anuncios clasificados en lnea.

Ventajas del e-commerce

El comercio electrnico ha trado nuevas oportunidades comerciales tanto para


empresas, como para los consumidores. El acceder a productos y servicios en lnea ha
permitido al consumidor tener mayor capacidad para buscar, comparar y comprar
productos y la opcin de poder hacerlo en cualquier momento y lugar. A la misma vez,
las opciones de los productos y servicios a los que se puede tener acceso se han
ampliado, incluyendo a proveedores de todo el mundo, permitiendo satisfacer mejor las
preferencias personales. Adems, el aumento de la transparencia ha intensificado la
competencia, a menudo resultando en precios ms bajos para los consumidores. Es as
como el comercio electrnico ha trado nuevas oportunidades comerciales tanto para
empresas, como para los consumidores. Ambos tienen la ventaja de tener una tienda
abierta 365 das al ao, 24 horas al da y la flexibilidad de poder llevar a cabo la
compra-venta desde cualquier parte del mundo con acceso a Internet.

En cuanto a las empresas, el e-commerce ha trado nuevas oportunidades a pequeas


y grandes organizaciones. De acuerdo a Evans y Wurster (1997), existen tres
caractersticas principales de la informacin que, al combinarse con el Internet,
impactan al mercado. La primera caracterstica es el alcance, el Internet permite a las
empresas incrementar el nmero de consumidores potenciales a los que tiene acceso.
Esto lo hace a un bajo costo, a travs de los motores de bsqueda, y rompiendo las
fronteras nacionales. La informacin tambin tiene la caracterstica de la riqueza y el
Internet permite ofrecer informacin detallada sobre productos, precios y disponibilidad.
La tercera caracterstica de la informacin es la afiliacin y esto se refiere a la
posibilidad que tienen las organizaciones en un contexto en lnea de establecer
relaciones con socios para diversificarse y crecer. Con el aumento de informacin

Interiores.indd 17



5/9/13 6:29 PM

disponible en lnea, existen ms oportunidades para adquirir nuevos clientes,


especialmente porque cada vez son ms las personas que se dirigen al Internet para
investigar acerca de un producto antes de hacer una compra.

Por su parte, Laudon y Guercion (2012) aaden a esta lista, reconociendo ocho
caractersticas del comercio electrnico: ubicuidad, alcance global, estndares
universales, riqueza, interactividad, densidad de informacin, personalizacin, y
tecnologa social. Estas particularidades hacen que la modalidad de comercio
electrnico sea un negocio atractivo. La caracterstica de ubicuidad se relaciona a la
capacidad del comercio electrnico de estar disponible casi en todos lados y a toda
hora. Esto elimina las barrera del espacio fsico y permite a los consumidores hacer
compras desde su hogar, oficina, o hasta su carro, utilizando la tecnologa mvil. Los
autores explican que el concepto de alcance se refiere al nmero de usuarios totales o
consumidores un negocio en lnea puede obtener. A diferencia del comercio tradicional,
que puede llegar a consumidores locales o regionales, el e-commerce tiene un alcance
global. Los autores explican que el comercio electrnico se rige por estndares
universales, ya que los estndares tcnicos del Internet son iguales para todos los
pases. Esto permite encontrar fcilmente los proveedores, precios y trminos de
entrega de un producto en cualquier parte del mundo. La caracterstica de riqueza se
refiere a la complejidad y el contenido de un mensaje. Similar a lo mencionado por
Evans y Wurster (1999), el comercio electrnico permite ofrecer informacin rica en
contenidos sobre los productos ofrecidos, sin sacrificar la interaccin personal. Las
tecnologas de e-commerce permiten que exista interaccin continua entre el proveedor
y el consumidor, asemejndose a la experiencia de la interaccin fsica directa, pero
logrando que sea de forma masiva y global. Otra caracterstica expuesta por Laudon y
Guercion es la densidad de informacin, refirindose a la cantidad y calidad de
informacin disponible para todos los participantes. Las tecnologas del comercio
electrnico aumentan la cantidad, calidad, precisin y actualidad de la informacin, y, a
la vez, logran reducir los costos de ofrecer y obtener esta informacin. El e-commerce
tambin permite personalizar los mensajes de marketing para cada individuo y ajustar
el producto o servicio ofrecido de acuerdo a las preferencias o comportamientos del

Interiores.indd 18



5/9/13 6:29 PM

comprador. Esta caracterstica permite a proveedores identificar con precisin los


diferentes segmentos del mercado y adecuar los mensajes que envan a cada uno. Por
ltimo, los autores mencionan la caracterstica de la tecnologa social, la cual ha
permitido a los usuario crear y compartir contenido con la comunidad mundial. A
diferencia de los modelos de comunicacin masiva anteriores, con un esquema de uno
a muchos, el Internet permite un esquema de comunicacin nico de muchos a
muchos.

2. Componentes del comercio electrnico

El comercio electrnico se compone de diversos elementos que en conjunto hacen


posible la compraventa segura de bienes o servicios a travs de internet. Para
comprender mejor el comercio electrnico es indispensable conocer los principios
bsicos del Internet, as como crear una presencia en lnea, entre otros elementos
clave. A continuacin se desglosan los componentes esenciales para el e-commerce.

Internet

Es importante reconocer que el Internet, y las tecnologas relacionadas a l, no son


estticas, por lo que las estrategias de negocio actuales y del futuro requieren un
profundo conocimiento de stas nuevas tecnologas (Laudon y Guercio, 2012). Para
asimilar el potencial y alcance de el comercio electrnico es necesario saber que el
Internet es "la mayor red de interconexin de redes del mundo... es una red
multiprotocolo, que permite a todos sus usuarios la utilizacin de sus servicios (World
Wide Web, correo electrnico, grupos de noticias, etc.) por medio de la simple conexin
a uno de los millones de servidores que proporcionan acceso a la red (AMIPCI, s.f.). El
Internet ha tenido un impacto incalculable en el comercio, la investigacin cientfica y la
cultura y es importante reconocer que el Internet y su funcionamiento no es controlado
por una organizacin en especfico, ni tiene un dueo (Laudon y Guercio, 2012). La
Red o Web es uno de los servicios de Internet ms utilizados y provee acceso a

Interiores.indd 19

5/9/13 6:29 PM

pginas web, las cuales se pueden visitar utilizando un navegador, que es un programa
instalado en la computadora.

Laudon y Guercio separan la evolucin del Internet en tres etapas que se han dado a lo
largo de 50 aos (de 1961 a la fecha). La primera etapa, de 1961 a 1974, la llaman la
etapa de innovacin en la cual se determinan las bases fundamentales del Internet y
se traducen en hardware y software. Estas bases fundamentales son el hardware de
conmutacin de paquetes, el protocolo de comunicacin TCP/IP, y la computacin de
cliente/servidor. El propsito inicial del Internet en 1960 era comunicar a las
computadoras en cada campus universitario. La segunda etapa del Internet se conoce
como institucionalizacin y empieza a partir de 1975, cuando grandes instituciones,
como el Departamento de Defensa de los Estados Unidos, deciden invertir en este
invento para desarrollar un sistema de comunicacin militar. En 1986 la Fundacin
Nacional de Ciencia, o NSF, por sus siglas en ingls, desarrolla un plan a diez aos,
con una inversin de $200 millones de dlares para expandir el Internet y desarrollar un
Internet civil. A partir de 1995 comienza la etapa de comercializacin en la que se
promueve la participacin privada para expandir tanto los cimientos del Internet como la
oferta de servicios a la sociedad en general. Es en este ao cuando las principales
compaas de comunicaciones Estadounidenses toman control de la operacin central
del Internet. Ese mismo ao se crea Amazon y AuctionWeb (eBay), dando comienzo al
comercio electrnico puro con tiendas y subastas meramente en lnea. En 2009 los
telfonos inteligentes, o smartphones, dan acceso a una nueva plataforma, permitiendo
que realmente se tenga acceso a Internet en cualquier momento o lugar. Actualmente
seguimos en esta etapa de comercializacin y el acceso a Internet sigue creciendo. De
acuerdo al Banco Mundial (2011) los usuarios de Internet pasaron de 29.5 por cada 100
en 2010 a 32.8 en 2011.

En 1995 el Federal Networking Council pas la siguiente resolucin como la definicin


de Internet: "Internet" se refiere al sistema global de informacin que - (i) est
relacionado lgicamente por un nico espacio de direcciones global basado en el
Protocolo Internet (IP) o en sus extensiones; (ii) es capaz de soportar comunicaciones

Interiores.indd 20

5/9/13 6:29 PM

utilizando el conjunto de protocolos Transmission Control Protocol / Internet Protocol


(TCP / IP) o sus extensiones u otros protocolos compatibles con IP, y (iii) emplea,
provee, o hace accesible, ya sea pblica o privada, servicios de alto nivel en capas de
comunicaciones y otras infraestructuras relacionadas aqu descritas" (Federal Network
Council, 1995).

De esta definicin se desglosan tres conceptos relevantes: conmutacin de paquetes,


protocolo de comunicacin TCP/IP, y computacin cliente/servidor. La conmutacin de
paquetes se refiere a un mtodo de envo de datos en el que el mensaje se
descompone en varios fragmentos, conocidos como paquetes, y se enva cada uno por
separado para luego ser reensamblados por el receptor en el orden adecuado (Herrera,
2003). Una vez que se empez a utilizar este sistema para enviar informacin, se
reconoce la necesidad de desarrollar protocolos que determinen la manera en que
deben ser enviados y ordenados estos paquetes. En 1974 se desarrolla el protocolo de
comunicacin TCP/IP, que rige el Internet actualmente, y establece las conexiones
entre computadoras, Web de envo y recepcin; as como tambin maneja el
ensamblado de paquetes en el lugar de origen y el reensamblaje al ser recibidos
(Laudon y Guercio, 2012). Por su parte, la computacin cliente/servidor permiti que el
Internet se desarrollara y creciera como lo ha hecho hasta ahora. En general, este
sistema de computacin se rige por computadoras personales conectadas en una red
con uno o ms servidores. En este esquema el cliente solicita y el servidor ejecuta las
solicitudes de trabajo. As, las computadoras en la red se dividen las tareas de
procesamiento entre clientes y servidores, volvindose ms eficaces (Kendall y Kendall,
2005). Estos tres conceptos componen la base del funcionamiento del Internet.

Creando una presencia en lnea

Enfoque sistmico
El da de hoy, se puede afirmar que el internet es parte de la vida diaria de personas y
de la sociedad en general y, por ello, contar con una presencia en lnea para
comercializar productos y servicios se ha convertido en una estrategia fundamental

Interiores.indd 21

5/9/13 6:29 PM

para todos los negocios y emprendedores del mundo.

Para crear presencia en lnea e incursionar en el comercio electrnico se necesitan


considerar aspectos de negocios, tecnolgicos y sociales. De acuerdo a Laudon y
Guercio (2012), lo ms importante es desarrollar un claro entendimiento de los objetivos
de negocio para que, a partir de ellos, se pueda elegir la tecnologa indicada para
alcanzarlos. Es necesario contar con un equipo de personas capacitadas para crear y
administrar una pgina de comercio electrnico exitosa, que tomar decisiones sobre
tecnologa, diseo del sitio y polticas de informacin. El proceso de desarrollo debe ser
monitoreado de cerca para asegurar el xito. Este proceso de planeacin incluir
decisiones sistmicas sobre recursos humanos, capacidad organizacional, hardware,
software, infraestructura de telecomunicaciones y diseo de sitio. Todas estas
decisiones se deben tomar considerando las demandas de los clientes, quienes
querrn encontrar lo que buscan con facilidad, ver el producto, comprarlo y recibirlo
rpidamente. A partir de esto, surgir el plan para el proyecto de comercio electrnico.

Laudon y Guercio (2012) sugieren implementar la metodologa de ciclo de vida del


desarrollo de sistemas o SDLC, por sus siglas en ingls, que permite comprender los
objetivos de negocio de cualquier sistema y disear estrategias y soluciones para
alcanzarlos. Para un sitio de comercio electrnico, los autores recomiendan seguir los
siguientes pasos: planeacin, diseo de sistema, construccin del sistema, prueba e
implementacin. A continuacin se detalla cada uno de estos pasos.

Planeacin: El primer paso al desear crear una presencia en lnea es realizar un


anlisis de los sistemas y responder a la pregunta Qu queremos que esta
pgina de comercio electrnico haga por nuestro negocio?. El sitio debe
alinearse a las necesidades del negocio y que sean stas las que dirijan las
decisiones relacionadas a la tecnologa. Como parte del proceso de planeacin
se deben definir los objetivos de negocio que el sitio web debe cumplir, a partir
de stos se determinarn las funcionalidades del sistema y los requisitos de
informacin (elementos de informacin que el sistema debe producir para

Interiores.indd 22



5/9/13 6:29 PM

alcanzar los objetivos). Un ejemplo de esto sera tener el objetivo de personalizar


el producto para cada cliente, la funcionalidad del sistema sera llevar un historial
de clientes y los requisitos de informacin sera contar con un registro para cada
visita de un cliente, capacidad de data mining para identificar los recorridos de
consumidores y respuestas apropiadas a esto. Con esta informacin el equipo
de sistemas podr disear el sitio web esperado.
2

Diseo de sistema: Una vez que se identifican los objetivos del negocio, las
funcionalidades del sistema y la informacin que se requiere obtener para su
funcionamiento se debe determinar cmo se va a presentar esta funcionalidad.
Para esto, se deben disear las especificaciones del sistema, las cuales proveen
una descripcin de los principales componentes del sistema y la relacin entre
uno y otro. Este sistema estar compuesto por un diseo lgico y uno fsico.

Construccin del sistema: Para la construccin del sistema se deber decidir


quin va a construir y alojar el sitio. Se puede contratar a un externo para hacer
cualquiera de stas dos cosas o ambas, o bien, se puede decidir que se harn
dentro de la empresa. Si se decide construir el sitio con un equipo interno, se
debe considerar la experiencia y habilidades que tiene en este tema. Si el
conocimiento es limitado, se pueden encontrar plantillas preestablecidas en
Yahoo Merchant Solutions, Amazon Stores y eBay. Si se tiene ms conocimiento
sobre diseo web se puede utilizar software como Adobe Dreamweaver,
Microsoft Expression algn software de uso libre como Kompozer. Se debern
evaluar las ventajas y desventajas de estas opciones, as como realizar un
anlisis de costo-beneficio. En cuanto al alojamiento del sitio, la mayora de las
empresas que realizan comercio electrnico deciden contratar a un proveedor
externo que aloje su sitio web y garantice su funcionamiento las 24 horas del da.
Por una cuota mensual la empresa no se tiene que preocupar de los aspectos
tcnicos y de personal necesarios para montar y mantener un servidor web. Otra
opcin es co-localizar el servidor Web. Esto implica comprar o rentar un servidor
Web localizado en el espacio fsico del proveedor. El proveedor se hace
responsable de dar mantenimiento al equipo y sede el control de las
operaciones. Una tercera opcin es utilizar un proveedor de servicios en la nube,

Interiores.indd 23



5/9/13 6:29 PM

el cual ofrece espacio virtual. Lo ms importante es seleccionar un proveedor


que sea seguro y fidedigno, que realmente pueda dar un servicio las 24 horas
del da, durante todo el ao y que permita tu sitio crecer conforme crezca tu
negocio. En realidad solamente las empresas grandes deciden alojar su sitio
web en sus servidores, ya que esto trae costos ms elevados al tener que
comprar y mantener hardware, software, instalaciones fsicas, renta de lneas,
contratar personal capacitado y construir capacidades de seguridad y respaldo.
4

Prueba: Una vez que el sistema se ha construido y programado se debe probar


el proceso. La prueba del sistema implica evaluar el sitio como un todo, de la
misma forma que lo hara un usuario comn, y verificando la funcin de todos los
caminos que un usuario puede tomar al entrar al sitio. La segunda fase de
prueba consiste en verificar que los objetivos de negocio planteados
originalmente se alcancen con el sitio creado. Esta evaluacin deben realizarla
los gerentes de marketing, produccin, ventas y la gerencia general.

Implementacin: ya que se instala e implementa el sitio web es necesario que


est en constante mantenimiento. Un sitio de comercio electrnico estar en un
constante proceso de cambio, mejora y correccin. Estudios revelan que el 20%
de las actividades de mantenimiento van dirigidas a situaciones de emergencia
(como cambios en el servidor que tumban el sitio). Otro 20% se dirige a cambios
en los reportes y documentos de data, as como las ligas que llevan a la base de
datos. El otro 60% del tiempo dedicado a mantenimiento se dedica a la
administracin general del sitio (como actualizar precios y productos). Es
necesario considerar que un sitio web de comercio electrnico debe ser dinmico
y su xito a largo plazo depender, en gran parte, del personal encargado de
actualizarlo de acuerdo a las cambiantes condiciones del mercado. El equipo
encargado de mantener el sitio deber estar atento a los comentarios y
recomendaciones de clientes, desarrollar un sistema de monitoreo y prueba para
asegurar semanalmente el buen funcionamiento del sitio, y de comparar el sitio
con aquellos de los competidores en trminos de diseo, tiempo que toma cargar
la pgina y experiencia del usuario. Un sitio disfuncional rpidamente har que
los clientes busquen en otro lado.

Interiores.indd 24



5/9/13 6:29 PM

Infraestructura tecnolgica de un sitio web


Un sitio web depende completamente del software sobre el que est diseado y el
hardware que lo aloja. Debido a que muchas de las funciones de un sitio web de
comercio electrnico dependen del software utilizado al disearlas, se deben conocer
algunos principios bsicos sobre esta herramienta. En un principio los paquetes de
software para sitios web consistan de una computadora servidor ejecutando software
de servidor Web simple, y solamente desplegaban contenido (Laudon y Guercio, 2012).
Con el desarrollo del comercio electrnico fue necesario contar con software ms
sofisticado que permitiera el tipo de interaccin que exige el comercio electrnico. De
ah surgen los servidores de aplicacin Web, con la capacidad de procesar las
transacciones requeridas por el e-commerce. Un primer paso al elegir software es
seleccionar el software de servidor Web, que a su vez definir el sistema operativo
necesario. Actualmente Apache tiene el 66% del mercado y utiliza sistemas operativos
Unix y Linux. Es gratuito y gracias a su amplio uso es extremadamente estable y
confiable. Otra opcin reconocida es Microsoft Internet Information Services, basado en
el sistema operativo de Windows, y su ventaja es que cuenta con una suite de
productos integrada y fcil de usar. Cabe sealar que el servidor Web que se utilice
para disear la pgina no har diferencia para los usuarios del sistema, ya que las
pginas web se vern igual en uno u otro software (Laudon y Guercio, 2012).

Como se mencion anteriormente, las aplicaciones de servidor Web son programas de


software que renen las transacciones necesarias para un sitio de comercio electrnico.
Algunas aplicaciones de servidor indispensables son: mostrar el catlogo, procesar
transacciones de pedidos y pagos, listas de correo, servidor proxy, servidor de correo
electrnico, servidor de chat, entre otros. Un e-commerce merchant server software
rene las funcionalidades bsicas de un sitio de comercio electrnico, como lo son un
catlogo en lnea, el carrito de compras y el procesamiento de rdenes y pagos. Estos
tres elementos se discutirn ms adelante. Gracias al crecimiento del comercio
electrnico a nivel mundial, ahora se cuenta con paquetes, o e-commerce suites, que
integran todas las aplicaciones necesarias para un sitio web de comercio electrnico y

Interiores.indd 25



5/9/13 6:29 PM

deja de ser necesario construir un sitio con un software diferente para cada aplicacin.
Laudon y Guercio (2012) dividen estas opciones en tres categoras: paquetes bsicos,
intermedios y de alto rango y sugieren evaluar cuidadosamente las opciones
disponibles, tomando en cuenta costos que podran ser pasados por alto, como
capacitacin de personal. Si los paquetes comerciales resultan costosos o no se
adecan a las necesidades de la empresa, se puede construir el sitio sin ellos. Para
esto se debe considerar las habilidades de programacin y el tiempo disponible y
seleccionar entre servicios ofrecidos por sitios de alojamiento (hosting sites) o utilizar un
software de cdigo abierto (open source).

Otra consideracin importante al empezar un sitio web de comercio electrnico es el


hardware, o todo el equipo de cmputo que utiliza el sistema para lograr su
funcionalidad (Laudon y Guercio, 2012). Lo ms importante es calcular la capacidad en
la plataforma con precisin para atender las demandas en momentos de mucho trfico,
sin gastar ms de lo necesario. Ser necesario tomar en cuenta el nmero de usuarios
simultneos, el tipo de contenido que se ofrecer, la seguridad requerida, el nmero de
artculos en el inventario, entre otros. Una vez que se estima la demanda promedio que
tendr el sitio, se debe decidir cmo se atender esta demanda. Una opcin que no
requiere mucho anlisis es alojar el sitio Web en un servicio en la nube. Si se decide
alojar el sitio web de manera interna, se debern evaluar opciones de escalabilidad y
analizar si se tendr un crecimiento vertical, horizontal, o una combinacin de ambos.

En la actualidad, el desarrollar una presencia en lnea implica desarrollar un sitio web o


aplicacin mvil. Como se precisar ms adelante, cada vez son ms los usuarios que
acceden a la red a travs de dispositivos mviles como smartphones o tablets. En
general, un sitio web mvil es una versin del sitio Web original, rediseado para que el
consumidor encuentre lo que busca y realice su compra con mayor rapidez. Al igual que
el sitio web, el sitio web mvil estar alojado en los servidores de la compaa. Por su
parte, las aplicaciones Web mviles, o Apps mviles, se disean especficamente para
una plataforma mvil y se ejecutan directamente en el dispositivo. Aunque tambin
requieren de una conexin a Internet para ser utilizadas, normalmente operan con

Interiores.indd 26



5/9/13 6:29 PM

mayor rapidez que un sitio Web mvil (Laudon y Guercio, 2012). La decisin sobre la
presencia mvil que deber tener la compaa depende de los objetivos de negocio
establecidos.

Elementos clave en un sitio web de comercio electrnico


En un sitio web de comercio electrnico existen ciertos elementos clave e
indispensables. Entre ellos est el catlogo e inventario de productos, el carrito de
compra, el procesamiento de pagos y el sistema de envos. Existen variaciones a las
formas tradicionales de estos elementos y la manera en que aparecen depende, en
gran parte, del producto que se ofrece.

El catlogo de productos en lnea ofrece una lista de todos los productos o servicios
que ofrece la empresa. El catlogo puede aparecer de manera sencilla, mostrando un
texto descriptivo y fotos del producto, o estar ms elaborado, y contar con videos,
sonidos o animaciones.

Una vez que el consumidor revisa el catlogo en lnea, debe ser capaz de seleccionar
aquellos productos que le interesan para su compra. El carrito de compra permite a los
compradores separar los artculos deseados en preparacin para la compra, revisar lo
que seleccionaron, en caso de ser necesario, editar su seleccin y hacer proceder a la
compra por medio de un clic (Laudon y Guercio, 2012). Un carrito de compras en lnea
es parte de un programa de software en un servidor de comercio o merchant server que
permite al comprador seleccionar los artculos, editar su lista y realizar la compra. Una
variacin al carrito de compras es la opcin one-click, en la que el consumidor accede a
la compra del producto o servicio con dar un solo click a un botn. El cliente deber
estar registrado en el sitio y tener una forma de pago aprobada, de manera que en
compras futuras se pedir una clave para autenticar al usuario y proceder a realizar el
pago.

El carrito de compras y el servicio de one-click normalmente trabajan en conjunto con el

Interiores.indd 27



5/9/13 6:29 PM

software de procesamiento de pagos. Cuando el pago se hace con una tarjeta de


crdito, el software verifica los datos y el crdito en la tarjeta y genera el cobro. Los
diferentes modos de pago para un servicio de comercio electrnico se discutirn
posteriormente. En general, se recomienda contar pago a travs de tarjeta de crdito y
algunos medios alternos para atraer a una mayor cantidad de clientes.

Para completar la venta en lnea se debe hacer la entrega del producto. Para esto,
existen distintos mtodos de envo para los productos vendidos en lnea. Si el volumen
lo amerita, se puede contar con una flotilla que haga la reparticin, de otra manera, se
debe establecer un contrato con alguna compaa de mensajera y paquetera
(Estafeta, DHL, UPS, entre otros). Al cliente se le podrn ofrecer varias opciones de
envo, como entrega al da siguiente, entrega en dos o tres das, entre otras. En cuanto
al precio del envo, se deber decidir si ir considerado en el precio del producto o ser
un costo adicional al que incurrir el cliente al momento de procesar su compra. El
ofrecer la promocin de envo gratis se ha vuelto popular y es una manera de atraer
clientes que no quieren incurrir en un gasto adicional (AMIPCI, 2012). Otra opcin que
se puede ofrecer al cliente es la opcin de recoger en tienda. Si su negocio cuenta con
un espacio fsico (como una tienda departamental), el consumidor puede hacer la
compra por Internet y decidir en qu tienda recoger el producto. Por ltimo, si los bienes
son intangibles, se debe ofrecer la opcin de descarga, en la que el consumidor tiene
acceso inmediato al producto, ya que no existe la necesidad de envo. Algunos
ejemplos de bienes no fsicos son, la

msica, videos, servicios de contratacin y

gestin de recursos humanos.

En cuanto a las devoluciones, expertos recomiendan ofrecer un periodo en el que si el


consumidor no est satisfecho con su compra pueda hacer una devolucin y se le
reembolse su pago, ya que esto reduce la percepcin de riesgo al hacer una compra en
lnea (Daniel, 2011). El nmero de das que se dan para hacer la devolucin depender
del negocio (empresas ofrecen desde 7 hasta 30 das) y el cargo del envo por
devolucin puede correr por parte de la empresa o el consumidor. Es importante que la
informacin se ofrezca de manera clara en el sitio web. Daniel (2011) calcula una tasa

Interiores.indd 28



5/9/13 6:29 PM

de devolucin entre 5 y 10% para productos fsicos vendidos en lnea. El determinar el


porcentaje de producto que est siendo devuelto permitir refinar el proceso de
devolucin y reducirlo. Para llevar un control adecuado del producto, el sistema de
envos y devoluciones debe estar vinculado al sistema de inventario y, a su vez, la
oferta en el sitio.

Para llevar el control del stock o inventario de productos que la empresa tiene
almacenados, se lleva un control de inventarios, de manera que se mantenga el ritmo
de pedidos para atender a las demandas de los clientes. Los inventarios para productos
que se anuncian en internet, no deben de estar en lnea necesariamente, se puede
llevar el control de manera tradicional, sin embargo cuando la magnitud de la empresa
crece y los pedidos aumentan, el inventario y su gestin se dificultan e incrementa el
riesgo de que algn producto que no esta disponible siga a la venta en la tienda virtual.

Por lo mencionado anteriormente se vuelve imprescindible contar con un sistema de


inventarios, ya que estos sistemas permiten que los inventarios estn completamente
integrados con los portales a travs de los cuales se llevan a cabo las ventas, para que
de esta manera un producto que no est en existencia quede fuera de catlogo
automticamente , y regrese al portal cuando se disponga de nuevo del mismo. De
igual manera, estos sistemas permiten que toda la informacin de ventas se integre
automticamente con las finanzas, agilizando los sistemas contables.

En resumen, un sistema de inventarios trae diferentes beneficios, pero principalmente


eliminan la necesidad de llevar un inventario fsico de forma anual o trimestral, adems
de evitar una mala gestin que pueda incrementar los costos de almacenamiento o
incluso no satisfacer el pedido del cliente.

Otro aspecto importante para la satisfaccin del cliente es el servicio que se le brinda al
atender sus dudas e inquietudes, por ello el espacio de atencin al consumidor en lnea
es otro componente importante del comercio electrnico. Generalmente las tiendas
virtuales manejan un formato de chat o foro, en donde algn ejecutivo atiende a las

Interiores.indd 29

5/9/13 6:29 PM

solicitudes de los ciber consumidores. De manera adicional, se puede incluir en la


tienda virtual un espacio para enviar comentarios o bien incluir una direccin de correo
electrnico a la cual se canalizan los comentarios o dudas de los clientes.

Segn Mendoza (s.f.), el servicio al cliente en Internet es incluso ms importante que en


el mundo real, ya que en Internet no existe el contacto directo con el cliente y este, para
confiar en el producto o servicio, tan slo cuenta con la informacin que proporciona la
tienda virtual. Por ello, contestar rpidamente los correos electrnicos de clientes
potenciales, les demuestra la presencia del vendedor detrs del sitio web.

Medios de pago

Formas de pago
De acuerdo a Meneses (2012) las formas de pago ms populares que ofrecen las
tiendas virtuales, se pueden agrupar en dos categoras generales:

1. Mtodos off-line: son aquellos en los que el pago se efecta despus de haber
realizado la compra.

1.1 Contra reembolso: mtodo en el que el pago se realiza nicamente cuando el


producto fue entregado al usuario.
1.2 Transferencia bancaria: consiste en que el vendedor del producto o servicio, da al
usuario una cuenta bancaria donde puede realizar una transferencia para confirmar su
pedido.
1.3 Domiciliacin bancaria: mtodo en el que el cliente facilita a su proveedor un
nmero de cuenta bancaria para que ste le haga un cobro una periodicidad
determinada.

2. Mtodos on-line: Son aquellos en los que el pago se realiza al momento de la


compra mediante conexin directa.

Interiores.indd 30

5/9/13 6:29 PM

2.1 Tarjeta de crdito: sistema de pago electrnico ms comn a nivel internacional hoy
en da. Consiste en que una vez que el cliente selecciona la mercanca de la tienda
virtual, procede a realizar el pago, entonces se le conecta a un servidor de la entidad
bancaria seleccionada, en donde se le solicitar que proporcione los datos de su tarjeta
y as el banco comprueba la validez de la misma y se garanticen los fondos para el
pago. Una vez autorizada la transaccin, la terminal del punto de venta virtual (TPV)
informa al comprador y al comercio sobre el resultado de la transaccin y devuelve el
control al sitio de la tienda virtual para que confirme el pedido y se abone el importe
generado a la cuenta del vendedor; habitualmente el cliente recibe la confirmacin en
su correo electrnico.

Meneses (2012) diferenca entre dos tipos de TPVs (terminal de puntos de venta) con
los que el comercio virtual puede realizar el cobro con tarjeta de crdito. El primer
formato de TPV es el tradicional, que consta de plataformas proporcionadas por
entidades bancarias para que sean incorporadas en el proceso de pago y el segundo
formato es el 3D secure que consiste en un sistema de autenticacin de tarjetas VISA
y MasterCard que permite realizar compras en lnea de manera segura en cualquiera
de los comercios participantes. Ms adelante se retoma este sistema de pago seguro
en el apartado de proteccin de datos.

2.2 Pago a travs de un intermediario: es un sistema de pago que ofrece a los clientes
una forma segura de pagar en internet sin necesidad de enviar datos financieros; esto
permite a pequeos comerciantes aceptar pagos sin necesidad de utilizar un banco o
procesador para validar la transaccin. Este tipo de pago cobra una comisin al
comercio pero no al consumidor final. A continuacin se presenta una tabla con algunos
medios para hacer este tipo de pago.

Medio de Pago
Paypal

Caractersticas
El cliente slo proporciona su correo electrnico de PayPal para
pagar en lnea y los comercios reciben el pago de parte de PayPal
sin ver en ningn momento la informacin financiera del

Interiores.indd 31

5/9/13 6:29 PM

consumidor.
PayU

El cliente compra a travs de la pasarela de pagos de PayU; la


cual acepta efectivo, tarjetas de crdito y transferencias
bancarias y una vez validada la informacin se confirma el
pedido y el vendedor recibe el dinero abonado por PayU en su
cuenta bancaria.

Safety Pay

El cliente compra en lnea y selecciona Safety Pay como medio de


pago, conserva el nmero de transaccin y monto a pagar, elige
su banco y es direccionado a su banca electrnica para
confirmacin.

Mercado Pago

El cliente elige el producto y realiza el pago con diferentes medios


(tarjetas de crdito o dbito, depsitos, transferencias bancarias,
OXXO), MercadoPago valida el pago y transfiere el dinero a la
cuenta del vendedor

Dinero Mail

El cliente paga a travs de diferentes medios: tarjetas, medios de


pago en efectivo o transferencia bancaria y los fondos se acreditan
en la cuenta DineroMail del vendedor y se le notifica.

3. Medios de prepago: Mtodo de pago en el que el cliente compra una tarjeta


prepagada por una cantidad determinada en un punto de venta y procede a realizar el
pago en lnea con el cdigo de la tarjeta prepagada. Un ejemplo de este medio es
PaySafe card, que consiste en cambiar dinero en efectivo por paysafecard en uno de
los puntos de venta, recibir paysafecard en forma de cdigo PIN de 16 dgitos por un
valor determinado y finalmente pagar con este PIN en cualquiera de los comercios en
lnea participantes.

Como se puede ver, existen diferentes grupos involucrados en las diversas formas de
pago. Entre ellos estn los consumidores, el comerciante y los intermediarios
financieros. Al elegir las formas de pago disponibles en el sitio web ser necesario
considerar las necesidades de estos grupos y ofrecer una variedad de formas de pago,


Interiores.indd 32



5/9/13 6:29 PM

sin descuidar la seguridad del sitio.

Contracargos
Un contracargo, es una forma de proteccin del cliente provisto por las entidades
bancarias, que permite a los tarjetahabientes presentar una queja en cuanto a
transacciones fraudulentas o no reconocidas en su estado de cuenta. Una vez que el
tarjetahabiente presenta una queja, el banco emisor hace una investigacin de la
misma y en el caso que se compruebe que la transaccin es en realidad fraudulenta, el
banco reembolsar el valor original al tarjetahabiente, quien por ley, tiene dos aos
para presentar una disputa.

Entonces, si el mercante no demuestra que la transaccin es legtima, el banco tomar


el valor entero de la transaccin de su cuenta, junto con un cobro adicional o multa,
cuyo monto depende del banco que patrocina la cuenta. Por lo contrario, si se prueba
que la queja del tarjetahabiente es falsa, no se solicitar ningn reembolso del
mercante.

Un contracargo puede presentarse por: transacciones fraudulentas que suceden


cuando una tarjeta es utilizada sin la autorizacin del propietario, crdito no procesado,
lo que significa que el consumidor devolvi la mercanca por algn defecto pero no
recibi su dinero de vuelta, artculos no recibidos, problemas tcnicos con la
transaccin, por ejemplo cuando se realiza un cargo doble o el resultado de la
transaccin es declinado pero si se hace el cobro, entrega tarda, estafa, entre otras.

Es posible enfrentar un contracargo, para lo cual el comercio debe presentar el


comprobante de aceptacin de cargo debidamente llenado y firmado por el cliente,
copia de la credencial del IFE, copia de la tarjeta de crdito, comprobante de
mensajera al domicilio del tarjetahabiente que tenga confirmacin de recibida la
mercanca por un autorizado o por el tarjetahabiente y cualquier documento o prueba
que pueda ser considerada como evidencia a favor del vendedor.

Interiores.indd 33



5/9/13 6:29 PM

Adicionalmente, existen algunas acciones que pueden tomarse para prevenir


contracargos. Es importante prevenir transacciones fraudulentas y aceptar compras no
autorizadas, para ello se puede recurrir a servicios de seguridad de entidades bancarias
y otros medios de pago y se sugiere detectar si un pedido se hace repetidamente y con
direcciones de facturacin diferentes. Por otro lado, para evitar rechazo de mercanca y
contracargo, se debe proporcionar artculos en buenas condiciones y atender a los
clientes manteniendo siempre comunicacin con ellos para evitar que la queja llegue a
la institucin bancaria.

Contrataciones electrnicas
Un contrato, segn el diccionario de la lengua espaola, es un pacto o convenio oral o
escrito entre partes que se obligan sobre una materia o cosa determinada. Por lo tanto,
la contratacin es el procedimiento que se sigue para que dos o ms personas se
pongan de acuerdo sobre los derechos y obligaciones que cada una de ellas adquiere y
todo ello se plasma en el contrato.

Todos los das se realizan miles de operaciones y contratos entre personas que no se
encuentran fsicamente en el mismo lugar, debido a los avances tecnolgicos. Estos
contratos electrnicos tienen un contenido obligacional determinante, por lo tanto, los
efectos jurdicos se aplican con todas sus consecuencias. As que, aunque no existe el
documento fsico, s hay un acuerdo de voluntades, el cual se obtiene por medios
electrnicos y es indudable que existen derechos y obligaciones para ambas partes.

Lpez (2010) menciona que para este fin, la Comisin de las Naciones Unidas para el
Derecho Mercantil Internacional (CNUDMI) di a conocer La Convencin de las
Naciones Unidas sobre la Utilizacin de las Comunicaciones Electrnicas en los
Contratos Internacionales, documento que fue aprobado por la Asamblea General el
23 de noviembre de 2005, mediante su resolucin 60/21. El objetivo de dicha
Convencin es ofrecer soluciones prcticas para celebrar contratos internacionales por
medio de las tecnologas de la informacin y comunicacin y garantizar el cumplimiento
de un contrato entre partes cuyos establecimientos estn en distintos lugares. En

Interiores.indd 34



5/9/13 6:29 PM

resumen, toda contratacin, incluyendo la electrnica, implica un procedimiento en


donde se expresan o declaran dos voluntades.

Factura electrnica
Una factura es el justificante fiscal de la entrega de un producto o de la provisin de un
servicio. La factura electrnica es la versin electrnica de las facturas tradicionales en
papel y es equivalentemente funcional, ya que es la representacin digital de los
comprobantes autorizados, pero a diferencia del comprobante fiscal tradicional, es
emitida y almacenada a travs de medios electrnicos.

As mismo, una factura electrnica est sometida a las regulaciones de las autoridades
tributarias de cada pas, dado que no existe una normativa internacional para la factura
electrnica. Sin embargo las naciones unidas a travs de la UN/CEFACT (United
Nations Economic Comission for Europe), han publicado ciertas recomendaciones para
emitir facturas impresas y en las modalidades electrnicas. (Rubio, 2008)

Existen diferentes modalidades en la que se presente la factura electrnica. Para cada


formato existe un cdigo. El formato XML por sus siglas en ingls Lenguaje de Marcas
Extensible, es un lenguaje estndar ampliamente reconocido para dar formato a la
informacin; incluye datos sobre el tiempo en el que se llev a cabo la firma electrnica
e informacin sobre la validez del certificado electrnico que la acompaa. El formato
EDIFACT por sus siglas en ingls Intercambio electrnico de datos para la
Administracin, Comercio y Transporte es un estndar de la Organizacin de las
Naciones Unidas para el Intercambio electrnico de datos en el mbito mundial y PDF.
El formato de firma de Adobe queda embebido dentro del formato PDF y permite
asociar una imagen, por lo que es uno de los ms adecuados para su visualizacin.

Como menciona la OCDE (2005), en Mxico el creciente uso de las tecnologas que se
est viviendo, tambin ha llevado a las organizaciones a utilizar la facturacin
electrnica sobre la factura fsica para ser ms eficientes. La facturacin electrnica en
Mxico est regulada por el Servicio de Administracin Tributaria (SAT). De acuerdo al

Interiores.indd 35



5/9/13 6:29 PM

SAT, existen requisitos indispensables para emitir facturas electrnicas. Para empezar,
se debe contar con la Firma Electrnica Avanzada (FIEL) vigente, tramitar al menos un
certificado de sello digital, que es un documento electrnico mediante el cual se
garantiza la relacin entre la identidad de un sujeto con su clave pblica, tambin se
debe contar con un sistema informtico para la generacin de las Facturas
Electrnicas, el cual podr ser desarrollado por los prestadores de servicios, o bien,
adquirir o arrendar a un tercer y enviar a validar las facturas electrnicas a un
proveedor autorizado de certificacin. La lista puede ser consultada en el sitio oficial del
SAT.

Seguridad

Seguridad de la informacin y delitos informticos


As como el Internet ha conectado a personas y abierto el acceso a ms y mejores
productos y servicios a mejor precio, tambin ha abierto nuevos canales delictivos.
Cassou (2009) define al delito informtico como toda aquella conducta ilcita
susceptible de ser sancionada por el derecho penal, consistente en el uso indebido de
cualquier medio informtico. Para los criminales, se ha vuelto atractivo robar por
Internet debido a que el acto no se comete de manera fsica y existe un sentido de
anonimidad al cometerlo.

En el Undcimo Congreso de las Naciones Unidas sobre Prevencin del Delito y


Justicia Penal, se definieron y enlistaron algunos tipos de delincuencia informtica:

a) Delitos informticos que atacan a las propias tecnologas de la informacin y


las comunicaciones, como los servidores y los sitios Web, con virus informticos.
b) El vandalismo electrnico y la falsificacin profesional.
c) El robo o fraude.
e) La pesca (phishing) o la inundacin de mensajes supuestamente de origen
conocido (spam spoofing), que es la construccin de mensajes de correo electrnico
con pginas Web correspondientes diseadas para aparecer como sitios de

Interiores.indd 36



5/9/13 6:29 PM

consumidores existentes.
f) La difusin de material ilcito y nocivo. La Internet se utiliza ahora cada vez
ms para distribuir material considerado legalmente obsceno en varios pases.

Como se puede observar, las compras de artculos y servicios por internet o en lnea
pueden resultar atractivas por la facilidad para realizarlas, sin embargo, es importante
que los ciberconsumidores tomen precauciones para evitar ser vctimas de prcticas
comerciales fraudulentas.

Para evitar lo antes mencionado, existen algunos servicios y mecanismos para proteger
al consumidor de cargos no autorizados. Entre ellos, se encuentra MasterCard
SecureCode, que protege a sus usuarios mientras compran por Internet. El comercio
participante contrata este servicio ante MasterCard para garantizar la seguridad en la
transaccin, as, MasterCard SecureCode realiza lleva a cabo un proceso de
autenticacin para proteger la cuenta de usuarios no autorizados. Si se ingresa un
cdigo incorrecto, la compra no se completar. Otro servicio de seguridad es Verified
by VISA, que consta de una Contrasea Personal que genera el cliente de tarjetas
VISA y que es solicitada al momento de hacer las compras en Internet, de este modo
se garantiza que esa persona es la nica que puede utilizar su tarjeta para realizar
compras en lnea. As mismo, el protocolo 3-D Secure est diseado para
perfeccionar y validar pagos efectuados por Internet; ya que es una tecnologa de
autenticacin que protege la informacin de pago con tarjeta en Internet. 3-D Secure se
basa en el modelo de tres dominios: emisor, adquiriente e interoperabilidad.

Firma electrnica
El hecho de que las transacciones comerciales se lleven a cabo en el entorno
electrnico, supone tener que suplir la falta de presencia fsica entre las partes y por
tanto dotar de seguridad jurdica a las mismas a travs de la tecnologa. En este
sentido, la firma electrnica viene a dar respuesta a dichas necesidades.

Para la doctrina, la firma representa un signo personal distintivo que permite informar

Interiores.indd 37



5/9/13 6:29 PM

acerca de la identidad del autor de un documento y manifestar su acuerdo sobre el


contenido del acto (Krafft, 2003). La firma, segn el Diccionario de la Real Academia,
es el Nombre y apellido, o ttulo, que una persona escribe de su propia mano en un
documento, para darle autenticidad o para expresar que aprueba su contenido.

Por su parte, Krafft (2003), define a la firma, como un sello que identifica y distingue a
un individuo de los dems y menciona que la firma autgrafa y la firma electrnica
poseen equivalencia funcional, lo que significa que son completamente diferentes pero
las dos son perfectamente vlidas y funcionalmente equivalentes; es decir que todas
las caractersticas de la firma autgrafa se conservan en la firma electrnica aunque
esta ltima es un conjunto de caracteres alfanumricos.

Segn el autor, la atribucin de la firma es la forma en que podemos garantizar que las
partes que se obligan en la relacin jurdica o contrato, son quienes dicen ser. Esta
atribucin jurdica que se pretende formalizar en un mensaje de datos, es conocida
como Firma electrnica, la cual puede ser Simple definida como los datos en forma
electrnica consignados en un mensaje, que puedan ser utilizados para identificar al
firmante; o bien la Firma Electrnica Avanzada que se diferenca de la simple porque
cuenta con un certificado digital que valida la autenticidad del emisor.y permite detectar
cualquier modificacin ulterior al contenido del mismo y garantizar la identidad del
titular.

Por su parte, la definicin del SAT dice que la Firma Electrnica Avanzada "Fiel" es un
conjunto de datos adjuntos en un mensaje electrnico, cuyo propsito es identificar al
emisor del mensaje como autor legtimo de ste, tal y como si se tratara de una firma
autgrafa. Por sus caractersticas, la Fiel brinda seguridad a las transacciones
electrnicas de los contribuyentes, ya que con su uso se puede identificar al autor del
mensaje y verificar no haya sido modificado.

Su diseo se basa en estndares internacionales de PKI por sus siglas en ingls: Public
Key Infrastructure, en donde se utilizan dos claves o llaves para el envo de mensajes;

Interiores.indd 38



5/9/13 6:29 PM

la "llave o clave privada" que solamente conoce el titular de la Fiel y sirve para cifrar
datos y la "llave o clave pblica", disponible en Internet para consulta de todos los
usuarios de servicios electrnicos, con la que se descifran datos.

Certificados digitales
Al igual que la firma digital, los certificados digitales buscan solucionar el problema de la
identidad digital. En realidad, para que una firma digital y PKI sean efectivas se necesita
asegurar que la llave par decodificar el mensaje realmente pertenezca a la persona de
quien dice ser (Chaffey, 2011). Para esto se desarroll el certificado digital, que es un
documento digital emitido por una institucin de confianza, conocida como autoridad
certificadora, el cual contiene el nombre del sujeto o empresa, una llave pblica, un
nmero de serie de certificado digital, una fecha de caducidad, una fecha de emisin, la
firma digital de la autoridad certificadora y otra informacin de identidad (Laudon y
Guercio, 2012). En general, los certificados digitales se utilizan para verificar la
autenticidad de un sitio Web, la autenticidad e integridad de un programa de
computacin o verificar el momento en que fue firmado o enviado un documento digital.

Proteccin al consumidor
Para proteger al consumidor de los diferentes delitos informticos, las autoridades de
proteccin al consumidor alrededor del mundo han desarrollado una serie de
lineamientos que buscan otorgar una mayor proteccin a los consumidores en lnea.
Por ejemplo, la Organizacin para la Cooperacin y el Desarrollo Econmicos (OCDE)
desarroll, en 1999, las Directrices para la Proteccin de los Consumidores en el
Contexto del Comercio Electrnico que tratan de una serie de recomendaciones
encaminadas a lograr que los proveedores de bienes y servicios a travs de internet
cumplan con las disposiciones de las leyes de proteccin al consumidor.

Por su parte, la Profeco, sugiere que se tengan en cuenta algunos aspectos al comprar
por internet. Por ejemplo, verificar la identidad del proveedor, quien debe proporcionar
al ciberconsumidor su denominacin legal y ubicacin fsica, para que este tenga las
herramientas para realizar un reclamo en caso de ser necesario. Por otro lado se debe

Interiores.indd 39

5/9/13 6:29 PM

asegurar que el negocio o vendedor hace una descripcin veraz de los productos, para
que el consumidor pueda tomar una decisin de compra bien fundamentada y en el
caso de los proveedores mexicanos, los precios en lnea deben estar expresados en
moneda nacional y deben notificar al consumidor sobre las condiciones y formas de
pago; as mismo mencionar si existen cargos adicionales por envo. Tambin se debe
tener en cuenta que el portal debe declarar sus polticas de privacidad porque es
probable que se requiera que el cliente revele datos de carcter privado, como el
nmero de la tarjeta de crdito, y por ltimo deben estipularse con claridad las polticas
de devolucin de mercancas, las garantas y condiciones generales de la transaccin.

En caso que el consumidor llegue a tener problemas en sus transacciones comerciales


con proveedores en lnea, puede contactar a las autoridades para ser protegido. Si la
operacin comercial electrnica se llev a cabo con un proveedor domiciliado en
territorio nacional, deber contactar a Profeco: http://www.profeco.gob.mx/ , de lo
contrario, el extranjero, deber contactar: http://www.econsumer.gov/, un portal para
elconsumidor donde se puede reportar quejas sobre transacciones en lnea o
relacionadas con compaas extranjeras

Proteccin de datos personales


Hoy en da por leyes y la prctica internacional ya no es posible solicitar y guardar los
datos personales de los consumidores, como se poda hacer antes; ahora al realizar
alguna compra por Internet, la empresa intermediaria puede solicitar algunos datos
personales; sin embargo, se debe asegurar que se cuidaran, ya que existen sanciones y
prdida de permisos por el mal uso de los mismos.

Los sitios que se preocupan por garantizar el uso adecuado de


la

informacin

de

sus

clientes,

consideran

implementar

mecanismos que avalen su operacin, dichos mecanismos


pueden ser los sellos o distintivos de seguridad mismos que se
publican bajo un logotipo en los sitios de compra y que permiten
ligar -al dar clic sobre ellos- ir a una pgina actualizada en donde

Interiores.indd 40

5/9/13 6:29 PM

informa que el sitio utiliza esos servicios para asegurar su


informacin (AMPICI, 2012).

De manera adicional, existen algunas acciones que ayudarn a proteger los datos
personales del comprador, por ejemplo, si el sitio solicita hacer un registro, no se debe
compartir la contrasea personal y se sugiere establecer contraseas alfanumricas, as
mismo se deben cambiar con frecuencia las contraseas de su cuenta en lnea.
Tampoco se debe enviar por correo electrnico informacin financiera personal y se
recomienda utilizar programas de software que filtren los correos electrnicos "spam" e
identifiquen los mensajes sospechosos.

En materia legislativa, el presidente Felipe Caldern Hinojosa expidi el Reglamento de


la Ley Federal de Proteccin de Datos Personales en Posesin de los Particulares,
mismo que fue publicado en el Diario Oficial de la Federacin el 21 de Diciembre del
2011.

Se destacan algunos elementos del reglamento mencionado:

1.-Esquemas de Autorregulacin

Lo detallado en el Reglamento permitir a los particulares contar con


un esquema complementario para la proteccin de datos y al difundir
estos mecanismos por parte de la Secretara de Economa, en conjunto
con el IFAI, se promueve la prctica y la atenuacin de posibles
sanciones.

2.-Solicitud de Proteccin de Derechos


Permite a los titulares tener certidumbre de la garanta que otorga la
Constitucin ante el IFAI cuando este derecho fundamental sea
vulnerado.

Interiores.indd 41

5/9/13 6:29 PM

3.-Procedimiento de Verificacin
Permite al Instituto llevar a cabo las visitas a las empresas para
corroborar el cumplimiento de la Ley y el Reglamento estableciendo los
procedimientos correspondientes, de conformidad con la Ley Federal
de Procedimiento Administrativo.

4.-Procedimiento de aplicacin de Sanciones


Permite a las empresas tener claridad de las disposiciones que el IFAI
considerar para emitir alguna sancin. En este sentido, se contempla
la garanta de audiencia para las empresas.

5.-Elementos de Seguridad
Considera los elementos mnimos que las empresas deben observar
para la adecuada proteccin de datos, tomando en cuenta el riesgo
inherente al tipo de dato que trata, el desarrollo tecnolgico y las
posibles consecuencias de una vulneracin.

6.-Medidas Compensatorias
En el Proyecto de Reglamento, se detalla que el uso medios de
difusin masiva como una medida compensatoria para dar a conocer
del Aviso de Privacidad en caso de que el volumen de datos
personales o su antigedad sean una barrera para darlo a conocer.
Con esto, se reducirn los costos y tiempos asociados de la puesta de
disposicin del Aviso a los titulares.

(AMIPCI, 2012, p. 67)

Modelos de negocio en lnea

Un modelo de negocio presenta cmo una empresa generar ingresos, identificando su


oferta de producto, servicio de valor agregado, fuentes de ingreso y su poblacin

Interiores.indd 42



5/9/13 6:29 PM

objetivo (Chaffey, 2011). De acuerdo a Gosh (1998), existen ocho elementos


indispensables a considerar en cualquier modelo de negocio: propuesta de valor,
modelo de ingresos, oportunidad de mercado, entorno competitivo, ventaja competitiva,
estrategia de mercado, desarrollo organizacional y equipo gerencial. Debido a la
rapidez con la que evoluciona el comercio electrnico es necesario constantemente
evaluar, innovar y actualizar el modelo de negocio adoptado, examinando cada uno de
los factores anteriormente mencionados. De acuerdo a Laudon y Guercio (2012) existe
un sin nmero de modelos de negocio en lnea y proponen categorizarlos de acuerdo a
los diferentes sectores de comercio electrnico en los que se utilizan. Esta clasificacin
sera B2C (negocio a consumidor), B2B (negocio a negocio), C2C (consumidor a
consumidor) y P2P (para a par). A la vez, mencionan que algunas compaas tendrn
mltiples modelos de negocio y distinguen que el tipo de tecnologa que se utiliza afecta
la clasificacin, como sera el caso del M-commerce, o comercio mvil.

B2C
En un modelo de B2C (business-to-consumer), o de negocio a consumidor, las
transacciones comerciales se dan entre una organizacin y un consumidor individual
(Chaffey, 2011). Un primer ejemplo de este modelo de negocio son los portales como
ofrecen herramientas de bsqueda, as como contenidos y servicios en un solo lugar.
Dentro de los portales ms reconocidos se encuentran Google, Yahoo, MSN/Bing y
AOL. Los portales no venden un producto directamente, ms bien generan sus ingresos
vendiendo espacios para anuncios o acceso a servicios avanzados (Laudon y Guercio,
2012). Otro modelo dentro de este esquema es el de ventas al por menor en lnea,
dentro de este sector se encuentran tiendas que venden todos sus productos en lnea
(amazon.com, decompras.com y itunes) y otras que combinan sus ventas en una tienda
fsica con una tienda virtual (Walmart y Palacio de Hierro). De acuerdo a Laudon y
Guercio (2012), este sector es altamente competitivo, ya que la barrera de entrada es
baja y existen miles de pequeas tiendas en lnea ofreciendo sus productos. El modelo
de ingresos de este tipo de negocio es basado en el producto, con los consumidores
pagando por la compra de un artculo en particular. El proveer contenidos es otro
modelo de negocios B2C y se refiere a cualquiera que distribuye contenidos de

Interiores.indd 43



5/9/13 6:29 PM

informacin como noticias de forma digital, msica, fotos, videos y arte a travs de la
Web. La mayora de estos negocios cobran a sus usuarios una cuota mensual
(WSJ.com, Harvard Business Review, Rhapsody.com), mientras que otros ofrecen la
informacin de forma gratuita e incorporan a su sitio banners con anuncios
(CBSSports.com y CNN.com). La clave en este tipo de negocio est en ser dueo de
los contenidos, darle un valor agregado a los contenidos o tener informacin nica a la
que no se pueda tener acceso si no es a travs del sitio (Laudon y Guercio, 2012).
Otras ofertas que forman parte de la categora B2C son procesadores de transacciones
(despegar.com

hoteles.com),

creadores

de

mercado

(como

eBay

mercadolibre.com), proveedores de servicios (Google Apps), y proveedores de


comunidades digitales (Facebook, LinkedIn y Twitter).

B2B
Como se mencion anteriormente, el modelo de negocio de B2B se refiere a aquellos
negocios cuyos clientes son otras organizaciones. En Estados Unidos se estima que
este tipo de negocio es 10 veces ms grande que el e-commerce B2C. En 2011 los
ingresos de los diferentes negocios B2B ascendieron a los $310 mil millones de
dlares. Los principales modelos dentro de esta categora son e-distribuidores, eprocurement, intercambios, consorcios industriales y redes industriales privadas. Los
distribuidores electrnicos son aquellos negocios que ofrecen a otros negocios
productos fsicos para el mantenimiento, refaccin u operacin de sus operaciones. La
clave de su xito se encuentra en tener la mayor cantidad de productos disponibles
para que clientes encuentren todo lo que necesitan en un solo sitio. Las empresas de eprocurement crean y venden acceso a mercados digitales electrnicos (Laudon y
Guercio, 2012). En general, estos negocios ofrecen la posibilidad de simplificar y
eficientar las operaciones internas. Los negocios con un modelo de intercambio ofrecen
una plataforma donde diversos proveedores y consumidores se reunen para realizar
transacciones y sus ganancias se derivan al cobrar comisiones y cuotas por las
transacciones realizadas. Los consorcios industriales son mercados en lnea para una
industria especfica, y ofrecen productos y servicios a un nmero reducido de
empresas. Un ltimo modelo de B2B son las redes industriales privadas diseadas para

Interiores.indd 44



5/9/13 6:29 PM

coordinar el flujo de comunicacin entre empresas que realizan negocios juntas. Un


ejemplo concreto de esto es Walmart, sus proveedores utilizan su red privada para
monitorear las ventas de sus productos y los inventarios en tienda de stos (Laudon y
Guercio, 2012).

P2P, C2C y m-commerce


Laudon y Guercio (2012) explican que cuando pensamos en un negocio, normalmente
pensamos en una empresa que produce un bien u ofrece un servicio y lo vende a un
consumidor. Sin embargo, la Web ha dado oportunidad a la creacin de nuevas formas
de negocio como lo es el e-commerce de consumidor a consumidor (C2C), de par a par
(P2P), y el comercio mvil. El modelo de C2C permite a consumidores conectarse con
otros consumidores y hacer negocio. Ejemplos de este modelo sera eBay,
MercadoLibre y Craigslist y, en general, el modelo de ingresos es a travs de cuotas
por transaccin. Los negocios P2P ayuda a los consumidores compartir expedientes y
servicion online y sus ingresos provienen de cuotas de inscripcin, anuncios y cuotas
por transaccin. Por ltimo, el comercio mvil, o m-commerce, toma modelos de ecommerce tradicionales y adeca sus funcionalidades a las plataformas de los
smartphones y tablets. En general, este modelo apoya a las aplicaciones de negocio
para su uso en la tecnologa inalmbrica.

Online marketing

Los medios digitales estn revolucionado la manera en la que tenemos que hacer
mercadotecnia hoy en da. Una campaa de marketing a travs del eficiente uso de
medios digitales, puede abrir la puerta hacia un nmero de cibernautas y
ciberconsumidores cada vez mayor. El marketing en lnea ha tomado un lugar
importante dentro de las estrategias de comercializacin de productos y servicios; de
hecho, muchas empresas ya estn adoptando una nueva visin que est cambiando el
enfoque de la publicidad en lnea, desde simples anuncios de texto y banners hasta
grandes campaas de publicidad multimedia.

Interiores.indd 45



5/9/13 6:29 PM

El consumidor
Este cambio en la manera de hacer marketing hoy en da, nace como respuesta ante el
comportamiento los consumidores, quienes constantemente buscan informacin sobre
productos o servicios a travs de internet. Segn el estudio de la AMIPCI sobre Hbitos
de Internet en Mxico 2012, ms de 40 millones de personas usan el internet y en
promedio, los usuarios permanecen alrededor de cuatro horas conectados para buscar
informacin, mandar correos o utilizar plataformas de redes sociales. Por otro lado, los
dispositivos mviles se estn utilizando cada vez ms para acceder a la red mundial y
buscar informacin; el estudio revela que se duplic el uso de Smartphones (58%) para
conectarse a internet respecto al ao anterior (26%) (AMIPCI, 2012).

Por lo anterior mencionada se vuelve un indispensable que las empresas/marcas estn


donde el consumidor/target est y realizar ah sus estrategias comerciales para
hacerlas ms efectivas (Hatch, 2012).

Publicidad en lnea
El marketing digital se presenta en diferentes modalidades; marketing por correo
electrnico, en redes sociales, publicidad en motores de bsqueda, marketing en video,
banners, entre otros.

El email marketing es una forma de comunicacin a diferentes tipos de usuarios en


forma masiva mediante el uso del correo electrnico. Entre las principales ventajas del
email marketing

est que es rpido de implementar, trae resultados medibles y

cuantificables, se obtiene rpida respuesta y cada vez ms gente adquiere una cuenta
de correo electrnico.

Una campaa efectiva de email marketing debe estar dirigida al segmento correcto. Se
debe segmentar la estrategia por zonas, edades, gustos y otras caractersticas y sobre
todo hay que dar seguimiento a las respuestas obtenidas; es decir, no solo enviar, sino
analizar y medir resultados para perfeccionar la estrategia. Es importante conocer a los
usuarios que se interesaron por el producto para definir el perfil de compradores

Interiores.indd 46



5/9/13 6:29 PM

potenciales.

Alejandro Jimnez, director de la Unidad de Negocios OCC Publicidad, coment que


tambin el contenido del mensaje publicitario que se enva debe ser estratgico; entre
las recomendaciones que hace est utilizar pocas imgenes y lneas, utilizar palabras
clave y agregar un vnculo o botn de click para invitar al sitio. A la gente le gusta que
le digan: da click, compra aqu (A. Jimenez, Economa de comunidades, 7 de
noviembre de 2012).

El videomarketing es otra forma de hacer publicidad en video. Un estudio publicado


por Media Mind en octubre del presente ao, que dice que los consumidores son ms
propensos a hacer clic en videos interactivos que en aquellos estticos. En concreto,
revela que la tasa de clics en videos online es 27,4 veces mayor a la de banners
estndar. Los resultados tambin revelan que, los usuarios son ms propensos de ver
anuncios de video interactivos hasta el final que un anuncio con video estndar. Esto
lleva a la conclusin de que la publicidad con video interactivo tiene mayor impacto que
la publicidad estndar (Interactive Advertising Bureau: IAB, 2012).

El uso del video en la comercializacin de un producto a travs de Internet es una


forma muy eficaz de marketing y esta siendo usada por numerosas empresas y
personas. Por ejemplo YouTube, el popular portal de vdeos en Internet, donde sus
usuarios activos, tienen una gran influencia en este tipo de marketing actualmente.

El marketing en motores de bsqueda o SEM por sus siglas en ingls Search Engine
Marketing, tambin est convirtindose en una manera popular y efectiva de hacer
publicidad en lnea, ya que como se ha mencionado, gran porcentaje de los cibernautas
utilizan buscadores para encontrar lo que necesitan y una manera de encontrar a la
poblacin objetivo de tu producto es relacionarlo con ciertas palabras claves de
bsqueda, de manera que se ofrezca el producto o servicio a aquellas personas que
buscan informacin relacionada; es decir al target de personas indicado.

Interiores.indd 47



5/9/13 6:29 PM

Redes sociales y comunidades en lnea


Las redes sociales tambin representan hoy en da un espacio importante de opinin y
por ello son una fuente de informacin relevante, donde segn Santo (2012) los
usuarios encuentran recomendaciones de sus semejantes que comparten sus
experiencias y opiniones sobre ciertas marcas y servicios, lo que se convierte en un
entorno publicitario influyente a la hora de tomar decisiones para realizar una compra.
Por ello, las empresas deben trabajar en una estrategia para tener presencia en los
medios y generar una buena opinin pblica.

Hatch (2012) afirma que las empresas deben trabajar en una buena estrategia para
hacer marketing digital y menciona 3 pilares importantes que debe considerar una
PyME antes de iniciar sus acciones digitales: planeacin, contenido y medicin. Una
buena planeacin ayuda a definir objetivos, estrategias y el alcance que se desea
obtener; el contenido debe llamar la atencin y lograr un efecto o reaccin en el
consumidor y la medicin debe dar informacin exacta sobre la medicin de
costo/beneficio de la inversin realizada de manera que se pueda valorar el impacto.

Por su parte, Rojas (2012), hace nfasis en el hecho que histricamente a las agencias
de publicidad tienen la responsabilidad de ser guardianes de la marca, as como a las
agencias de relaciones pblicas y comunicacin construir la reputacin de la empresa.
Lograrlo es muy difcil y slo se consigue con el tiempo y una trayectoria limpia. En la
actualidad, todos los empleados de una empresa, as como los usuarios, se convierten
en portavoces de la misma, ya que expresan sus opiniones personales en canales
sociales. Esto puede traer consecuencias tanto positivas como negativas.

Las comunidades digitales tambin son espacios en los que se comparten opiniones
de diferentes temas, as como de productos o servicios. Colle (2000) define a una
cibercomunidad como cualquier comunidad de individuos que tienen en Internet su
lugar de reunin, discusin, cambio de puntos de vista, etc. Las cibercomunidades
pueden encontrarse en espacios virtuales como una comunidad.

Interiores.indd 48



5/9/13 6:29 PM

Tecnologa de marketing y Data mining


El marketing digital, es el medio en el cual se puede medir con mayor precisin todo el
proceso y los resultados que se obtienen de la publicidad online, ya que la analtica web
(web analytics) difunde los indicadores y resultados (Falcn, 2010).

La IAB Espaa hizo una publicacin sobre cmo medir la Publicidad Online. Este
manual argumenta que si bien los CTR (Clicks through rate) son un indicador de la
efectividad de una campaa de marketing digital, existen otras mtricas importantes
para evaluar el efecto de una campaa, Post-View o Post- Click que complementan las
CTR de manera ms precisa.

El anlisis de la informacin a partir de ciertos datos toma dos formas principales:


descripcin y prediccin. La minera de datos (data mining) se utiliza para simplificar y
resumir informacin de una manera que podamos comprender y analizar, permite inferir
cosas sobre casos especficos basndose en los patrones observables. La minera de
datos, puede otorgar al vendedor en lnea un poder inmenso inferencial sobre la
estrategias publicitaria que est utilizando, ya que los algoritmos pueden clasificar
correctamente los resultados por categoras (Furnas, 2012).

La minera de datos puede hacer diferentes tipos de anlisis: La deteccin de


anomalas, cuando se usan las estadsticas para determinar si algo es notablemente
diferente de un patrn. Asociacin de aprendizaje, es el tipo de minera de datos que
maneja el sistema de recomendaciones de Amazon o Google; este tipo de hallazgos
son de uso frecuente para la orientacin y ofertas al target correcto. Deteccin de
Cluster, es un tipo de reconocimiento de patrones que es til para diferenciar distintos
grupos o categoras dentro de un conjunto de datos; con la minera de datos, es posible
dejar que los algoritmos detecten todos los diferentes subgrupos dentro de un conjunto
de datos que difieren entre s. Clasificacin, se puede utilizar para clasificar nuevos
casos en categoras ya existentes, ya que los algoritmos pueden detectar diferencias
entre los elementos de cada grupo y aplicar ciertas reglas a los nuevos problemas de
clasificacin. Regresin, se puede utilizar para construir modelos predictivos basados

Interiores.indd 49

5/9/13 6:29 PM

en muchas variables; por ejemplo, Facebook se interesa en factores como la


informacin personal compartida, el nmero de fotos etiquetadas, solicitudes de
amistad, comentarios, entre otros; ya que estos resultados pueden ser utilizados para
guiar el diseo y alentar a ms de los comportamientos que conducen a una mayor
participacin.

.Leyes y tica en el comercio electrnico

Privacidad y proteccin de datos personales


La expansin del Internet ha trado nuevas consideraciones sobre el derecho de
privacidad de los individuos y el uso de datos personales. En general, el derecho a la
privacidad se refiere al derecho que tenemos las personas de evitar intrusiones de
terceros a sus asuntos personales (Chaffey, 2011). Como parte de este derecho, se
encuentra la privacidad de la informacin, o el derecho a que cierta informacin sea
privada y no recolectada por gobiernos o empresas y el derecho a tener control del uso
de la informacin personal que es recolectada (Laudon y Guercio, 2012). Algunos datos
personales pueden ser nombre, telfono, domicilio, correo electrnico, edad, ocupacin,
fotografa, o cualquier otro dato que identifique o pueda servir para identificar a una
persona. Los retos impuestos al derecho a la privacidad de la informacin vienen tanto
del sector privado, como el pblico y se cuestiona la cantidad de informacin que
renen y el uso que le dan a esta informacin empresas privadas y el gobierno.
Tambin es innegable cierto temor a que esta informacin termine en las manos
equivocadas. Es una realidad que los sitios de e-commerce recolectan una gran
informacin de los consumidores que visitan su sitio y de los que hacen compras. Como
se explic anteriormente, esta informacin permite entender las necesidades,
caractersticas y comportamientos de los consumidores y dirigir campaas publicitarias
especficas para cada tipo de consumidor. Sin embargo, la privacidad de los
consumidores se ha convertido en un cuestionamiento tico clave, independientemente
de si se realizan transacciones comerciales en el sitio o no. De acuerdo a Chaffey
(2011), el asunto de mayor relevancia para el comercializador es ofrecer un aviso sobre
el tipo de informacin que se recolecta y el uso que se le da.

Interiores.indd 50

5/9/13 6:29 PM

En Mxico, el 5 de Julio de 2010, se public en el Diario Oficial de la Federacin la Ley


Federal de Proteccin de Datos Personales en Posesin de Particulares. El objetivo de
la ley es proteger los datos personales en posesin de las empresas, as como regular
que dichos datos sean usados nicamente para la finalidad que fueron entregados, que
se tenga un control de quin y para qu los tiene y que el titular o dueo de los datos
siempre est informado del trato de dichos datos, buscando con lo anterior garantizar la
privacidad y el derecho a la autodeterminacin informativa de los individuos (Carrillo,
2011). La Ley se rige por 6 principios rectores que son las reglas mnimas a observar
para garantizar el uso adecuado de la informacin personal. Estos principios son: son
licitud, consentimiento, calidad, informacin, proporcionalidad y responsabilidad.

La implicacin ms importante que tiene esta Ley para las empresas de comercio
electrnico, corresponde a la obligacin a cargo del receptor de datos de entregar a los
titulares de datos personales un Aviso de Privacidad, as como nombrar a una persona
o departamento que estar al frente de la proteccin de datos de la empresa. Un Aviso
de Privacidad es un documento generado por la persona fsica o moral responsable de
la recopilacin y tratamiento de datos personales que se presenta de manera fsica
(escrita en papel), electrnica (pgina web), o sonora (grabacin). ste debe informar al
titular de los datos sobre quin recopila los datos, qu datos se recopilan, con qu
finalidad, cmo limitar su uso o divulgacin, cmo revocar su uso, el procedimiento para
ejercer sus derechos de acceso, rectificacin, correccin y oposicin, la forma en que
se comunican cambios a este aviso, y la aceptacin o negativa para autorizar la
transferencia de datos a terceros (Proteccin de datos personales, 2011). El Instituto
Federal de Acceso a la Informacin y Proteccin de Datos (IFAI) es el encargado de
garantizar el derecho a la proteccin de datos personales en posesin de particulares y
verificar el cumplimiento de la Ley.

Propiedad intelectual
El derecho a la propiedad intelectual es otra rea que se ha vuelto controvertida a raz
de la expansin del Internet y el comercio electrnico. Se considera propiedad

Interiores.indd 51

5/9/13 6:29 PM

intelectual a los bienes derivados de la actividad creativa o inventiva (Sbada, 2008). El


derecho a la propiedad intelectual protege los diseos, ideas e inventos, incluyendo los
contenidos y servicios desarrollados en sitios de e-commerce (Chaffey, 2011). En
general, las leyes dirigidas a la propiedad intelectual buscan que los autores y personas
involucradas en el proceso creativo reciban remuneracin por su trabajo cada vez que
es utilizado. Es indiscutible que el Internet ha hecho difcil mantener control sobre el
acceso, uso, distribucin y copia de los productos digitales ya que son fcilmente
copiados, transmitidos y alterados (Laudon y Guercio, 2012).

Rosales, Santana y Gmez (2011) explican que como parte de la Naciones Unidas se
encuentra la Organizacin Mundial de la Propiedad Intelectual, el cual divide a la
propiedad intelectual en dos ramas: la propiedad industrial y el derecho de autor. Las
autoras explican que en la primera se incluyen las patentes de invencin, marcas de
fbrica y de comercio, dibujos y modelos industriales y las denominaciones de origen.
Por su parte, el derecho de autor agrupa las obras literarias, musicales, artsticas,
fotogrficas y audiovisuales (Rosales et al., 2011). Aunque en la actualidad una
persona u organizacin que genera e innova obras artsticas, cientficas, industriales o
comerciales puede reclamar ser dueo de su obra y protegerla de cambios, distribucin
o mal uso, en realidad las leyes no han logrado abarcar los cambios que ha trado la
era digital. Por el lado social se cuestiona si cierta tecnologa debe ser ilegal slo por
afectar a algunos dueos de propiedad intelectual, mientras que, desde una perspectiva
poltica, la discusin se centra en cmo regular el Internet y el e-commerce para
proteger la institucin de la propiedad intelectual, sin obstaculizar el crecimiento del
Internet y el comercio electrnico (Laudon y Guercio, 2012).

A raz de esta discusin han surgido iniciativas como la de Creative Commons que
busca que autores conserven sus derechos autorales, invitando a otros a usar su obra
bajo el esquema Algunos derechos reservados (Creative Commons, s.f.). El objetivo
de esta organizacin es ofrecer licencias modelo que faciliten la distribucin y uso de
contenidos (Creative Commons, 2012). Actualmente se ofrecen 6 diferentes licencias,
todas aseguran que el autor o creador obtenga crdito de su trabajo y se puede decidir

Interiores.indd 52



5/9/13 6:29 PM

entre permitir su uso comercial o no, si permite hacer cambios o crear nuevas obras a
partir del original, y pedir que quien utilice la obra comparta la nueva versin bajo la
misma licencia, haciendo crecer los bienes digitales comunes. Las licencias de creative
commons protegen la propiedad intelectual y van de acuerdo a las leyes de copyright,
reservando ciertas acciones al dueos original y obligando al usuario a dar crdito a
quien tenga la licencia, mostrar avisos de copyright y ofrecer una liga a la licencia
(Creative Commons, s.f.).

Cabe sealar que el agregar una licencia de Creative

Commons no suple el registro de la obra ante la Oficina de Derecho de Autor, ms


bien funciona a la par del copyright. En general, la comunidad Creative Commons
busca que el Internet alcance su mximo potencial, facilitando el acceso universal a
investigacin y educacin y permitir una nueva forma de desarrollo, crecimiento y
productividad (Creative Commons, s.f.).

3. Mxico y el comercio electrnico

Situacin actual en Mxico

Mxico tiene amplias oportunidades para avanzar en el desarrollo de las Tecnologas


de la Informacin y usarlas como herramientas para impulsar la competitividad y
crecimiento del mercado mexicano. Estudios coinciden en que Mxico es actualmente
terreno frtil para impulsar el comercio electrnico y existen oportunidades de xito
debido a mltiples factores. De acuerdo al estudio E-readiness en Amrica Latina
comisionado por Visa, al tomar en cuenta las variables de adopcin tecnolgica,
volumen de mercado, infraestructura tecnolgica, bancarizacin y fortaleza de la oferta,
Mxico cuenta con un e-readiness de 0.69, comparado con un 0.80 en la regin
(AmricaEconoma Intelligence, 2011). Respecto a 2009, este mismo estudio seala
que los factores que han tenido un aumento son la penetracin de banda ancha, el
nmero de plsticos bancarios y, especialmente, el nmero de mexicanos que compran
por Internet (de 4.7 millones en 2009 a 7 millones en 2011). Por otra parte, el Mobile
Commerce representa tambin una de las ventajas que tiene Mxico para poder

Interiores.indd 53



5/9/13 6:29 PM

impulsar el comercio digital, ya que segn las cifras de Cofetel (1Q 2012) actualmente
hay ms de 95 millones de celulares en Mxico y durante el 2011 se duplic el uso de
smartphones para conectarse a la web.

El estudio de Comercio Electrnico 2012 presentado por la Asociacin Mexicana de


Internet revela que el e-commerce en Mxico ha ido creciendo positivamente en los
ltimos aos, indicando que en el 2011 aport $54,500 millones de pesos a la
economa mexicana y se estima un crecimiento del 46% para el cierre del 2012
representando $79,600 millones de pesos (AMIPCI, 2012). Adems del crecimiento que
han tenido las compras por internet en los ltimos aos, la confianza de los
consumidores est aumentando, al igual que la oferta de productos y los mtodos de
pago se han diversificado. El estudio comprueba que el medio de pago ms utilizado
por el Internauta es la Tarjeta de Crdito (60%), seguido de Depsito en Sucursal (31%)
y Paypal (28%), la transferencia electrnica gana terreno (28%), 9% ms que en 2011.

Aunque el comercio electrnico en el pas est creciendo de manera acelerada, las


ventas en lnea an se consideran por debajo del promedio de Amrica Latina. Un
ejemplo de esto es la comparacin con Brasil, que tiene menos del doble de usuarios
de Internet que Mxico y ha logrado un volumen de ventas 3 veces mayor al de Mxico
(Soto, 2012). A propsito del caso de xito del e-commerce en Brasil, Stelleo Tolda
COO de la compaa Mercado Libre, en su conferencia Factores de xito y retos del
comercio electrnico 2012 hizo nfasis en la necesidad de inversin en tecnologa,
infraestructura, polticas pblicas, inversin exterior y comunidad de desarrolladores, ya
que segn su experiencia en Brasil, cada pas debe pensar en su propio modelo de
acuerdo a las necesidades contextuales. El crecimiento que se est dando en estas
reas permitir explotar el potencial comercial de Mxico. Por su parte Pablo Slough,
director de Google Mxico opina que el pas crece en todos los indicadores
fundamentales de Internet: acceso a la red, crecimiento de usuarios y volumen de
operaciones pero falta la oferta ya que con ms competidores y consumidores se
alcanzarn metas ms altas. Ms actores significa ms mercado, ms oferta y mayor
retorno. Mxico debera estar entre los 7,000 u 8,000 millones de dlares en

Interiores.indd 54



5/9/13 6:29 PM

operaciones de comercio electrnico, menciona Slough (Snchez y Soto, 2012).

Actualmente en Mxico, las compras ms populares en lnea, segn Piedras (2011),


son los boletos de avin que representan el 69% de las compras en lnea, destacando
la importancia del e-commerce dentro del sector turismo. En segundo lugar, los equipos
de cmputo abarcan 8% de las compras, el 4% lo representa la compra de accesorios
para celulares, el 3% en el rubro de electrnica, audio y video. Finalmente, la compra
de boletos para espectculos va internet ha sido una parte exitosa del modelo, con 4%
del total de las ventas por este medio.

En Mxico an existen reservas entre los consumidores para hacer compras en lnea;
entre las principales razones est la falta de informacin del producto o negocio y la
desconfianza del consumidor ante posibles delitos informticos o la no recepcin del
producto (AMIPCI, 2012). Por otro lado, la baja penetracin de Servicios Bancarios
dificulta este tipo de transacciones, slo el 23% de los mexicanos cuenta con una
tarjeta de crdito, as como la baja penetracin de banda ancha entre la poblacin, ya
que apenas alcanza 11.9% (Piedras, 2011). Por lo anterior, resulta necesario promover
el e-commerce, aceptar nuevos modelos y medios de pago, trabajar en la seguridad y
confianza de pago en lnea y potenciar el marketing online.

En materia legal, Mxico se ha adecuado a la realidad moderna de la actividad


mercantil en lnea para proteger al ciber consumidor mexicano cuando realiza compras
por Internet. En materia legislativa se agregaron las reformas legales publicadas en el
Diario Oficial de la Federacin (DOF) el 20 de Mayo del 2000 en donde se adicionaron
reformas a cuatro leyes federales: el Cdigo Civil Federal, el Cdigo de Comercio, el
Cdigo Federal de Procedimientos Civiles y la Ley Federal de Proteccin al
Consumidor. El objeto de estas reformas es la regulacin de las operaciones o
transacciones de comercio electrnico incluyendo la contratacin electrnica,
autenticacin y derechos y obligaciones de los contratantes (Rojas, 2000, p. 400). A la
vez, existe mayor presin por ofrecer a consumidores un Aviso de Privacidad, indicando
el uso que se le darn a sus datos personales.

Interiores.indd 55



5/9/13 6:29 PM

Mensajes clave para el sector empresarial mexicano

Actualmente Mxico presenta un panorama atractivo para incursionar en el comercio


electrnico. Como se resalt anteriormente, los indicadores muestran que el terreno
est listo y los consumidores cada vez ms dispuestos a aprovechar las ventajas de
este servicio. A continuacin se presentan los puntos clave a considerar al emprender
en e-commerce.

Considerar recursos requeridos:

Evaluar y elegir infraestructura necesaria y un sistema de mantenimiento

En caso de ya contar con una tienda fsica establecida, reconocer que el


rea de e-commerce debe tener un peso igual de importante.

Desarrollar un sitio web centrado en el usuario.

Tomar en cuenta la facilidad de encontrar los productos ofrecidos.

Visualizacin del carrito de compra y todos los proceso de compra de


manera siempre visible para el usuario.

Velocidad de carga de la pgina.

Ofrecer opciones claras de Servicio al Cliente, como chat, nmero


telefnico, etc.

Sistematizar la cadena de valor

Se debe considerar el ciclo de venta en su totalidad, tomando en cuenta la


experiencia del cliente y sus necesidades.

Algunos procesos que no se deben obviar: ofertas, detalle de los


productos, inventarios, ordenes de compras, entregas, servicios de
instalacin, devoluciones, garantas.

Tener alianzas con proveedores de paquetera serios y puntuales


(garantizar entrega)

Ofrecer medios de pagos diversos y seguros (Apoyarte en intermediarios


financieros para evitar fraudes y facilitar los pagos a los usuarios)

Establecer una base de clientes

Interiores.indd 56

Una vez que un consumidor hace una compra la probabilidad que, al



5/9/13 6:29 PM

hacer otra compra, la haga en un sitio en el que ya tiene sus datos


registrados es muy alta.

Actualmente hay un gran nmero de consumidores potenciales, si no se


convierten en clientes ahora, en un par de aos ser ms difcil hacerse
de una base slida de clientes.

Establecer una poltica de privacidad y proteccin de datos personales de los


usuarios.

Interiores.indd 57



5/9/13 6:29 PM

IV. Referencias

AmricaEconoma Intelligence. (2012). E-readiness en Amrica Latina: Estudio sobre

las

condiciones

para

el

e-commerce

en

la

regin.

Recuperado

de:

http://www.ecommerceday.co/2012/wpcontent/uploads/2012/08/eReadiness_visa_ESP.pdf
AMIPCI. (2012). Hbitos de los Usuarios de Internet en Mxico, 2012. Recuperado

de http://www.amipci.org.mx/?P=editomultimediafile&Multimedia=115&Type=1
Asociacin Mexicana de Internet. (2012). Gua de Negocio para Desarrollar

Estrategias de Comercio Electrnico en Mxico. Mxico D.F. 108 p.


Banco Mundial. (2011). Usuarios de Internet [Data file] . Recuperado de:

http://datos.bancomundial.org/indicador/IT.NET.USER.P2/countries/1W?display=defa
ult
Carrillo, J.C. (2011). Ley Federal de Proteccin de Datos Personales en Posesin de

Particulares. Seguridad Cultura de prevencin TI (10).

Recuperado de:

http://revista.seguridad.unam.mx/numero-10/ley-federal-de-protecci%C3%B3n-dedatos-personales-en-posesi%C3%B3n-de-particulares
Cassou, Ruiz, J. (2009). Delitos Informticos en Mxico. Revista del Instituto de la

Judicatura

Federal.

(Nmero

28,

Captulo

IV)

Recuperado

de

http://www.ijf.cjf.gob.mx/publicaciones/revista/28/Delitos_inform%C3%A1ticos.pdf
Chaffey,

D.

(2011).

E-Business

&

E-commerce

Management:

Strategy,

Implementation and Practice (5ta ed.). England: Pearson Education Limited.


Colle, R. (2000) Las Comunidades Digitales. Revista Temas de Tecnologas Digitales

de

la

Comunicacin.

Recuperado

de

http://www.recinet.org/colle/publicaciones/comvir/comvir1.htm
comercio

electrnico (s.f.) Glosario de trminos AMIPCI. Recuperado de:

http://www.amipci.org.mx/?P=glosario#qglosario_65
Creative

Commons

(s.f.).

Creative

Commons.

Recuperado

de:

http://creativecommons.org/
Daniel, I. (2011). E-commerce Get It Right!. USA: NeuroDigital.

Interiores.indd 58



5/9/13 6:29 PM

Evans, P.B. & Wurster, T.S. (1997). Strategy and the New Economics of Information.

Harvard Business Review. Recuperado de: http://hbr.org/1997/09/strategy-and-thenew-economics-of-information/ar/1


Falcn, D. (2010, 17 de Agosto). Medicin del Marketing Digital. [Blog Neo

Consulting]. Recuperado de http://blogs.neo.com.pe/neo/2010/08/marketing-digitalmedicion-web-analyticshtml.html


Federal Networking Council. (1995). FNC Resolution: Definition of Internet.

Recuperado de: http://www.nitrd.gov/fnc/Internet_res.aspx


Formas de Pago por Internet. (s.f). Como comprar por Internet. Recuperado de

http://www.comocomprarporinternet.com/formas-de-pago-por-internet
Furnas, A. (2012). Everything you wanted to know about Data Mining but you where

afraid to ask. Mashable. Recuperado de http://mashable.com/2012/04/03/datamining-explained/


Hatch, H. (2012). 3 Pilares Bsicos del Marketing Digital para PYMES. Merca 2.0.

Recopilado de http://www.merca20.com/3-pilares-basicos-del-marketing-digital-parapymes/
Hernndez, Rodrguez A. ( 2012). Estrategia Digital y Gestin de Negocios Digitales.

Gestin

de

Empresas

de

Internet.

Recuperado

de

http://finanzasparaebusiness.com/2012/05/27/gestion-del-inventario-en-empresasde-comercio-electronico/
Herrera, E. (2003). Tecnologa y redes de transmisin de datos. Mxico D.F.:

Lamusa.
IAB Spain. (2010). Ms all del CTR; Mtricas de Publicidad Online. [SlideShare]

Recuperado de http://www.slideshare.net/IAB_Spain/mtricas#btnPrevious
Internet

(s.f.)

Glosario

de

trminos

AMIPCI.

Recuperado

de:

http://www.amipci.org.mx/?P=glosario#qglosario_145
Kendall, K.E. & Kendall J.E. (2005) Anlisis y diseo de sistemas (6ta ed.). Mxico:

Pearson Educacin.
Laudon, K.C. & Guercio, C. (2012). E-commerce: Business. technology. society (8va

ed.). England: Pearson Education Limited.


Lpez, Varas, M. (2010). Regulacin Jurdica de la Contratacin Electrnica en el

Interiores.indd 59

5/9/13 6:29 PM

Cdigo Civil Federal. (Tesis de Maestra). Instituto de Transparencia y Acceso a la


Informacin Pblica del Estado de Mxico y Municipios.

Recuperado de

http://www.infoem.org.mx/sipoem/ipo_capacitacionComunicacion/pdf/pet_tesis_001_
2009.pdf
Marketing

Online.

(s.f).

Marketing

en

Internet.

Recuperado

de

http://marketingenlinea.net/
MasterCard. (s.f). MasterCard Secure Code(Cdigo de Seguridad). Recuperado de

http://www.mastercard.com/us/personal/es/servicios/codigodeseguridad/
Mendoza, A. (s.f). El Servicio al Cliente en Internet. Mercadoglobal.com. Recuperado

de http://mercadeoglobal.com/blog/el-servicio-al-cliente-en-internet/
Meneses, D. (2012). Formas de Pago en Comercio Electrnico. Marketing Colectivo.

Recuperado

de

http://citecolombia.com/marketingcolectivo/formas-de-pago-en-

comercio-electronico/
Navarro, D. (2012). MediaMind revela en su nuevo estudio la publicidad digital de

mayor

rendimiento

en

Mxico.

IAB

Mxico.

Recuperado

de

http://www.iabmexico.com/estudio/digital_mediamind
OCDE. (2000). E-commerce: Impacts and Policy Challenges. In OECD Economic

Outlook

(Captulo

VI).

Recuperado

de:

http://www.oecd.org/eco/economicoutlookanalysisandforecasts/2087433.pdf
OCDE. (2003). Directrices de la OCDE para la Proteccin de los Consumidores de

Prcticas Comerciales Transfronterizas Fraudulentas y Engaosas. Recuperado de


http://www.oecd.org/sti/consumerpolicy/34012151.pdf
OECD. (2005). Budgetary Barriers. En OECD, E-Government Studies, Mexico.

(Captulo

3.3,

p.66).

Recuperado

de

http://books.google.com.mx/books?id=dqEoUBN2A7QC&pg=PA66&dq=factura+elect
ronica+mexico&hl=en&sa=X&ei=1Z2uUKTRG47bqQGU4GgAQ&ved=0CEAQ6AEwAw#v=onepage&q&f=false
One Click Payment. (s.f). Gate to Shop. Recuperado de http://www.g2s.com/one-

click-payment
Organizacin para la Cooperacin y Desarrollo Econmicos. (OCDE) (2009,

Diciembre). Conference on Empowering E-Consumers: Strengthening Consumer

Interiores.indd 60

5/9/13 6:29 PM

Protection

in

the

Internet

Economy.

Recuperado

de:

http://www.oecd.org/ict/econsumerconference/44047583.pdf
Piacente, P. (2012). Controlar el Inventario: Una tarea que puede resultar compleja.

El

Blog

de

E-

Commerce.

Recuperado

de

http://elblogdeecommerce.com/2011/08/17/controlar-el-inventario-una-tarea-quepuede-resultar-compleja/
Piedras, E. (2011). Comercio Electrnico en Mxico. El Economista. Recuperado de

http://eleconomista.com.mx/columnas/columna-especialempresas/2011/11/09/comercio-electronico-mexico
Profeco.

(2012).

Comercio

Electrnico.

Recuperado

de

http://www.profeco.gob.mx/internacionales/com_elec.asp
Proteccin de datos personales. (2011). Qu es el Aviso de Privacidad?.

Recuperado de: http://www.protecciondedatospersonales.org/%C2%BFque-es-el-aviso-deprivacidad/


Qu

es

Facturacin

Digital?

(s.f).

Facturacin

Digital.

Recuperado

de

http://www.factdigital.com/principal.htm
Qu

es

un

Contracargo?

(s.f).

Multicards.

Recuperado

de

Recuperado

en

http://www.multicards.com/es/support/chargebacks.html
Reyes

Krafft,

A.

(s.f)

La

Firma

Electrnica.

http://www.razonypalabra.org.mx/libros/libros/firma.pdf
Rojas Armandi, V. (2000) . Regulacin del Comercio Electrnico en Mxico. Anuario

del Departamento de Derecho de la Universidad Iberoamericana, Jurdica, Nmero


30.

Recuperado

de

http://www.juridicas.unam.mx/publica/librev/rev/jurid/cont/30/cnt/cnt16.pdf
Rojas, O. (2012). Principios bsicos de las Polticas de Social Media. Merca 2.0.

Recuperado

de

http://www.merca20.com/principios-basicos-de-las-politicas-de-

social-media/
Rosales, E.M., Santana, M.V. & Gmez, M.R. (2011). La propiedad intelectual en el

entorno

digital:

Una

proteccin

del

conocimiento?.

Recuperado

de:

http://www.inegi.org.mx/eventos/2011/Conf_Ibero/doc/ET2_15_ROSALES.pdf
Rubio, Sanz, J. et al (2008). Facturacin Electrnica. En Gestin de Cobro de las

Interiores.indd 61

5/9/13 6:29 PM

Operaciones de Venta Internacional. (Captulo 8, p. 249-258). Recuperado de


http://books.google.com.mx/books?id=grUNqTz5OEC&pg=PA249&dq=factura+electronica&hl=en&sa=X&ei=TZSuUO7OFYS2rQG4t4
CQBA&ved=0CDQQ6AEwAA#v=onepage&q&f=false
Sbada, I. (2008). Propiedad Intelectual: Bienes pblicos o mercancias privadas?.

Espaa: Los Libros de la Catarata.


Snchez, J. & Soto, J. (2012, Septiembre 27). Mxico, con potencial en e-commerce:

P.

Slough.

El

Informador.

Recuperado

de:

http://www.informador.com.mx/economia/2012/407320/6/mexico-con-potencial-en-ecommerce-p-slough.htm
Santo, C. (2012). Lo Digital, Mvil y Social acaparan las Tendencias del Marketing

para

el

2013.

Puro

Marketing

Marketing

Digital).

Recuperado

de

http://www.puromarketing.com/30/14608/digital-movil-social-acaparan-tendenciasmarketing-para-2013.html
SAT. (2011) Qu es y para qu sirve la Firma Electrnica Avanzada. Recuperado de

http://www.sat.gob.mx/sitio_internet/e_sat/tu_firma/60_11498.html
SAT. (2012). Comprobantes Fiscales: La Factura Electrnica. Recuperado de

http://www.sat.gob.mx/sitio_internet/asistencia_contribuyente/principiantes/comproba
ntes_fiscales/66_19339.html
Soto, J. (2012). Qu le falta al comercio electrnico en Mxico? [Web log comment]

Recuperado

de:

http://eleconomista.com.mx/economicon/2012/11/07/que-le-falta-

comercio-electronico-mexico
The Nielsen Company. (2008), Nielsen Global Online Survey on Internet shopping

habits. Recuperado de: http://my.nielsen.com/site/20080414.shtml


UNAM,

InfoSec.

(s.f).

Firmas

Digitales.

Recuperado

de

http://infosec.aragon.unam.mx/f001.php
Visa (s.f). Verified by Visa. Recuperado de http://lac.visa.com/consumers/security.jsp

Interiores.indd 62



5/9/13 6:29 PM

Curso introductorio al comercio electrnico


Objetivo General: Comprender qu es el comercio electrnico, su situacin en
Mxico y sus componentes clave para aplicarlos en tu prctica empresarial. A la vez, que
logre analizar los mensajes clave para los empresarios mexicanos en materia de
comercio electrnico.
LECCIONES:
1. Introduccin al mundo de Internet
Descripcin: Se presentan los conceptos de Internet, la web y los navegadores.
Objetivo: Diferenciar los conceptos de Internet, la World Wide Web y los
navegadores.
2. Qu es el comercio electrnico?
Descripcin: Se define el concepto de comercio electrnico, se discuten sus
ventajas y se sealan las tendencias de e-commerce a nivel global.
Objetivo: Definir comercio electrnico y sealar las diferentes ventajas que trae
para los comercios.
3. Situacin actual en Mxico
Descripcin: Se reconocen las oportunidades en materia de comercio electrnico
en Mxico, se presenta la legislacin disponible en este tema y se discuten los retos para
el comercio electrnico en el pas.
Objetivo: Conocer la situacin de Mxico frente al comercio electrnico e identificar
las reas de oportunidad para impulsar su crecimiento.
4. Modelos de negocio en lnea 1
Descripcin: Se presentan los distintos modelos de negocio en lnea de forma
general, para despus enfocarse en el modelo B2C y discutir un caso de xito.
Objetivo: Distinguir los diferentes modelos de negocio en lnea.
5. Modelos de negocio en lnea 2
Descripcin: Se analizan los net marketplaces y sus clasificaciones, as como las
redes industriales privadas, para despus describir sus ventajas.
Objetivo: Distinguir los diferentes modelos de negocio en lnea.
6. Modelos de negocio en lnea 3
Descripcin: Se analizan los modelos de P2P, C2C y la nueva modalidad de
comercio mvil.

Interiores.indd 63

5/9/13 6:29 PM

Objetivo: Distinguir los diferentes modelos de negocio en lnea.


7. Creando presencia en lnea 1
Descripcin: Se describen los pasos a seguir para desarrollar un sistema de
comercio electrnico y se presentan los elementos clave de un sitio web de comercio
electrnico.
Objetivo: Identificar cmo desarrollar un sistema es necesario para el xito de un
sitio de e-commerce y distinguir los elementos clave de un sitio web de comercio
electrnico para delinear cmo se incorporarn al sitio de la empresa.
8. Creando presencia en lnea 2
Descripcin: Se desglosan los primeros pasos a seguir para desarrollar un sitio
web de comercio electrnico.
Objetivo: Describir qu es tener presencia en lnea, determinar los pasos a seguir
para crear un sitio web de comercio electrnico e identificar otros medios para
comercializar productos en lnea.
9. Creando presencia en lnea 3
Descripcin: Se contina con los pasos para desarrollar un sitio web de comercio
electrnico y se analizan plataformas de terceros y opciones alternas para tener presencia
en lnea. Despus se dan recomendaciones bsicas para posicionar tu pgina en la lista
de resultados de bsqueda de los principales buscadores.
Objetivo: determines los pasos a seguir para crear un sitio web de comercio
electrnico e identifiques otros medios para comercializar productos en lnea.
10. Redes Sociales
Descripcin: Se analizan las redes sociales y comunidades virtuales como parte
del comercio electrnico y cmo incorporarlas a una estrategia de marketing en lnea.
Objetivo: identifiques las redes sociales ms utilizadas y reconozcas cmo
utilizarlas para aumentar tu presencia en lnea y como estrategia de marketing.
11. Online Marketing 1
Descripcin: Se presentan el comportamiento de los consumidores en lnea y
algunas tcnicas de online marketing para despus recomendar algunos pasos para
disear una campaa de marketing exitosa.
Objetivo: Explicar el concepto de online marketing y reconocer el impacto que
tienen las diversas formas de hacer publicidad en lnea con el fin de utilizarlas como
estrategia.

Interiores.indd 64

5/9/13 6:29 PM

12. Online Marketing 2


Descripcin: Se presenta tecnologa de marketing que permite medir el impacto
que tienen las estrategias de marketing y las maneras que existen para recabar
informacin. Algunas de las herramientas que se presentan son registros, archivos de
rastreo, perfiles, sistemas CRM y mtricas.
Objetivo: Explicar el concepto de online marketing y reconocer el impacto que
tienen las diferentes formas de hacer publicidad en lnea con el fin de utilizarlas como
estrategia.
13. Online Marketing 3
Descripcin: Se describe cmo aprovechar los dispositivos mviles para promover
tu marca, analizando las nuevas tendencias y ofreciendo algunas recomendaciones
prcticas.
Objetivo: Explicar el concepto de online marketing y reconocer el impacto que
tienen las diferentes formas de hacer publicidad en lnea con el fin de utilizarlas como
estrategia.
14. Medios de Pago
Descripcin: Se presentan distintas formas de pago que se pueden incorporar a
una tienda en lnea y se explica qu es un contracargo y cmo prevenirlos.
Objetivo: Identificar las distintas formas de pago y definir qu es un contracargo.
15. Seguridad 1
Descripcin: Se explican los conceptos de firma electrnica y certificado digital y
cmo tramitarlos.
Objetivo: definir qu es la firma electrnica y el certificado digital para poder
obtener ambas.
16. Seguridad 2
Descripcin: Se discute el concepto de contratacin electrnica y se explica qu
es un comprobante fiscal digital y los requisitos para expedirlo.
Objetivo: Identificar los elementos de una contratacin electrnica y un
comprobante fiscal digital.
17. Seguridad 3
Descripcin: Se presentan las dimensiones de seguridad, se explican algunos
delitos informticos comunes y se analizan estrategias de seguridad para prevenirlos.
Objetivo: analizar las diferentes formas de delitos informticos con el fin de poner
en prctica las medidas de seguridad que le protejan de acciones fraudulentas.

Interiores.indd 65

5/9/13 6:29 PM

18. Leyes y tica en comercio electrnico


Descripcin: Se discuten los aspectos sociales impactados por el comercio
electrnico como privacidad, proteccin de datos personales, proteccin al consumidor y
propiedad intelectual.
Objetivo: Conocer la regulacin de las autoridades para proteger la privacidad del
consumidor y sus datos personales, as como los cuestionamientos ticos de la
propiedad intelectual en la era digital.
19. Mensajes clave para el sector empresarial mexicano
Descripcin: Se presentan consideraciones generales para tener xito en el
comercio electrnico.
Objetivo: Analizar aquellas acciones que favorecen la productividad de las
empresas que participan del comercio electrnico en Mxico.
20. Recapitulando
Descripcin: Se retoman los principales aprendizajes obtenidos durante el curso
para recapitular y concluir con este programa.
Objetivo: Recapitular e integrar aprendizajes previos.

Interiores.indd 66

5/9/13 6:29 PM

Interiores.indd 67

5/9/13 6:29 PM

a.Temario
b.Lecciones 1-20
(Plan de Leccin, Contenido, Ejercicios de Prctica)

III. Diseo Instruccional

Interiores.indd 68

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 1
Introduccin al Mundo de Internet
Duracin:

30 min

Objetivo de aprendizaje:

Al finalizar esta sesin, los alumnos sern capaces de explicar


y diferenciar el concepto de Internet, la World Wide Web y los
navegadores.

Subtemas:

Requisitos:

Introduccin al curso de comercio electrnico


Introduccin a la leccin 1
Internet
La Web
Los Navegadores
Conclusiones

Computadora, Tablet o dispositivo desde el cual pueda


tomar el curso en lnea.
Conexin a internet

Agenda:
Contenido:
Introduccin
- Bienvenida al curso de comercio
electrnico.
- Presentacin del instructor.
- Informacin general del curso (Esqueleto
y duracin total).

Interiores.indd 69

Notas de Produccin:
D 2:
- Nombre del Presentador
- Objetivos
- Ttulos de las 20 lecciones que componen el curso,
agrupadas en los tres divisiones del temario.

5/9/13 6:29 PM

- Introduccin a la primera leccin: Tema y


subtemas
- Mencin del objetivo de aprendizaje.

D 3:
- Fondo de Pantalla: Objetivo General
D 4-5:
- Ttulo
- Tema y subtemas de la leccin 1.
- Objetivo especfico de aprendizaje

Desarrollo
1. Internet:
- Definicin
- Historia y evolucin

D 6:
- Imgenes / Pistas de fondo. (Dejar unos segundos
mientras se ilustran las grficas imgenes.)
D 7:
- Imagen de telaraas (web)
- Un mundo con las computadoras interconectadas.
(internet)
D 8:
- Texto de fondo: Cada computadora en la "red
internacional", o Internet, est conectada por medio de
cables reales o cables ethernet, lneas telefnicas y el
cableado de fibra ptica
D 9:
Texto en el fondo:
1. Conmutacin de paquetes
2. Protocolo de comunicacin TCP/IP
3. Computacin cliente/servidor.
D 10-11:
Animaciones sobre:
- Conmutacin de paquetes
- Rompecabezas y paquetes
D 12:
- Animaciones que representen TCP/IP
D14:
- Grfica de Cliente y Servidor
D17:
- Lnea del tiempo de fondo (incluyendo imgenes)
D18- D19:
- Fotos correspondientes y texto acorde a los datos y
porcentajes.

Interiores.indd 70

5/9/13 6:29 PM

2.La Web:
- Definicin de la World Wide Web
- Web 1.0, 2.0, 3.0

D 22:
- Que aparezca en texto con animacin Web 1.0, con una
foto, luego Web 2.0 con otra foto y finalmente Web 3.0
con otra fotO que represente cada una respectivamente
D 23:
- Imagen Web 1.0 (de una pc a varios clientes)
-D24:
- Imagen Web 2.0 (computadoras interconectadas entre
si)
-D25:
- Imagen Web 3.0 (Dispositivos mviles, tablets,
computadoras interconectadas (Imgenes de Amazon o
Netflix)
-D26:
- Imgenes de smartphones, ipads, laptops, etc.
D28:
- Pregunta en el fondo de pantalla
- Que aparezcan los iconos de los distintos navegadores:
chrome, IE, safari, Opera, Firefox, etc.

3. Navegadores
- Definicin
- Ejemplos de navegadores populares

Cierre
- Resumen
- Preguntas de Reflexin
- Mencin de la leccin que le precede.
- Ejercicios de Prctica

Interiores.indd 71

D 30- 32:
- Foto de un cartoon de un navegador.
- Imgenes de los navegadores y APPS mencionados

D 34:
- Preguntas para responder en el foro de fondo

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
&XUVRGH&DSDFLWDFLyQSDUDHPSUHVDULRV

%LHQYHQLGD
%LHQYHQLGRVDOFXUVREiVLFRGH&RPHUFLR(OHFWUyQLFR0L
QRPEUHHV$QGUHD%DUULRV\VHUpVXJXtDHQHVWH
UHFRUULGRSRUHOPXQGRGHOFRPHUFLRHOHFWUyQLFR(VWH
FXUVRHVWiSHQVDGRSDUDWRPDUVHJUDGXDOPHQWHyELHQ
SRUODVVHFFLRQHVRWHPDVTXHPiVOHLQWHUHVHSRUORTXH
KHPRVGLYLGLGRHOFRQWHQLGRHQFiSVXODVyOHFFLRQHV
TXHWHOOHYDUiQGHODPDQRHQHODSUHQGL]DMH
&RPHQ]DUHPRVFRQDOJXQRVFRQFHSWRVLQWURGXFWRULRV
SRVWHULRUPHQWHSURIXQGL]DUHPRVHQORVGLIHUHQWHV
FRPSRQHQWHVGHOFRPHUFLRHOHFWUyQLFR\ILQDOL]DUHPRVFRQ
PHQVDMHVFODYHSDUDHPSUHVDULRVFRPRW~

Interiores.indd 72

5/9/13 6:29 PM

2EMHWLYR*HQHUDO
$OILQDOL]DUHOSURJUDPDVHUiVFDSD]GH
FRPSUHQGHUTXpHVHOFRPHUFLRHOHFWUyQLFROD
VLWXDFLyQDFWXDOHQ0p[LFR\VXVFRPSRQHQWHV
FODYHQHFHVDULRVSDUDDEULUWXWLHQGDHQOtQHD
$ODYH]SRGUiVXWLOL]DUORVPHQVDMHVFODYHSDUD
ORVHPSUHVDULRV\HPSUHQGHGRUHVPH[LFDQRVHQ
PDWHULDGHFRPHUFLRHOHFWUyQLFRSDUDDSOLFDUORVHQ
WXSURSLRQHJRFLR

,QIRUPDFLyQ*HQHUDO/HFFLyQ
(Q HVWD VHVLyQ GHVDUUROODUHPRV OD SULPHUD OHFFLyQ
,QWURGXFFLyQDOPXQGRGHO,QWHUQHW\YDPRVDFXEULU
ORVWHPDVGH
,QWHUQHW
/DZHE
/RVQDYHJDGRUHV
<DTXHHOREMHWLYRGHVHDGRHVTXHOOHJXHVD
GLIHUHQFLDUHOFRQFHSWRGH,QWHUQHW\OD:RUOG:LGH
:HE

Interiores.indd 73

5/9/13 6:29 PM

,QWHUQHW
3LHQVDSRUXQPRPHQWR
&yPRGHILQLUtDV,QWHUQHW"4XpVLJQLILFD
,QWHUQHWSDUDWL"
3XHVELHQ,QWHUQHWHVODPD\RUUHGGH
LQWHUFRQH[LyQGHUHGHVGHOPXQGRTXHSHUPLWHD
WRGRVVXVXVXDULRVODXWLOL]DFLyQGHVXVVHUYLFLRV
SRUPHGLRGHODVLPSOHFRQH[LyQDXQRGHORV
PLOORQHVGHVHUYLGRUHVTXHSURSRUFLRQDQDFFHVRD
ODUHG

,QWHUQHW
&DGDFRPSXWDGRUDHQODUHGLQWHUQDFLRQDOR
,QWHUQHWHVWiFRQHFWDGDSRUPHGLRGHFDEOHVUHDOHVR
FDEOHVHWKHUQHWOtQHDVWHOHIyQLFDV\HOFDEOHDGRGH
ILEUDySWLFDXELFDGRHQHOVXHORVXEPDULQR
(VLPSRUWDQWHUHFRQRFHUTXHHO,QWHUQHW\VX
IXQFLRQDPLHQWRQRVRQFRQWURODGRVSRUXQD
RUJDQL]DFLyQJRELHUQRRSHUVRQDHQHVSHFtILFRQL
WLHQHXQGXHxRVLQRTXHHVXQFRQMXQWR
GHVFHQWUDOL]DGRGHUHGHVGHFRPXQLFDFLyQ
LQWHUFRQHFWDGDV

Interiores.indd 74

5/9/13 6:29 PM

,QWHUQHW
([LVWHQWUHVFRQFHSWRVUHOHYDQWHVSDUDFRPSUHQGHUFyPR
RSHUD,QWHUQHW
&RQPXWDFLyQGHSDTXHWHV
3URWRFRORGHFRPXQLFDFLyQ7&3,3
&RPSXWDFLyQFOLHQWHVHUYLGRU
(VWRVWUHVFRQFHSWRVFRPSRQHQODEDVHGHO
IXQFLRQDPLHQWRGHO,QWHUQHW+DVHVFXFKDGRGHDOJXQR
GHHOORV"

,QWHUQHW
(OSULPHUFRQFHSWRTXHDQDOL]DUHPRVHVOD
FRQPXWDFLyQGHSDTXHWHVGHLQIRUPDFLyQVHUHILHUHD
XQPpWRGRGHHQYtRGHGDWRVHQHOTXHHOPHQVDMHVH
GHVFRPSRQHHQYDULRVIUDJPHQWRVFRQRFLGRVFRPR
SDTXHWHV\VHHQYtDFDGDXQRSRUVHSDUDGRSDUD
OXHJRVHUUHHQVDPEODGRVSRUHOUHFHSWRUHQHORUGHQ
DGHFXDGR
8QDDQDORJtDSDUDFRPSUHQGHUGHPHMRUPDQHUDOD
FRQPXWDFLyQGHSDTXHWHVSXHGHVHUHOVHUYLFLRSRVWDO

Interiores.indd 75

5/9/13 6:29 PM

,QWHUQHW
,PDJLQDFRPRVHUtDHQYLDUFDGDXQDGHODVSLH]DVGH
XQURPSHFDEH]DVTXHOOHJDUiQDOPLVPRGHVWLQDWDULR
SDUDVHUDUPDGRHQHOGHVWLQRILQDO

(OVHJXQGRFRQFHSWRUHOHYDQWHHVHOSURWRFROR
GHFRPXQLFDFLyQ7&3,3HOFXDOULJHHO,QWHUQHW
DFWXDOPHQWH\DTXHHVWDEOHFHODVFRQH[LRQHV
HQWUHFRPSXWDGRUDVGHHQYtR\GHUHFHSFLyQ\
PDQHMDHOHQVDPEODGRGHSDTXHWHVHQHOOXJDUGH
RULJHQ\UHFHSFLyQ

,QWHUQHW
(OPRGHOR7&3,3GHVFULEHXQFRQMXQWRGHJXtDV
JHQHUDOHVGHGLVHxRHLPSOHPHQWDFLyQHVSHFtILFDV
SDUDTXHXQHTXLSRSXHGDFRPXQLFDUVHHQXQDUHG
$VtPLVPRSURYHHFRQHFWLYLGDGHVSHFLILFDQGRFyPR
ORVGDWRVGHEHUtDQVHUIRUPDWHDGRVGLUHFFLRQDGRV
WUDQVPLWLGRVHQUXWDGRV\UHFLELGRVSRUHO
GHVWLQDWDULR
(VWHSURWRFRORGHFRPXQLFDFLyQ7&3,3EULQGDDO
XVXDULRODLPSUHVLyQGHXQDFRQH[LyQVLPSOHGH
PRGRTXHQRWLHQHTXHSUHRFXSDUVHVREUHHO
UHFRUULGRGHORVGDWRVDWUDYpVGHODUXWDSRUODTXH
YLDMDQ

Interiores.indd 76

5/9/13 6:29 PM

,QWHUQHW
&RQWLQXDQGRFRQHOHMHPSORGHOURPSHFDEH]DV
TXHIXHHQYLDGRHQGLIHUHQWHVSDTXHWHVFRQSLH]DV
VHSDUDGDVHOSURWRFRORGHFRPXQLFDFLyQ7&3,3
VHUtDHOLQVWUXFWLYRTXHLQGLFDFRPRDUPDUHO
URPSHFDEH]DV
(OWHUFHU\~OWLPRFRQFHSWRUHOHYDQWHSDUD
FRPSUHQGHUODRSHUDFLyQGH,QWHUQHWHVOD
DUTXLWHFWXUDFOLHQWHVHUYLGRU6XOOHJDGDSHUPLWLy
TXHHO,QWHUQHWVHGHVDUUROODUD\FUHFLHUDFRPROR
KDKHFKRKDVWDDKRUD

,QWHUQHW
(VWHVLVWHPDGHDUTXLWHFWXUDFRPSXWDFLRQDOVH
ULJHSRUFRPSXWDGRUDVSHUVRQDOHVFRQHFWDGDVD
XQDUHGFRQXQRRPiVVHUYLGRUHV
(QHVWHHVTXHPDHOFOLHQWHVROLFLWD\HOVHUYLGRU
HMHFXWDGLFKDVVROLFLWXGHVGHWUDEDMR$VtODV
FRPSXWDGRUDVHQODUHGVHGLYLGHQODVWDUHDVGH
SURFHVDPLHQWRHQWUHFOLHQWHV\VHUYLGRUHV
YROYLpQGRVHPiVHILFDFHV

Interiores.indd 77

5/9/13 6:29 PM

,QWHUQHW
(QUHVXPHQXQVHUYLGRUHVXQDDSOLFDFLyQTXHRIUHFH
XQVHUYLFLRDXVXDULRVGH,QWHUQHWXQFOLHQWHHVHOTXH
SLGHHVHVHUYLFLR*HQHUDOPHQWHXQVHUYLGRUSXHGH
WUDWDUP~OWLSOHVSHWLFLRQHVDOPLVPRWLHPSR
&RPRDQDORJtDSRGHPRVXVDUHOVLJXLHQWHHMHPSOR
FXDQGRDOJXLHQSUHJXQWDODKRUDDXQFRPSDxHURHO
GHPDQGDQWHDFW~DFRPRFOLHQWHRVROLFLWDQWHGH
LQIRUPDFLyQDOVHUYLGRURVXPLQLVWUDGRUGH
LQIRUPDFLyQ

,QWHUQHW
&UHHVTXH\DSXHGHVH[SOLFDUHVWRVWUHV
FRQFHSWRV"
%XVFDXQDLPDJHQFRUUHVSRQGLHQWHDFDGD
FRQFHSWRDQWHVGHVHJXLU
$KRUDTXHKHPRVUHSDVDGRORVFRQFHSWRV
FODYHGH,QWHUQHWFRQR]FDPRVPiVVREUHOD
PDQHUDHQODTXHKDHYROXFLRQDGRKDVWD
DKRUD

Interiores.indd 78

5/9/13 6:29 PM

&yPRKDHYROXFLRQDGR,QWHUQHW"
(O,QWHUQHWVXUJHDOUHGHGRUGHFRQHOSURSyVLWR
LQLFLDOGHFRPXQLFDUDODVFRPSXWDGRUDVHQFDGD
FDPSXVXQLYHUVLWDULR$ORODUJRGHDxRV,QWHUQHW
KDHYROXFLRQDGRGHPDQHUDH[WUDRUGLQDULD(VWD
HYROXFLyQSXHGHGLYLGLUVHHQWUHVHWDSDV

&yPRKDHYROXFLRQDGR,QWHUQHW"
/DSULPHUDHWDSD D HVFRQRFLGD
FRPRODHWDSDGHLQQRYDFLyQHQODFXDOVH
GHWHUPLQDQODVEDVHVIXQGDPHQWDOHVGHO,QWHUQHW
+DUGZDUH\6RIWZDUH(VWDVEDVHVVRQOD
FRQPXWDFLyQGHSDTXHWHVHOSURWRFRORGH
FRPXQLFDFLyQ7&3,3\ODFRPSXWDFLyQGH
FOLHQWHVHUYLGRUODVFXDOHV\DKHPRVUHYLVDGR

Interiores.indd 79

5/9/13 6:29 PM

&yPRKDHYROXFLRQDGR,QWHUQHW"
/DVHJXQGDHWDSDGH,QWHUQHWVHFRQRFHFRPR
LQVWLWXFLRQDOL]DFLyQ\VXUJHHQFXDQGR
JUDQGHVLQVWLWXFLRQHVFRPRHO'HSDUWDPHQWRGH
'HIHQVDGHORV(VWDGRV8QLGRVGHFLGHQLQYHUWLU
HQHVWHSUR\HFWRSDUDGHVDUUROODUXQVLVWHPDGH
FRPXQLFDFLyQPLOLWDU(QOD)XQGDFLyQ
1DFLRQDOGH&LHQFLDR16)SRUVXVVLJODVHQ
LQJOpVGHVDUUROODXQSODQDGLH]DxRVFRQXQD
LQYHUVLyQGHPLOORQHVGHGyODUHVSDUD
H[SDQGLUHO,QWHUQHW\GHVDUUROODUXQ,QWHUQHWFLYLO

&yPRKDHYROXFLRQDGR,QWHUQHW"
/DWHUFHUDHWDSDHVFRQRFLGDFRPRHWDSDGH
FRPHUFLDOL]DFLyQ\FRPLHQ]DHQFXDQGRVH
SURPXHYHODSDUWLFLSDFLyQSULYDGDSDUDH[SDQGLU
WDQWRORVFLPLHQWRVGHO,QWHUQHWFRPRODRIHUWDGH
VHUYLFLRVDODVRFLHGDGHQJHQHUDO(VHQHVWHDxR
FXDQGRODVSULQFLSDOHVFRPSDxtDVGH
FRPXQLFDFLRQHV(VWDGRXQLGHQVHVWRPDQFRQWUROGH
ODRSHUDFLyQFHQWUDOGHO,QWHUQHW
0iVWDUGHVXUJHODQHFHVLGDGGHFRQHFWDUVHGH
PDQHUDLQDOiPEULFD3DUDHODxRODFRQH[LyQ
:L)LHVWDED\DGLVSRQLEOHDOS~EOLFRHQJHQHUDO

Interiores.indd 80

5/9/13 6:29 PM

&yPRKDHYROXFLRQDGR,QWHUQHW"
(QHOORVWHOpIRQRVLQWHOLJHQWHVR
VPDUWSKRQHVGDQDFFHVRDXQDQXHYDSODWDIRUPD
SHUPLWLHQGRTXHUHDOPHQWHVHWHQJDDFFHVRD
,QWHUQHWHQFXDOTXLHUPRPHQWRROXJDU
$FWXDOPHQWHVHJXLPRVHQHVWDHWDSD\HODFFHVRD
,QWHUQHWVLJXHFUHFLHQGR'HDFXHUGRDGDWRVGHO
%DQFR0XQGLDOORVXVXDULRVGH,QWHUQHWSDVDURQGH
HQDHQ

,QWHUQHW
$KRUD\DFRQRFHVODKLVWRULD\ODHYROXFLyQTXHKD
WHQLGR,QWHUQHWKDVWDKR\(VLPSRUWDQWHWDPELpQ
DSXQWDUTXH,QWHUQHWLQFOX\HGLIHUHQWHVVHUYLFLRV
HQWUHHOORVHVWiSRUHMHPSOROD:HEHOFRUUHR
HOHFWUyQLFRODPHQVDMHUtDLQVWDQWiQHDHQWUHRWURV
$FRQWLQXDFLyQKDEODUHPRVVREUHOD:RUOG:LGH
:HEXQRGHORVVHUYLFLRVGH,QWHUQHWTXHPiV
p[LWRKDWHQLGR

Interiores.indd 81

5/9/13 6:29 PM

/D:RUOG:LGH:HE
/D:RUOG:LGH:HERR5HG0XQGLDOHVVyORXQDSDUWH
GH,QWHUQHW/D5HGHVXQRGHORVVHUYLFLRVGH,QWHUQHW
PiV XWLOL]DGRV \ SURYHH DFFHVR D SiJLQDV ZHE ODV
FXDOHVVHSXHGHQYLVLWDUXWLOL]DQGRXQQDYHJDGRUTXH
HVXQSURJUDPDLQVWDODGRHQODFRPSXWDGRUD
/DHYROXFLyQGHOD:HESXHGHGLYLGLUVHHQWUHVHWDSDV
:HE
:HE
:HE

/D:RUOG:LGH:HE
/DHWDSDLQLFLDOGHODUHGPXQGLDOHVFRQRFLGD
FRPR:HE<VHFDUDFWHUL]DSRU

Interiores.indd 82

3iJLQDVZHEHVWiWLFDVHLQIRUPDWLYDV
8VXDULRVFRPROHFWRUHVRUHFHSWRUHV
,QWHUDFFLyQPtQLPD
'LVFXUVROLQHDOHQWUHHPLVRU\UHFHSWRU
6LWLRV12FRODERUDWLYRV
%DMDDFWXDOL]DFLyQGHVLWLRVZHE

5/9/13 6:29 PM

/D:RUOG:LGH:HE
&RQODOOHJDGDGHOD:HEODUHGPXQGLDO
FRPLHQ]DDFRQVWUXLUVFDGDGtDSRUPLOORQHVGH
XVXDULRVTXHFRQWULEX\HQFRQLQIRUPDFLyQ
$OJXQDVFDUDFWHUtVWLFDVUHOHYDQWHVGHHVWDHWDSD
GHOD:HEVRQ
8VXDULRVFRPRSURGXFWRUHVGHFRQWHQLGR
:HEFRODERUDWLYD
)DFLOLGDGGHLQWHUDFFLyQ
,QIRUPDFLyQHQFDPELRSHUPDQHQWH
)DFLOLGDGGHDFFHVRDVRIWZDUH
JUDWXLWRVRGHPX\EDMRFRVWR

/D:RUOG:LGH:HE
7RGDVHVWDVDSRUWDFLRQHVKDQOOHYDGRDODUHG
PXQGLDODXQDWHUFHUDHWDSD/D:HEODZHE
LQWHOLJHQWH\RPQLSUHVHQWH(VWDYHUVLyQQRHV
WRWDOPHQWHGLIHUHQWHGHODDQWHULRUSHURDxDGH
FDUDFWHUtVWLFDVTXHSHUPLWHQFRQRFHUORVJXVWRVGH
ORVXVXDULRVDWUDYpVGHVLVWHPDVGHDSUHQGL]DMH
VREUHHOFRPSRUWDPLHQWRGHORVFLEHUQDXWDV'HHVWH
PRGRORVXVXDULRVVHWRSDQFRQLQIRUPDFLyQTXHOHV
JXVWD\HYLWDQDTXHOODTXHOHVGLVJXVWD3RUHMHPSOR
$PD]RQR1HWIOL[UHFRPLHQGDQDOXVXDULRFRQEDVH
HQORTXHKDQFRPSUDGRRYLVWR

Interiores.indd 83

5/9/13 6:29 PM

/D:RUOG:LGH:HE
/D:HEUHSUHVHQWDDOLQWHUQHWGLVSRQLEOH
VLHPSUH\HQWRGROXJDU\HVWRKDRFDVLRQDGRTXH
ODUHGVHDPHQRVYLVLEOHFDGDYH]HVGHFLU\DQR
HVUHSUHVHQWDGDSRUJUDQGHVFRPSXWDGRUDVDKRUD
FDGDYH]PiVODUHGPXQGLDOHVWiFRQIRUPDGDSRU
XVXDULRVHQWRGDVSDUWHVGHVGHVXV
FRPSXWDGRUDVWHOpIRQRVLQWHOLJHQWHV\RWURV
GLVSRVLWLYRVPyYLOHV

/D:RUOG:LGH:HE
2WUDFDUDFWHUtVWLFDGHOD:HEHVTXHODV
DSOLFDFLRQHV\ORVSURJUDPDVDKRUDHVWiQ
GLVSRQLEOHVHQODQXEHVLQODQHFHVLGDGGH
DORMDUORVHQWXFRPSXWDGRUD3RUHMHPSOR\DQR
QHFHVLWDVLQVWDODUXQSURJUDPDGHSDTXHWHUtDGH
KHUUDPLHQWDVDKRUDSXHGHVDFFHVDUORGHVGH
FXDOTXLHUFRPSXWDGRUDFRQFRQH[LyQDLQWHUQHWD
WUDYpVGHWXFXHQWD
/D:HEH[SUHVDODHYROXFLyQGHOXVR\OD
LQWHUDFFLyQGHODVSHUVRQDVHQ,QWHUQHW

Interiores.indd 84

5/9/13 6:29 PM

/D:RUOG:LGH:HE
3HUR&yPRSRGHPRVDFFHGHUDWRGDHVWD
LQIRUPDFLyQDOPDFHQDGDHQODZHE"
$WUDYpVGHORVSRSXODUHV1DYHJDGRUHV
&RQRFHVDOJXQRV"
5HIOH[LRQDXQPRPHQWR

8Q1DYHJDGRU
8QZHEEURZVHURQDYHJDGRUHVXQSURJUDPD
LQVWDODGRHQWXFRPSXWDGRUDTXHRSHUDDWUDYpVGH
,QWHUQHW\WHSHUPLWHYLVLWDUSiJLQDV\VLWLRVZHE
/DPDQHUDHQTXHWUDEDMDXQQDYHJDGRUHV
LQWHUSUHWDQGRDUFKLYRV\VLWLRVZHEGHVDUUROODGRV
JHQHUDOPHQWHHQFyGLJR+70/TXHFRQWLHQHQ
LQIRUPDFLyQ\FRQWHQLGRGHWRGDVSDUWHVGHO
PXQGR\HVWRSHUPLWHODYLVXDOL]DFLyQGH
GRFXPHQWRV\VLWLRVHQKLSHUWH[WR

Interiores.indd 85

5/9/13 6:29 PM

8Q1DYHJDGRU
/DSULQFLSDOIXQFLyQGHOQDYHJDGRUHVSRQHUUiSLGD\
VHQFLOODPHQWHDODOFDQFHGHOXVXDULRWRGDOD
LQIRUPDFLyQTXHKDVLGRLQFOXLGDHQOD:RUOG:LGH
:HE
$OJXQRVQDYHJDGRUHVXWLOL]DGRVSRSXODUPHQWHVRQ
*RRJOH&KURPH0R]LOOD)LUHIR[6DIDUL,QWHUQHW
([SORUHUHQWUHRWURV&DGDXQRGHHOORVFXHQWDFRQ
GLVWLQWDVFDUDFWHUtVWLFDVSHURHQJHQHUDOFRPSDUWHQ
XQFULWHULRTXHOHVSHUPLWHPRVWUDUWH[WRJUiILFRV
YLGHRVRQLGRDQLPDFLRQHV\HMHFXWDUSURJUDPDV

0iVDOOiGHORV1DYHJDGRUHV
3HURPiVDOOiGHORVQDYHJDGRUHVDKRUDH[LVWHQ
ODV$SSV6DEHVTXHHVXQD$SS"
8Q$33HVXQDDSOLFDFLyQRSURJUDPD
HVSHFLDOL]DGRSDUDIXQFLRQDUHQGLVSRVLWLYRV
PyYLOHV8Q$33WHSHUPLWHQDYHJDUHQLQWHUQHW
GDQGRFOLFNGHVGHWXGLVSRVLWLYRLQWHOLJHQWH/D
GHPDQGDVREUHHOGHVDUUROORGH$336HVFDGDYH]
PD\RUGHELGRDODFUHFLHQWHWHQGHQFLDGHORV
FRQVXPLGRUHVSDUDQDYHJDUHQLQWHUQHWDWUDYpVGH
GLVSRVLWLYRVPyYLOHV

Interiores.indd 86

5/9/13 6:29 PM

0DVDOOiGHORV1DYHJDGRUHV
$OJXQRVEXHQRVHMHPSORVVRQ$SSGH&LQpSROLV
$SSGH(O8QLYHUVDO$SSGH)DFHERRN$SSGH
7ZLWWHUHQWUHRWURV
7XTXH$SSVFRQRFHVRXWLOL]DV"

&LHUUH
+DFLHQGRXQUHVXPHQGHORDSUHQGLGRHQHVWD
VHVLyQSRGHPRVGHFLUTXHHO,QWHUQHWHVXQDUHG
JOREDOGHPLOORQHVGHFRPSXWDGRUDVTXHHVWiQSRU
WRGRHOPXQGRWRGDVFRQHFWDGDVHQWUHVt/D
:RUOG:LGH:HEHVXQDSDUWHGHOLQWHUQHWTXH
SURYHHDFFHVRDGLIHUHQWHVVLWLRV\SiJLQDVZHE<
XQQDYHJDGRUFRPRVXQRPEUHORGLFHHVHO
SURJUDPDTXHQRVSHUPLWHDFFHGHUDHVD
LQIRUPDFLyQQDYHJDQGRSRU,QWHUQHW

Interiores.indd 87

5/9/13 6:29 PM

&LHUUH
&RQHVWRFRQFOXLPRVQXHVWUDSULPHUDOHFFLyQGHOFXUVR
GHFRPHUFLRHOHFWUyQLFRSDUDHPSUHVDULRV(QHO
VLJXLHQWHYLGHRQRVDGHQWUDUHPRVHQHOFRQFHSWRGH
FRPHUFLRHOHFWUyQLFR\ODVYHQWDMDVTXHWLHQHHVWH
PRGHORGHQHJRFLR
3HURDQWHVORVLQYLWRDTXHSDUWLFLSHQHQHOIRURGH
GLVFXVLyQUHVSRQGLHQGR
 &XiOHVODGLIHUHQFLDHQWUH,QWHUQHW\OD:HE"
 (QTXHVHSDUHFHXQQDYHJDGRU\XQ$33"

+DVWDSURQWR

Interiores.indd 88

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 1: Introduccin al Mundo de Internet
______________________________________________________________________________

Instrucciones: Ya has concluido la Leccin # 1 del Curso Bsico de Comercio Electrnico.


Repasa lo aprendido respondiendo a las siguientes preguntas:
1. Define el concepto de Internet en menos de un prrafo.
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
2. Cmo surge Internet?

3. Cules son los tres componentes bsicos para el funcionamiento de Internet?


a)
b)
c)
4. Qu metfora utilizamos para explicar la Conmutacin de Paquetes?

5. Cul es la diferencia entre Internet y la Web?

6. Menciona dos caractersticas de las diferentes etapas de evolucin de la Red Mundial:

Interiores.indd 89

Web 1.0

Web 2.0

Web 3.0

a)
b)

a)
b)

a)
b)

5/9/13 6:29 PM

7. Qu es un navegador?

8. Qu ejemplos de navegadores se mencionaron? Se te ocurre alguno ms?Cul?

9. Qu propsito tienen las APPs?

10. Da 3 ejemplos de APPs que se hayan mencionado en el video o tu conozcas.


a)
b)
c)

Interiores.indd 90

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 2
Qu es el comercio electrnico?
Duracin:

30 min

Objetivo de aprendizaje: Definir comercio electrnico y sealar las diferentes ventajas


que trae para los comercios.
Subtemas:

Qu es el comercio electrnico?
Ventajas de comercio electrnico
Tendencias del e-commerce

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a internet

Agenda:
Contenido:
Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo
1. Qu es el comercio electrnico?

D 4-5:
-Definicin en el fondo.
- Se van resaltando las palabras clave.

1.1 Definicin de e-commerce o comercio


electrnico (AMIPCI)
- Desglose de la definicin.
1.2 Desarrollo histrico del e-commerce
1.3 Panorama del comercio electrnico
1.4 Implicaciones del comercio electrnico para

Interiores.indd 91

Notas de Produccin:

D 3:
- Texto en el fondo

D 6:
- Aparecen de un lado del locutor caractersticas
o imgenes de e-business (supermercado
moderno) y del otro de e-commerce

5/9/13 6:29 PM

los comercios

D 7:
-El banner que AT&T public en Hotwired.com
en Octubre de 1994
D 8:
- Usuarios a nivel mundial
D9:
- Texto de porcentajes en el fondo
D 11:
- tecnologa, negocio, sociedad
D 12:
- tecnologa, negocio, sociedad, se resalta
tecnologa
D 13-14:
- tecnologa, negocio, sociedad, se resalta
negocio
- aparecen logos de e-Bay, Netflix y Groupon
D 15:
- tecnologa, negocio, sociedad, se resalta
sociedad

2. Ventajas del comercio electrnico


- Introduccin a las ventajas del e-commerce
- Caractersticas del e-commerce que
representan una ventaja para empresas y
consumidores.

D 17:
- Preguntas en el fondo mientras se plantean
D 19- 26:
- Que aparezca cada palabra con su definicin y
posiblemente una imagen.
D 27:
- Aparece la lista de caractersticas

3. Tendencias del e-commerce

D 28:
- Texto en el fondo: estadsticas

- Nuevas tendencias en el comercio electrnico

Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 92

D 31:
- Pasar las preguntas de reflexin en el fondo de
la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ4XpHVHOFRPHUFLRHOHFWUyQLFR"

,QIRUPDFLyQ*HQHUDO
+ROD ELHQYHQLGR GH QXHYR DO FXUVR GH H
FRPPHUFH $KRUD TXH \D VDEHV OR TXH HV HO
,QWHUQHW \ SXHGHV GLVWLQJXLUOR GH OD :HE \ ORV
QDYHJDGRUHVSRGHPRVHQWUDUGHOOHQRDOWHPDGH
FRPHUFLRHOHFWUyQLFR
(O WHPD JHQHUDO GH HVWD OHFFLyQ HV SUHFLVDPHQWH
4XpHVHOFRPHUFLRHOHFWUyQLFR"
<GHQWURGHHVWHWHPDSURIXQGL]DUHPRVHQ
/DGHILQLFLyQGHOFRPHUFLRHOHFWUyQLFR
/DVYHQWDMDVGHOHFRPPHUFH
/DVWHQGHQFLDVGHOHFRPPHUFHDQLYHOJOREDO

Interiores.indd 93

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
<DTXHHOREMHWLYRGHDSUHQGL]DMHHVTXHDOILQDOL]DU
HVWDVHVLyQSXHGDV'HILQLUHOFRPHUFLRHOHFWUyQLFR
\VHxDODUODVGLIHUHQWHVYHQWDMDVTXHWUDHSDUDORV
FRPHUFLRV
4XpHQWLHQGHVSRUFRPHUFLRHOHFWUyQLFR"
4XpHVORTXH\DVDEHVGHOWHPD"
VHJXQGRVGHUHIOH[LyQ 

4XpHVHOFRPHUFLRHOHFWUyQLFR"
(O FRPHUFLR HOHFWUyQLFR R HFRPPHUFH VH GHILQH
FRPRHOLQWHUFDPELRGHELHQHV\VHUYLFLRVUHDOL]DGR
D WUDYpV GH ODV 7HFQRORJtDV GH OD ,QIRUPDFLyQ \ ODV
&RPXQLFDFLRQHV KDELWXDOPHQWH FRQ HO VRSRUWH GH
SODWDIRUPDV\SURWRFRORVHVWDQGDUL]DGRV
3DUDHQWHQGHUPHMRUHVWDGHILQLFLyQHVLPSRUWDQWH
UHVDOWDUORVFRQFHSWRVTXHODLQWHJUDQ
([LVWHXQ,QWHUFDPELRRWUDQVDFFLyQFRPHUFLDO
6HUHTXLHUHQ%LHQHV\RVHUYLFLRV\DVHDQ
)tVLFRVRGLJLWDOHV
6HUHDOL]DFRQHOVRSRUWHGHODVWHFQRORJtDVGHOD
,QIRUPDFLyQ\ODV&RPXQLFDFLyQ7,&V

Interiores.indd 94

5/9/13 6:29 PM

4XpHVHOFRPHUFLRHOHFWUyQLFR"
*HQHUDOPHQWH VH FRQIXQGH HO WpUPLQR H
FRPPHUFH FRQ HEXVLQHVV (Q HVWH FXUVR QRV
UHIHULPRV DO HEXVLQHVV FRPR HO SURFHVR GH
GLJLWDOL]DU ODV WUDQVDFFLRQHV \ SURFHGLPLHQWRV
GHQWUR GH XQD HPSUHVD LQFOX\HQGR ORV VLVWHPDV
GHLQIRUPDFLyQ
8QHMHPSORGHHVWRVHUtDXQLQYHQWDULRHQOtQHDGH
FRQWUROLQWHUQRRXQVHUYLFLRGHFRUUHRHOHFWUyQLFR
3RU HO FRQWUDULR HO HFRPPHUFH LQFOX\H
WUDQVDFFLRQHV FRPHUFLDOHV HQ ODV TXH VH GD XQ
LQWHUFDPELR GH YDORU D WUDYpV GH RUJDQL]DFLRQHV
\R LQGLYLGXRV 3XHV ELHQ HVWH VHUi HO WHPD TXH
WUDWDUHPRVDORODUJRGHOFXUVR

'HVDUUROORKLVWyULFRGHOH FRPPHUFH
'HVDUUROORKLVWyULFRGHOHFRPPHUFH
3DUDFRPSUHQGHUHOHFRPPHUFHYHDPRVFyPRVH
KDYHQLGRGHVDUUROODQGRHQORV~OWLPRVDxRV
$ILQDOHVGHDSDUHFHHOSULPHUEDQQHU
SXEOLFLWDULRHQOtQHD$7 79ROYR\6SULQWHQ
+RWZLUHGFRP
$&7,9,'$'3RQSDXVDDOYLGHR\EXVFDHQ
LPiJHQHVGHJRRJOHORVLJXLHQWH
%DQQHU$7 72FWXEUH

Interiores.indd 95

5/9/13 6:29 PM

3DUD1HWVFDSHH,QIRVHHNLQLFLDQODYHQWDGH
HVSDFLRVSXEOLFLWDULRVHQOtQHD
+DVWDDQWHVGHOORVFRQVXPLGRUHVXWLOL]DEDQ
HO,QWHUQHWSDUDLQYHVWLJDUFRVWRVGLVSRQLELOLGDGGH
SURGXFWRV\UHDOL]DUFRPSDUDFLRQHV
<DHQHOODVUHGHVVRFLDOHVFRPLHQ]DQD
LPSDFWDUDOFRPHUFLRHOHFWUyQLFR
3DUD HO  ORV FLEHUFRQVXPLGRUHV HQ (VWDGRV
8QLGRVJDVWDQPiVGHPLOPLOORQHVGHGyODUHV
\ ORV QHJRFLRV PiV GH  ELOORQHV GH GyODUHV HQ
FRPSUDVHQ,QWHUQHW
$FWXDOPHQWH HO  GH ODV SHUVRQDV D QLYHO
PXQGLDOWLHQHQDFFHVRD,QWHUQHW\FRPRVHSXHGH
REVHUYDUHQODJUiILFDHOQ~PHURGHXVXDULRVHVWi
HQXQDXPHQWRFRQVWDQWH

3DQRUDPDGHOHFRPPHUFH
,QGXGDEOHPHQWH (VWDGRV 8QLGRV \ &DQDGi VRQ
SDtVHV FRQ XQ SRUFHQWDMH DOWR GH XVXDULRV (O
GHORV(VWDGRXQLGHQVHVHVWiQHQOtQHD\HO
GHHOORVKDQFRPSUDGRHQOtQHDHQXQDGHODV
PiVGHPLOORQHVGHWLHQGDVTXHSDUWLFLSDQHQHO
FRPHUFLRHOHFWUyQLFR
(VWXGLRV GHPXHVWUDQ TXH HQ  ODV YHQWDV HQ
OtQHD DVFHQGLHURQ D  PLO PLOORQHV GH GyODUHV
GHMDQGR JDQDQFLDV GH FHUFD GH  PLO PLOORQHV
GHGyODUHVDORVQHJRFLRV

Interiores.indd 96

5/9/13 6:29 PM

3DQRUDPDGHOHFRPPHUFH
$ QLYHO PXQGLDO ORV VHFWRUHV SURGXFWLYRV PiV
IDYRUHFLGRV SRU ORV FLEHUFRQVXPLGRUHV VRQ OLEURV
URSD YLGHRV '9'V MXHJRV EROHWRV GH DYLyQ \
HTXLSRHOHFWUyQLFR
(Q 0p[LFR HO VHFWRU WXUtVWLFR KD VLGR HO PiV
IDYRUHFLGR SRU HO FRPHUFLR HOHFWUyQLFR GHVGH VX
OOHJDGD VLQ HPEDUJR HQ ORV ~OWLPRV DxRV VRQ FDGD
YH]PiVORVVHJPHQWRVGHOPHUFDGRTXHSDUWLFLSDQ\
VRQ H[LWRVRV HQ HO FRPHUFLR HOHFWUyQLFR (Q XQD
OHFFLyQ SRVWHULRU YHUHPRV FRQ PD\RU GHWDOOH OD
VLWXDFLyQGHOFRPHUFLRHOHFWUyQLFRHQQXHVWURSDtV

,PSOLFDFLRQHVGHOH FRPPHUFH
,PSOLFDFLRQHVGHOHFRPPHUFH
4XpLPSOLFDHOFRPHUFLRHOHFWUyQLFR"
$&7,9,'$'
+D] XQD OOXYLD GH LGHDV DOUHGHGRU GHO FRQFHSWR H
FRPPHUFH HQ GRQGH HQJOREHV WRGRV ORV IDFWRUHV
TXHFUHDVTXHHVWiQUHODFLRQDGRV
0X\ELHQFRPRSXGLVWHGDUWHFXHQWDHQWXOOXYLDGH
LGHDV HO FRPHUFLR HOHFWUyQLFR HQJORED GLIHUHQWHV
IDFWRUHV $FWXDOPHQWH QR VH SXHGH KDEODU GH
FRPHUFLR HOHFWUyQLFR VLQ FRQVLGHUDU WUHV WHPDV
LQWHUUHODFLRQDGRVWHFQRORJtDQHJRFLR\VRFLHGDG

Interiores.indd 97

5/9/13 6:29 PM

,PSOLFDFLRQHVGHOHFRPPHUFH
(O HFRPPHUFH HV VREUH WRGR XQ IHQyPHQR
GLULJLGRSRUODWHFQRORJtDHQVXFHQWURHO,QWHUQHW
\ OD 5HG R :RUOG :LGH :HE FRQFHSWRV TXH
IXHURQH[SOLFDGRVHQODOHFFLyQDQWHULRU
$GHPiV H[LVWHQ WHFQRORJtDV FRPSOHPHQWDULDV
FRPR OR VRQ ODV FRPSXWDGRUDV SHUVRQDOHV ORV
WHOpIRQRVLQWHOLJHQWHVODQXEHHQWUHRWUDV

,PSOLFDFLRQHVGHOHFRPPHUFH
(VWDV WHFQRORJtDV KDQ SHUPLWLGR HO GHVDUUROOR GH
DSOLFDFLRQHV GH QHJRFLRV FRPR VLVWHPDV GH
DGPLQLVWUDFLyQ GH OD FDGHQD GH VXPLQLVWUR VLVWHPDV GH
SODQHDFLyQ GH ORV UHFXUVRV GH PDQXIDFWXUD \ VLVWHPDV
GHDGPLQLVWUDFLyQGHUHODFLRQHVFRQFOLHQWHV
([LVWHQRWURVFRPSRQHQWHVWHFQROyJLFRVFRPRSURWRFRORV
LQIRUPiWLFRV SODWDIRUPDV GLJLWDOHV PyYLOHV VHUYLGRUHV
ZHE \ KHUUDPLHQWDV GH SURJUDPDFLyQ GH VRIWZDUH TXH
SHUPLWHQ FRPSUHQGHU HO HFRPPHUFH D SURIXQGLGDG
(VWRVWHPDVORVH[SOLFDUHPRVHQOHFFLRQHVSRVWHULRUHV

Interiores.indd 98

5/9/13 6:29 PM

,PSOLFDFLRQHVGHOHFRPPHUFH
0LHQWUDV TXH OD WHFQRORJtD SURYHH OD LQIUDHVWUXFWXUD
SDUD HO FRPHUFLR HOHFWUyQLFR HV OD SDUWH GH QHJRFLR
ORTXHORKDKHFKRLQWHUHVDQWH
/DVQXHYDVWHFQRORJtDVKDQSHUPLWLGRDORVQHJRFLRV
\ HPSUHQGHGRUHV UHRUJDQL]DU ODV IRUPDV GH
SURGXFFLyQ \ WUDQVDFFLyQ 3RU HVWR HV QHFHVDULR
FRQVLGHUDU QXHYRV PRGHORV GH QHJRFLR DQDOL]DU HO
FRPSRUWDPLHQWRGHORVFRQVXPLGRUHVHQHOPHUFDGR
GLJLWDO ORV ELHQHV GLJLWDOHV OD HVWUXFWXUD GH OD
LQGXVWULD \ RWURV IDFWRUHV TXH PRGLILFDQ HO PHUFDGR
WUDGLFLRQDO

(MHPSORV GH HVWR SRGUtDQ VHU ORV PRGHORV


LQFRUSRUDGRV SRU HPSUHQGHGRUHV FRPR H%D\
1HWIOL[\*URXSRQTXHKDQVXUJLGRDSDUWLUGHODV
ERQGDGHV TXH SURYHH HO FRPHUFLR HOHFWUyQLFR \
TXHVLPSOHPHQWHQRSRGUtDQH[LVWLUVLQpO
0iV DGHODQWH HQ ODV OHFFLRQHV   \  QRV
RFXSDUHPRVGHORVPRGHORVGHQHJRFLRHQOtQHD
3RU RWUD SDUWH HV LQQHJDEOH TXH HO ,QWHUQHW KD
WHQLGR XQ LPSDFWR VLJQLILFDWLYR D QLYHO JOREDO FRQ
PiVGHPLOPLOORQHVGHXVXDULRVHQHOPXQGR

Interiores.indd 99

5/9/13 6:29 PM

3RU HOOR VH UHTXLHUH UHIOH[LRQDU VREUH WHPDV


VRFLDOHV LPSDFWDGRV SRU HO FRPHUFLR HOHFWUyQLFR
FRPR OR HV OD SULYDFLGDG LQGLYLGXDO SURSLHGDG
LQWHOHFWXDO \ ODV SROtWLFDV GH ELHQHVWDU S~EOLFR
WHPDV TXH GLVFXWLUHPRV HQ OHFFLRQHV SRVWHULRUHV
\D TXH DKRUD KDEODUHPRV VREUH ODV YHQWDMDV TXH
RIUHFHHOFRPHUFLRHOHFWUyQLFRDVXVXVXDULRV

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
(O FRPHUFLR HOHFWUyQLFR KD WUDtGR QXHYDV
RSRUWXQLGDGHV FRPHUFLDOHV WDQWR SDUD HPSUHVDV
FRPRSDUDFRQVXPLGRUHV(ODFFHGHUDSURGXFWRV\
VHUYLFLRVHQOtQHDKDSHUPLWLGRDOFRQVXPLGRUWHQHU
PD\RUFDSDFLGDGSDUDEXVFDUFRPSDUDU\FRPSUDU
SURGXFWRV\ODRSFLyQGHSRGHUKDFHUORHQFXDOTXLHU
PRPHQWR\HQFXDOTXLHUOXJDU
$ODYH]ODRIHUWDGHSURGXFWRV\VHUYLFLRVDORVTXH
VH SXHGH WHQHU DFFHVR VH KD DPSOLDGR LQFOX\HQGR
OD RIHUWD GH SURYHHGRUHV HQ WRGR HO PXQGR
SHUPLWLHQGR VDWLVIDFHU PHMRU ODV SUHIHUHQFLDV
SHUVRQDOHV

Interiores.indd 100

5/9/13 6:29 PM

$GHPiV HO DXPHQWR GH OD WUDQVSDUHQFLD KD


LQWHQVLILFDGR OD FRPSHWHQFLD D PHQXGR UHVXOWDQGR HQ
SUHFLRVPiVEDMRVSDUDORVFRQVXPLGRUHV
$&7,9,'$'%XVFDODSDODEUDPRFKLODHQWXEXVFDGRU
GH SUHIHUHQFLD \ DQDOL]D OD RIHUWD \ YDULHGDG HQ HO
PHUFDGR
(V DVt FRPR HO FRPHUFLR HOHFWUyQLFR KD WUDtGR QXHYDV
RSRUWXQLGDGHV FRPHUFLDOHV WDQWR SDUD HPSUHVDV FRPR
SDUDORVFRQVXPLGRUHV$PEDVSDUWHVWLHQHQODYHQWDMD
GHWHQHUXQDWLHQGDDELHUWDGtDVDODxRKRUDVDO
GtD \ OD IOH[LELOLGDG GH SRGHU OOHYDU D FDER OD FRPSUD
YHQWD GHVGH FXDOTXLHU SDUWH GHO PXQGR FRQ DFFHVR D
,QWHUQHW

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
$OJXQDYH]KDVFRPSUDGRHQOtQHD"
4XpYHQWDMDVSHUFLELVWHHQWXH[SHULHQFLD"
3RGHPRV GHFLU TXH H[LVWHQ RFKR FDUDFWHUtVWLFDV
GHO FRPHUFLR HOHFWUyQLFR TXH RIUHFHQ YHQWDMDV D
VXV XVXDULRV XELFXLGDG DOFDQFH JOREDO
HVWiQGDUHV XQLYHUVDOHV ULTXH]D LQWHUDFWLYLGDG
GHQVLGDG GH LQIRUPDFLyQ SHUVRQDOL]DFLyQ \
WHFQRORJtDVRFLDO
(VWDVSDUWLFXODULGDGHVKDFHQTXHODPRGDOLGDGGH
FRPHUFLRHOHFWUyQLFRVHDXQQHJRFLRDWUDFWLYR
$QDOL]HPRVFDGDXQDGHHOODV

Interiores.indd 101

5/9/13 6:29 PM

/D FDUDFWHUtVWLFD GH XELFXLGDG VH UHODFLRQD D OD


FDSDFLGDG GHO FRPHUFLR HOHFWUyQLFR GH HVWDU GLVSRQLEOH
FDVLHQWRGRVODGRV\DWRGDKRUD(VWRHOLPLQDODVEDUUHUD
GHO HVSDFLR ItVLFR \ SHUPLWH D ORV FRQVXPLGRUHV KDFHU
FRPSUDV GHVGH VX KRJDU RILFLQD R KDVWD VX FDUUR
XWLOL]DQGRODWHFQRORJtDPyYLO
&XiQWDV SHUVRQDV QR LQWHQWDQ VDOLU D WLHPSR GH OD
RILFLQD SDUD DOFDQ]DU D FRPSUDU XQ SDU GH ]DSDWRV TXH
QHFHVLWDQ\VHSDVDQODVVHPDQDV\QROHVGDHOWLHPSR
SDUD KDFHUOR" *UDFLDV DO FRPHUFLR HOHFWUyQLFR DKRUD
SXHGHQPDQGDUSHGLUORTXHQHFHVLWHQDODKRUDTXHPiV
OHVFRQYHQJD\WHQHUORHQVXFDVDKDVWDHQPHQRVGH
GtDV

(O FRQFHSWR GH DOFDQFH VH UHILHUH DO Q~PHUR GH


XVXDULRV WRWDOHV R FRQVXPLGRUHV TXH XQ QHJRFLR HQ
OtQHD SXHGH REWHQHU  $ GLIHUHQFLD GHO FRPHUFLR
WUDGLFLRQDO TXH SXHGH OOHJDU D FRQVXPLGRUHV ORFDOHV
RUHJLRQDOHVHOHFRPPHUFHWLHQHXQDOFDQFHJOREDO
3HQVDQGR TXH KD\ PiV GH  PLOORQHV SHUVRQDV
HQOtQHDHVWRVHYXHOYH08<DWUDFWLYR
2WUD FDUDFWHUtVWLFD TXH HV QHFHVDULD UHFRQRFHU HV
TXH HO FRPHUFLR HOHFWUyQLFR VH ULJH SRU HVWiQGDUHV
XQLYHUVDOHV \D TXH ORV HVWiQGDUHV WpFQLFRV GHO
,QWHUQHWVRQLJXDOHVSDUDWRGRVORVSDtVHV

Interiores.indd 102

5/9/13 6:29 PM

(VWR SHUPLWH HQFRQWUDU IiFLOPHQWH ORV SURYHHGRUHV


SUHFLRV \ WpUPLQRV GH HQWUHJD GH XQ SURGXFWR HQ
FXDOTXLHU SDUWH GHO PXQGR (VWR WDPELpQ UHGXFH ORV
FRVWRVGHHQWUDGDDOPHUFDGRPXQGLDO
/D FDUDFWHUtVWLFD GH ULTXH]D VH UHILHUH D OD
FRPSOHMLGDG \ HO FRQWHQLGR GH XQ PHQVDMH HO
FRPHUFLRHOHFWUyQLFRSHUPLWHRIUHFHULQIRUPDFLyQULFD
HQ FRQWHQLGRV VREUH ORV SURGXFWRV RIUHFLGRV VLQ
VDFULILFDU OD LQWHUDFFLyQ SHUVRQDO (Q OD SiJLQD :HE
VH SXHGHQ LQFOXLU YLGHRV DXGLR \ WH[WR VREUH HO
SURGXFWR SDUD HQULTXHFHU OD H[SHULHQFLD GHO
FRQVXPLGRU

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
/DVWHFQRORJtDVGHOHFRPPHUFHSHUPLWHQTXH
H[LVWDLQWHUDFFLyQFRQWLQXDHQWUHHOSURYHHGRU\HO
FRQVXPLGRUDVHPHMiQGRVHDODH[SHULHQFLDGHOD
LQWHUDFFLyQItVLFDGLUHFWDSHURORJUDQGRTXHVHD
GHIRUPDPDVLYD\JOREDO
8Q HMHPSOR GH HVWR SXHGH VHU HO FKDW HQ OtQHD D
WUDYpV GHO FXDO HO FRQVXPLGRU SXHGH UHVROYHU
FXDOTXLHU GXGD TXH WHQJD VREUH XQ SURGXFWR R
VHUYLFLR

Interiores.indd 103

5/9/13 6:29 PM

/DGHQVLGDGGHLQIRUPDFLyQ VHUHILHUHDODFDQWLGDG
\ FDOLGDG GH LQIRUPDFLyQ GLVSRQLEOH SDUD WRGRV ORV
SDUWLFLSDQWHV/DVWHFQRORJtDVGHOFRPHUFLRHOHFWUyQLFR
DXPHQWDQ OD FDQWLGDG FDOLGDG SUHFLVLyQ \ DFWXDOLGDG
GHODLQIRUPDFLyQ\DODYH]ORJUDQUHGXFLUORVFRVWRV
GHRIUHFHU\REWHQHUHVWDLQIRUPDFLyQ
(VWD YHQWDMD OH SHUPLWH DO FRQVXPLGRU FRPSDUDU
SUHFLRV \ SURGXFWRV IiFLOPHQWH PLHQWUDV TXH SDUD HO
FRPHUFLDQWH SHUPLWH UHFROHFWDU LQIRUPDFLyQ YDOLRVD
VREUH ORV FRQVXPLGRUHV \ DWUDHUORV GH XQD PDQHUD
PiVGLULJLGD

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
(O HFRPPHUFH WDPELpQ SHUPLWH SHUVRQDOL]DU ORV
PHQVDMHV GH PDUNHWLQJ SDUD FDGD LQGLYLGXR \
DMXVWDU HO SURGXFWR R VHUYLFLR RIUHFLGR GH DFXHUGR
D ODV SUHIHUHQFLDV R FRPSRUWDPLHQWRV GHO
FRPSUDGRU
(VWD FDUDFWHUtVWLFD SHUPLWH D ORV SURYHHGRUHV
LGHQWLILFDU FRQ SUHFLVLyQ ORV GLIHUHQWHV VHJPHQWRV
GHOPHUFDGR\DGHFXDUORVPHQVDMHVTXHHQYtDQD
FDGDXQR

Interiores.indd 104

5/9/13 6:29 PM

3RU HMHPSOR DO HVWDU YLHQGR OD WHOHYLVLyQ OR PiV


TXH SXHGHV SHUVRQDOL]DUOD HV GHFLGLU TXp FDQDO
YHVSHURQRVXFRQWHQLGR
3iJLQDV FRPR OD GH :DOO 6WUHHW -RXUQDO WH
SHUPLWHQ VHOHFFLRQDU TXp QRWLFLDV DSDUHFHQ
FXDQGRW~HQWUDVDODSiJLQD\WHPDQGDDOHUWDVGH
HYHQWRVTXHWHVHUiQUHOHYDQWHV
3RU ~OWLPR VH HQFXHQWUD OD FDUDFWHUtVWLFD GH OD
WHFQRORJtD VRFLDO OD FXDO KD SHUPLWLGR D ORV
XVXDULRV FUHDU \ FRPSDUWLU FRQWHQLGR FRQ OD
FRPXQLGDGPXQGLDO

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
$ GLIHUHQFLD GH ORV PRGHORV GH FRPXQLFDFLyQ PDVLYD
DQWHULRUHV HQ ORV TXH HO HVTXHPD HUD GH XQR D
PXFKRV HO ,QWHUQHW SHUPLWH XQ HVTXHPD GH
FRPXQLFDFLyQ GH PXFKRV D PXFKRV \ GD OD
RSRUWXQLGDG D ORV PLVPRV XVXDULRV GH JHQHUDU ORV
FRQWHQLGRV
9DPRV D KDFHU XQD UHFDSLWXODFLyQ WH LQYLWDPRV D
UHFRUGDU ODV  FDUDFWHUtVWLFDV GHO FRPHUFLR HOHFWUyQLFR
TXH RIUHFHQ YHQWDMDV SDUD FRPHUFLDQWHV \ FOLHQWHV
3XHGHV(VFULELUODV"5HFXHUGDDSURYHFKDUHOHVSDFLR
GHQRWDVSHUVRQDOHVHQODSODWDIRUPD

Interiores.indd 105

5/9/13 6:29 PM

9HQWDMDVGHO&RPHUFLR(OHFWUyQLFR
%XHQ WUDEDMR 8ELFXLGDG DOFDQFH JOREDO HVWiQGDUHV
XQLYHUVDOHV ULTXH]D LQWHUDFWLYLGDG GHQVLGDG GH
LQIRUPDFLyQSHUVRQDOL]DFLyQ\WHFQRORJtDVRFLDO
$ FRQWLQXDFLyQ KDEODUHPRV VREUH ODV SULQFLSDOHV
WHQGHQFLDVGHOHFRPPHUFHUHFRQRFLHQGRTXHHVXQ
DPELHQWH TXH HYROXFLRQD UiSLGDPHQWH DIHFWDGR SRU
ORVDYDQFHVWHFQROyJLFRV
+DFLDGyQGHVHGLULJHHOFRPHUFLRHOHFWUyQLFR"
/DUHVSXHVWDHVHO(FRPPHUFH0yYLO

7HQGHQFLDVGHO(FRPPHUFH
(VWRVVRQDOJXQRVGDWRVTXHORGHPXHVWUDQ
$FWXDOPHQWHGHFDGDSHUVRQDVFRQXQ
WHOpIRQRLQWHOLJHQWHFRPSDUDQSUHFLRV\
EXVFDQGHVFXHQWRVHQVXVWHOpIRQRV
(OGHORVLQJUHVRVGHHFRPPHUFHDQLYHO
PXQGLDOIXHURQWUDQVDFFLRQHVKHFKDVHQXQ
GLVSRVLWLYRPyYLO
(OGHORVPH[LFDQRVWLHQHQXQWHOpIRQR
LQWHOLJHQWH

Interiores.indd 106

5/9/13 6:29 PM

7HQGHQFLDVGHO(FRPPHUFH
/RVFHOXODUHVVHFRQYLHUWHQHQWDUMHWDVGHFUpGLWR
(O3DJR0yYLOGH%DQRUWHHVXQDDSOLFDFLyQTXH
WH SHUPLWH UHDOL]DU SDJRV HQ FRPHUFLRV R
WLHQGDV HQ OtQHD GLUHFWDPHQWH GHVGH WX FHOXODU
WRGR HVWR VLQ OD QHFHVLGDG GH SUHVHQWDU XQD
WDUMHWD GH GpELWR R FUpGLWR GH IRUPD ItVLFD DO
JHQHUDUXQDWDUMHWDYLUWXDOOLJDGDDWXFXHQWDGH
FUpGLWRRGpELWRSRU~QLFDRFDVLyQ
2 *RRJOH :DOOHW TXH SHUPLWLUi D ORV XVXDULRV
SDVDUVXFHOXODUFRPRPHGLRGHSDJRHQOXJDU
GHXQDWDUMHWDGHFUpGLWR

0DSDVFRQ2IHUWDV
(Q(VWDGRV8QLGRV1RNLD0DSVLQFRUSRUDRIHUWDV
GH *URXSRQ PRVWUDQGR D ORV XVXDULRV ODV
RIHUWDVFHUFDQDVDVXXELFDFLyQ
6LORGHVHDVSXHGHVEXVFDUPiVLQIRUPDFLyQVREUH
HVWDVWHQGHQFLDVHQ,QWHUQHWRFRQVXOWDUHOPDWHULDO
DGLFLRQDOGHHVWDOHFFLyQ

Interiores.indd 107

5/9/13 6:29 PM

&LHUUH
&DGD YH] VH YXHOYH PiV QHFHVDULR LQFRUSRUDU
HVWUDWHJLDV GH FRPHUFLR PyYLO SRU OR TXH HQ
OHFFLRQHV SRVWHULRUHV OH GHGLFDUHPRV WLHPSR D HVWH
WHPD

+DFLHQGR XQ UHVXPHQ GH OR DSUHQGLGR HO FRPHUFLR
HOHFWUyQLFR HV HO XVR GH ,QWHUQHW SDUD UHDOL]DU
WUDQVDFFLRQHVFRPHUFLDOHV
&DGD YH] VRQ PiV ODV SHUVRQDV TXH FRPSUDQ HQ
OtQHD\VHHVSHUDTXHHVWHPHUFDGRVLJDFUHFLHQGR
/DV FDUDFWHUtVWLFDV GHO HFRPPHUFH TXH WUDHQ
YHQWDMDV D HVWD IRUPD GH RIUHFHU SURGXFWRV R
VHUYLFLRVVRQODVUHFXHUGDV"

3RU ~OWLPR HV QHFHVDULR UHFRQRFHU TXH HO FRPHUFLR


HOHFWUyQLFR VHJXLUi FUHFLHQGR \ TXH ODV QXHYDV
WHQGHQFLDV LQFOX\HQ DSOLFDFLRQHV PyYLOHV TXH
SHUPLWHQ KDFHU WUDQVDFFLRQHV FHOXODUHV TXH VH
FRQYLHUWHQ HQ WDUMHWDV GH FUpGLWR \ VHUYLFLRV GH
PDSDVTXHPXHVWUDQGyQGHKD\RIHUWDVFHUFDQDV
$KRUD HV EXHQ PRPHQWR SDUD SHQVDU FyPR
SXHGHV DSURYHFKDU ODV FDUDFWHUtVWLFDV GHO FRPHUFLR
HOHFWUyQLFR SDUD EHQHILFLDU D WX HPSUHVD" 4Xp
WHQGHQFLDV GHO HFRPPHUFH FUHHV YDOLRVDV
LQFRUSRUDU"
(QODVLJXLHQWHOHFFLyQKDEODUHPRVVREUHODVLWXDFLyQ
GH 0p[LFR IUHQWH DO FRPHUFLR HOHFWUyQLFR H
LGHQWLILFDUHPRV ODV iUHDV GH RSRUWXQLGDG SDUD
LPSXOVDUVXFUHFLPLHQWR

Interiores.indd 108

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 2: Qu es el comercio Electrnico?
______________________________________________________________________________

Instrucciones: Ya has concluido con la leccin # 2 del curso. Repasa lo aprendido


respondiendo a las siguientes preguntas y haciendo lo que se te pide.
1.

Cmo definiras el comercio electrnico?

2. A qu nos referimos con TICs?

3. Menciona 5 ventajas que tiene la prctica del e-commerce


a)
b)
c)
d)
e)
4. Seala la diferencia entre e-commerce y e-business.

5. Menciona 1 de los sectores productivos ms favorecidos por el comercio electrnico en


Mxico.

6. De acuerdo al estudio de comercio electrnico de la AMIPCI, que mencionamos en el


video Por qu motivos los mexicanos se reservan de realizar compras en Internet?

7. Menciona una de las nuevas tendencias del e- commerce.

Interiores.indd 109

5/9/13 6:29 PM

8. Recuerdas que mencionamos que el primer banner publicitario en lnea se public en


Octubre de 1994? Busca la imgen en Internet utilizando las siguientes palabras claves:
* Banner/ AT&T, Volvo y Sprint / Hotwired.com / 1994

9. Una de las ventajas mencionadas que ha trado el e-commerce es la ampliacin de la


oferta y variedad de productos al alcance del consumidor. Busca algn artculo que te
interese en tu buscador favorito y comprueba la variedad de opciones disponibles.

10. A qu se refiere la caracterstica del comercio electrnico ubicuidad?

Interiores.indd 110

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 3
Situacin en Mxico
Duracin:

30 min

Objetivo de aprendizaje:

Al finalizar esta sesin, los alumnos conocern la situacin


de Mxico frente al comercio electrnico e identificar las
reas de oportunidad para impulsar su crecimiento.

Subtemas:

Mxico: Terreno Frtil


Retos para el e- commerce en Mxico

Requisitos:

Computadora, Tablet o dispositivo desde el cual


pueda tomar el curso en lnea.
Conexin a Internet
Tarea previa realizada

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida
- Informacin general de la leccin 3 (tema,
subtemas y objetivo de aprendizaje).

D 2:
- Texto de fondo:
-Tema
-Subtemas
-Objetivo especfico de aprendizaje: Conocer la
situacin de Mxico frente al comercio electrnico
e identificar las reas de oportunidad para
impulsar su crecimiento.

Desarrollo
1. Mxico: Terreno Frtil

D 4:
-Fondo de pantalla= cifras y estadsticas

Interiores.indd 111

5/9/13 6:29 PM

D 5:
-Grfica de crecimiento en el fondo.
D 6:
- Imgenes correspondientes a los distintos
medios de pago
D 7:
- Imgenes y cifras % en el fondo
D 8:
- Imagen dispositivo mvil inteligente y logotipos
Itunes y Android
2. Legislacin en Mxico
2.1 El IFAI

D 9:
- Texto de fondo:
1. Cdigo Civil Federal
2. Cdigo de Comercio
3. Cdigo Federal de procedimientos civiles
4. Ley Federal de proteccin al consumidor
D 10:
- El Instituto Federal de acceso a la Informacin
(IFAI)

2.Retos para el e- commerce en Mxico

D 13:
- Pregunta de fondo y dejar unos segundos a
reflexin: Qu obstculos crees que impiden que
los mexicanos adoptemos esta prctica comercial?

Cierre
- Resumen
- Preguntas de Reflexin
- Mencin de la leccin que le precede.

D 16:
-Pregunta en el fondo:
Creen que Mxico puede potenciar rpidamente
su actividad en comercio electrnico

- Ejercicios de Prctica

Interiores.indd 112

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ6LWXDFLyQ$FWXDOHQ0p[LFR

,QIRUPDFLyQ*HQHUDO
%LHQYHQLGR D OD WHUFHUD OHFFLyQ GHO FXUVR /D
6LWXDFLyQ DFWXDO HQ 0p[LFR (Q HVWD VHVLyQ
WRFDUHPRVORVVLJXLHQWHVWHPDV
0p[LFR7HUUHQR)pUWLO
/HJLVODFLyQHQ0p[LFR
5HWRVSDUDHOFRPHUFLRHOHFWUyQLFRHQ0p[LFR
<D TXH HO REMHWLYR GH DSUHQGL]DMH HV &RQRFHU OD
VLWXDFLyQ GH 0p[LFR IUHQWH DO FRPHUFLR HOHFWUyQLFR H
LGHQWLILFDU ODV iUHDV GH RSRUWXQLGDG SDUD LPSXOVDU VX
FUHFLPLHQWR

Interiores.indd 113

5/9/13 6:29 PM

0p[LFR7HUUHQR)pUWLO
0p[LFR WLHQH DPSOLDV RSRUWXQLGDGHV SDUD DYDQ]DU
HQ HO GHVDUUROOR GH ODV 7HFQRORJtDV GH OD
,QIRUPDFLyQ \ XVDUODV FRPR KHUUDPLHQWDV SDUD
LPSXOVDU OD FRPSHWLWLYLGDG \ FUHFLPLHQWR GHO
PHUFDGRPH[LFDQR
'LIHUHQWHV HVWXGLRV FRLQFLGHQ HQ TXH 0p[LFR HV
DFWXDOPHQWHWHUUHQRIpUWLOSDUDLPSXOVDUHOFRPHUFLR
HOHFWUyQLFR \D TXH H[LVWHQ RSRUWXQLGDGHV GH p[LWR
GHELGRDP~OWLSOHVIDFWRUHV

/RV IDFWRUHV TXH UHSUHVHQWDQ XQD RSRUWXQLGDG SDUD


LPSXOVDU HO HFRPPHUFH KDQ WHQLGR XQ DXPHQWR
VLJQLILFDWLYR HQ ORV ~OWLPRV DxRV SRU HMHPSOR HO
Q~PHUR GH XVXDULRV GH ,QWHUQHW HO Q~PHUR GH
SOiVWLFRV EDQFDULRV \ HVSHFLDOPHQWH HO Q~PHUR GH
PH[LFDQRV TXH FRPSUDQ SRU HVWH PHGLR GLJLWDO 'H
 PLOORQHV GH FLEHUFRQVXPLGRUHV HQ  D 
PLOORQHVHQ
3RURWUDSDUWHHO0RELOH&RPPHUFHWDPELpQHVXQD
YHQWDMDTXHWLHQH0p[LFRSDUDLPSXOVDUHOFRPHUFLR
GLJLWDO\DTXHDFWXDOPHQWHKD\PiVGHPLOORQHV
GHFHOXODUHV\GXUDQWHHOVHGXSOLFyHOXVRGH
VPDUWSKRQHVSDUDFRQHFWDUVHDODZHE

Interiores.indd 114

5/9/13 6:29 PM

(Q HO HVWXGLR GH &RPHUFLR (OHFWUyQLFR  


SUHVHQWDGRSRUOD$VRFLDFLyQ0H[LFDQDGH,QWHUQHW
VH UHYHOD TXH HO HFRPPHUFH HQ 0p[LFR KD LGR
FUHFLHQGRSRVLWLYDPHQWHHQORV~OWLPRVDxRVGDGR
TXHHQHODSRUWyPLOORQHVGHSHVRV
DODHFRQRPtDPH[LFDQD\SDUDHOFLHUUHGHO
VHHVWLPyXQFUHFLPLHQWRGHOORTXHHTXLYDOH
DPLOORQHVGHSHVRV
$GHPiV GHO FUHFLPLHQWR TXH KDQ WHQLGR ODV
FRPSUDV SRU ,QWHUQHW HQ ORV ~OWLPRV DxRV OD
FRQILDQ]D GH ORV FRQVXPLGRUHV HVWi DXPHQWDQGR
DO LJXDO TXH OD RIHUWD GH SURGXFWRV \ ORV PpWRGRV
GHSDJRORVFXDOHVVHKDQGLYHUVLILFDGR

0p[LFR7HUUHQR)pUWLO
(O HVWXGLR FRPSUXHED TXH HO PHGLR GH SDJR PiV
XWLOL]DGR SRU HO ,QWHUQDXWD HV OD 7DUMHWD GH &UpGLWR 
  VHJXLGR GH 'HSyVLWR HQ 6XFXUVDO     \
3D\SDO    OD WUDQVIHUHQFLD HOHFWUyQLFD JDQD
WHUUHQR  PiVTXHHQ
$FWXDOPHQWH HQ 0p[LFR ODV FRPSUDV PiV SRSXODUHV
HQOtQHDVRQORVEROHWRVGHDYLyQTXHUHSUHVHQWDQHO
 GH ODV FRPSUDV HQ OtQHD OR TXH GHVWDFD OD
LPSRUWDQFLD GHO HFRPPHUFH GHQWUR GHO VHFWRU
WXULVPR

Interiores.indd 115

5/9/13 6:29 PM

0p[LFR7HUUHQR)pUWLO
(Q VHJXQGR OXJDU ORV HTXLSRV GH FyPSXWR TXH
DEDUFDQGHODVFRPSUDVHOORUHSUHVHQWDOD
FRPSUDGHDFFHVRULRVSDUDFHOXODUHVHOHQHO
UXEURGHHOHFWUyQLFDDXGLR\YLGHR\ILQDOPHQWHOD
FRPSUD GH EROHWRV SDUD HVSHFWiFXORV FRQ  GHO
WRWDOGHODVYHQWDVSRUHVWHPHGLR
2WUR GDWR LQWHUHVDQWH HV TXH HO  GH ORV
LQWHUQDXWDV PH[LFDQRV KDQ KHFKR XQD FRPSUD HQ
OtQHDDWUDYpVGHVXGLVSRVLWLYRPyYLOVLHQGRLWXQHV
\$QGURLGPDUNHWODVWLHQGDVPiVUHFXUULGDV

/DV HQFXHVWDV UHDOL]DGDV SRU HO HVWXGLR GH OD


$0,3&,UHYHODQTXHORVPH[LFDQRVTXHFRPSUDQHQ
OtQHD OR KDFHQ SRUTXH HVWD SUiFWLFD WLHQH YHQWDMDV
FRPR 3UDFWLFLGDG DKRUUR GH WLHPSR \ DSDUWDGR GH
SURGXFWRV
'H KHFKR TXHGDQ WDQ FRQYHQFLGRV TXH HO  GH
ORV PH[LFDQRV TXH FRPSUDQ HQ OtQHD WLHQH OD
LQWHQFLyQGHYROYHUDFRPSUDU

Interiores.indd 116

5/9/13 6:29 PM

/HJLVODFLyQHQ0p[LFR
(Q PDWHULD OHJLVODWLYD 0p[LFR SRFR D SRFR VH KD
DGHFXDGR D OD DFWLYLGDG PHUFDQWLO HQ OtQHD SDUD
SURWHJHU DO FLEHU FRQVXPLGRU PH[LFDQR FXDQGR
UHDOL]DFRPSUDVSRU,QWHUQHW
3RUHOORHOGH0D\RGHOVHSXEOLFDURQHQ
HO'LDULR2ILFLDOGHOD)HGHUDFLyQODVUHIRUPDVTXH
VHDGLFLRQDURQDFXDWUROH\HVIHGHUDOHVHO&yGLJR
&LYLO)HGHUDOHO&yGLJRGH&RPHUFLRHO&yGLJR
)HGHUDO GH 3URFHGLPLHQWRV &LYLOHV \ OD /H\
)HGHUDOGH3URWHFFLyQDO&RQVXPLGRU

/HJLVODFLyQHQ0p[LFR
J
(VWDVOH\HVIXHURQDGLFLRQDGDVFRQHOREMHWLYRGH
UHJXODUODVWUDQVDFFLRQHVGHFRPHUFLRHOHFWUyQLFR
SULQFLSDOPHQWH OD FRQWUDWDFLyQ HOHFWUyQLFD
DXWHQWLFDFLyQ GH HPLVRU \ UHFHSWRU \ GHUHFKRV \
REOLJDFLRQHVGHORVFRQWUDWDQWHV
$Vt PLVPR H[LVWH PD\RU SUHVLyQ SRU RIUHFHU D
FRQVXPLGRUHVXQ$YLVRGH3ULYDFLGDGLQGLFDQGRHO
XVR TXH VH OH GDUiQ D VXV GDWRV SHUVRQDOHV
$FWXDOPHQWH /H\ )HGHUDO GH 3URWHFFLyQ GH 'DWRV
3HUVRQDOHV HQ 3RVHVLyQ GH ORV 3DUWLFXODUHV OR
H[LJH\HVXQDREOLJDFLyQGHORVFRPHUFLRV
\D HODERUDVWH HO DYLVR GH SULYDFLGDG TXH
XVDUiVHQWXVLWLRZHE"

Interiores.indd 117

5/9/13 6:29 PM

/DDXWRULGDGUHVSRQVDEOHGHODSURWHFFLyQGHGDWRV
SHUVRQDOHV HV (O ,QVWLWXWR )HGHUDO GH DFFHVR D OD
,QIRUPDFLyQ ,)$, 
/D OH\ OH KD RWRUJDGR OD IDFXOWDG GH GLIXQGLU HO
FRQRFLPLHQWRGHHVWHGHUHFKRDORVPH[LFDQRVSDUD
SURWHJHU VXV GDWRV SHUVRQDOHV \ SRU HOOR SXHGH
OOHYDUDFDERLQVSHFFLRQHVSDUDFRUURERUDUHOGHELGR
FXPSOLPLHQWRGHODVGLVSRVLFLRQHVGHOD/H\
3DUD SUHYHQLU HO PDO XVR GH ORV GDWRV \ RULHQWDU D
ORVUHVSRQVDEOHVGHOWUDWDPLHQWRGHORVPLVPRVKD
HODERUDGR XQD JXtD SDUD JHQHUDU HO DYLVR GH
SULYDFLGDG OD FXDO SXHGH FRQVXOWDUVH GHVGH HO VLWLR
ZHEGHO,)$,

/HJLVODFLyQHQ0p[LFR
0iV DGHODQWH HQ OD OHFFLyQ GH OH\HV \ pWLFD
DSUHQGHUHPRV &yPR JHQHUDU XQ DYLVR GH
SULYDFLGDG"
(VWDV DFFLRQHV \ FOiXVXODV TXH UHJXODQ ODV
RSHUDFLRQHV HQ FRPHUFLR HOHFWUyQLFR UHSUHVHQWDQ
XQD D\XGD SDUD TXH ORV FRPHUFLRV HQ OtQHD
FXPSODQFRQIRUPHDORGLVSXHVWRSRUODOH\
6H SXHGH REVHUYDU TXH FDGD YH] H[LVWHQ PiV
DFFLRQHVSDUDEULQGDUVHJXULGDGDORVFLEHUQDXWDV
SHUR HV LQQHJDEOH TXH D~Q TXHGD PXFKR SRU
KDFHU

Interiores.indd 118

5/9/13 6:29 PM

/HJLVODFLyQHQ0p[LFR
3UREDEOHPHQWH ODV OH\HV SURQWR SURPRYHUiQ HO
DFFHVRD,QWHUQHW
3RUHMHPSORHOSUHVLGHQWH(QULTXH3HxD1LHWRVH
FRPSURPHWLy D HVWDEOHFHU OD EDQGD DQFKD FRPR
XQGHUHFKRFRQVWLWXFLRQDO
2WUR HMHPSOR HV HO (VWDGR GH &ROLPD TXLHQ
UHIRUPy VX FRQVWLWXFLyQ SDUD JDUDQWL]DU D VXV
FLXGDGDQRVHODFFHVRDOPXQGRGH,QWHUQHW

5HWRVSDUDHOHFRPPHUFHHQ0p[LFR
$XQTXH HO FRPHUFLR HOHFWUyQLFR HQ HO SDtV HVWi
FUHFLHQGR GH PDQHUD DFHOHUDGD ODV YHQWDV HQ OtQHD
D~Q VH FRQVLGHUDQ SRU GHEDMR GHO SURPHGLR GH
$PpULFD /DWLQD 8Q HMHPSOR GH HVWR HV OD
FRPSDUDFLyQFRQ%UDVLOTXLHQWLHQHPHQRVGHOGREOH
GHXVXDULRVGH,QWHUQHWTXH0p[LFR\KDORJUDGRXQ
YROXPHQGHYHQWDVYHFHVPD\RUDOGH0p[LFR
4XpREVWiFXORVFUHHVTXHLPSLGHQTXHORV
PH[LFDQRVDGRSWHPRVHVWDSUiFWLFDFRPHUFLDO"

Interiores.indd 119

5/9/13 6:29 PM

5HWRVSDUDHOHFRPPHUFHHQ0p[LFR
(Q 0p[LFR D~Q H[LVWHQ UHVHUYDV HQWUH ORV
FRQVXPLGRUHV SDUD KDFHU FRPSUDV HQ OtQHD ODV
SULQFLSDOHVUD]RQHVVRQ
/DIDOWDGHLQIRUPDFLyQGHOSURGXFWRRQHJRFLR
/D GHVFRQILDQ]D GHO FRQVXPLGRU DQWH SRVLEOHV
GHOLWRV LQIRUPiWLFRV R OD QR UHFHSFLyQ GHO
SURGXFWR
/D SHQHWUDFLyQ GH 6HUYLFLRV %DQFDULRV \D TXH
D~Q H[LVWHQ XQD EDUUHUD SDUD TXH WRGRV ORV
PH[LFDQRV FXHQWHQ FRQ XQD WDUMHWD GH FUpGLWR
$SHQDV HO  GH PH[LFDQRV TXH XWLOL]D XQ
VHUYLFLR GH FUpGLWR IRUPDO SRVHH XQD WDUMHWD GH
pGLW

/D SHQHWUDFLyQ GH EDQGD DQFKD HQWUH OD


SREODFLyQ D~Q QR OOHJD DO  GH OD
SREODFLyQ
3RU OR DQWHULRU UHVXOWD QHFHVDULR SURPRYHU HO H
FRPPHUFH DFHSWDU QXHYRV PRGHORV \ PHGLRV GH
SDJRWUDEDMDUHQODVHJXULGDG\FRQILDQ]DGHSDJR
HQOtQHD\SRWHQFLDUHOPDUNHWLQJRQOLQH
'HILQLWLYDPHQWH HO FRPHUFLR HOHFWUyQLFR DSRUWDUi
JUDQGHV RSRUWXQLGDGHV GH FUHFLPLHQWR \
GLYHUVLILFDFLyQDWXQHJRFLR

Interiores.indd 120

5/9/13 6:29 PM

4XpWHYDSDUHFLHQGRHOFXUVR"
&UHHVTXH0p[LFRSXHGHSRWHQFLDU
UiSLGDPHQWHVXDFWLYLGDGHQFRPHUFLR
HOHFWUyQLFR"
3RUIDYRUFRPSDUWHWXRSLQLyQDOUHVSHFWRHQHO
IRUR(VPX\LPSRUWDQWHSDUDVHJXLUPHMRUDQGR
QXHVWURVFRQWHQLGRV
(QODSUy[LPDOHFFLyQLQWURGXFLUHPRVORVPRGHORV
GHQHJRFLRHQOtQHD
+DVWDSURQWR

Interiores.indd 121

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 3: : Situacin en Mxico
______________________________________________________________________________

Instrucciones: Ya has concluido con la leccin # 3 del curso. Repasa lo aprendido


respondiendo a las siguientes preguntas y haciendo lo que se te pide.
1.

A qu nos referimos con que Mxico es actualmente terreno frtil para impulsar el
comercio electrnico?

2. Enlista 4 factores que favorezcan el potencial de crecimiento de esta prctica en Mxico:


a)
b)
c)
d)
3. Circula el inciso del medio de pago ms utilizado por el internauta mexicano:
a) PayPal

b) Depsito Bancario

c) Tarjeta de Crdito

4. De acuerdo al estudio de la AMIPCI, Qu porcentaje de mexicanos que han comprado


en lnea en algn momento, tiene la intencin de volver a comprar?

5. En esta leccin se mencion que en materia legislativa Mxico se ha ido adecuando a la


actividad mercantil en lnea. Como parte de las obligaciones de los comerciantes est el
ofrecer un aviso de privacidad. Consulta la gua prctica para elaborarlo en la siguiente
liga: http://inicio.ifai.org.mx/DocumentosdeInteres/privacidadguia.pdf
6. Circula el inciso de la autoridad responsable de la proteccin de datos personales en
Mxico:
a) IMPI
7.

Interiores.indd 122

b) PROFECO

c) IFAI

La penetracin de banda ancha que actualmente hay en Mxico representa una


ventaja o una desventaja para la incursin del e- commerce? Argumenta.

5/9/13 6:29 PM

8. Menciona algunas de las compras ms populares en lnea adems de boletos de avin.

9. Cules son las dos tiendas en lnea mas visitadas a travs de los smartphones?
a)
b)

10. Qu pas de Amrica Latina se mencion como referencia de un pas que ha


incursionado en la prctica de comercio electrnico? Busca ms informacin sobre el
tema, en lnea.

Interiores.indd 123

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 4
Modelos de Negocio en Lnea 1
Duracin:

30 min

Objetivo de aprendizaje: Distinguir los diferentes modelos de negocio online


Subtemas:

Introduccin a los modelos de negocio en lnea


Modelo B2C (Business to Consumer)
Caso de xito

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
- Texto de fondo:
1. propuesta de valor
2. modelo de ingresos
3. oportunidad de mercado
4. entorno competitivo
5. ventaja competitiva
6. estrategia de mercado
7. desarrollo organizacional
8. equipo gerencial

1. Introduccin a Modelos de Negocio en Lnea


- Definicin Modelos de Negocio
- Resumen modelos ms conocidos en lnea
(B2C, B2B, C2C, P2P)

Interiores.indd 124

D 3:
- Texto en el fondo

5/9/13 6:29 PM

D5:
- Texto de fondo conforme se menciona:
B2C: Business to Consumer (negocio a
consumidor)
B2B: business to business (negocio a negocio)
C2C: Consumer to consumer (consumidor a
consumidor)
P2P: pair to pair (para a par).
D6:
Sugiero que pongamos el grfico en esta
diapositiva (o similar) de fondo de pantalla.
2. Modelo B2C (Business to Consumer)
- Teora del modelo B2C
- Ejemplos de negocios online bajo este modelo
- Casos de xito:
MercadoLibre (Modelo B2C)
Micro-empresarios
- Cmo adoptar este modelo de negocio?
- Tips para tener xito bajo este modelo.

D7:
- Texto: B2C (Negocio a Consumidor)
D8:
- Pantallas de tienda en lnea de las marcas
mencionadas
D10:
- En el fondo poner pantallas o logotipos de las
empresas conforme vayan mencionndose.
D 12:
- Texto de fondo al tiempo que se menciona:
-Marcos Galpern
-Argentina, Brasil, Colombia, Chile, Ecuador,
Mxico, Per, Uruguay y Venezuela.
Mercado Libre. Marketplace
MercadoPago- Gestin de pago desde
el sitio de la empresa o negocio
Mercado Clicks- Publicidad
Mercado Shop- Tiendas en lnea
D 14:
-Texto de fondo
Cmo adoptar este modelo para tu
negocio?
D 15:
- Texto de fondo:
Construir una tienda con entorno intuitivo
D 16:
- Texto de fondo:
el producto correcto, en el lugar correcto y
en el momento correcto.

Interiores.indd 125

5/9/13 6:29 PM

3. Caso de xito

Durante todo el relato poner grficos y


pantallas que ilustren la narracin

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

D 20:
- Escribe en el foro de esta leccin cuatro
ejemplos que conozcas que utilicen el modelo
B2C en lnea.

Interiores.indd 126

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ0RGHORVGH1HJRFLRHQ
/tQHD 

,QIRUPDFLyQ*HQHUDO
+ROD %LHQYHQLGR D OD OHFFLyQ  GHO FXUVR +DVWD
DKRUDQRVKHPRVDFHUFDGRDOFRQFHSWRGH,QWHUQHW
\ DTXHOORV DVSHFWRV UHODFLRQDGRV D pO DVt PLVPR
KHPRV FRPSUHQGLGR HO VLJQLILFDGR GH FRPHUFLR
HOHFWUyQLFR\ODVYHQWDMDVTXHKDWUDtGRHVWDQXHYD
IRUPDGHKDFHUQHJRFLRDKRUD\DSRGHPRVSDVDU
DODVLJXLHQWHVHFFLyQGHOFXUVR/RVPRGHORVGH
QHJRFLRHQOtQHD

Interiores.indd 127

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O WHPD JHQHUDO GH HVWD VHVLyQ VHUi 0RGHORV GH
1HJRFLRHQ/tQHD\DSUHQGHUHPRVVREUH
/RVGLVWLQWRVPRGHORVGH1HJRFLRHQ/tQHD
(O0RGHOR%& %XVLQHVVWR&RQVXPHU
&DVRGHp[LWR
(O 2EMHWLYR GH DSUHQGL]DMH HVSHUDGR SDUD HVWD
VHVLyQ HV 'LVWLQJXLU ORV GLIHUHQWHV PRGHORV GH
QHJRFLRRQOLQH

0RGHORVGHQHJRFLRHQOtQHD
4XpHVXQPRGHORGHQHJRFLRHQOtQHD"
8Q PRGHOR GH QHJRFLR HVWDEOHFH OD PDQHUD HQ OD
TXHXQDHPSUHVDJHQHUDUiLQJUHVRVLGHQWLILFDQGR
VXRIHUWDGHSURGXFWRVHUYLFLRGHYDORUDJUHJDGR
IXHQWHVGHLQJUHVR\VXSREODFLyQREMHWLYR
([LVWHQ DOJXQRV HOHPHQWRV LQGLVSHQVDEOHV D
FRQVLGHUDU HQ FXDOTXLHU PRGHOR GH QHJRFLR
SURSXHVWD GH YDORU PRGHOR GH LQJUHVRV
RSRUWXQLGDG GH PHUFDGR HQWRUQR FRPSHWLWLYR
YHQWDMD FRPSHWLWLYD HVWUDWHJLD GH PHUFDGR
GHVDUUROORRUJDQL]DFLRQDO\HTXLSRJHUHQFLDO

Interiores.indd 128

5/9/13 6:29 PM

0RGHORVGH1HJRFLRHQ/tQHD
'HELGR D OD UDSLGH] FRQ OD TXH HYROXFLRQD HO
FRPHUFLR HOHFWUyQLFR HV QHFHVDULR HYDOXDU
LQQRYDU \ DFWXDOL]DU FRQVWDQWHPHQWH HO PRGHOR
GH QHJRFLR DGRSWDGR H[DPLQDQGR FDGD XQR GH
ORVIDFWRUHVPHQFLRQDGRV
([LVWHXQVLQQ~PHURGHPRGHORVGHQHJRFLRHQ
OtQHD TXH VH SXHGHQ FDWHJRUL]DU GH DFXHUGR D
ORV GLIHUHQWHV VHFWRUHV GH FRPHUFLR HQ ORV TXH
VH XWLOL]DQ (VWD FODVLILFDFLyQ VH GHWHUPLQD SRU
VXV VLJODV HQ LQJOpV  TXH HV %XVLQHVV WR
&RQVXPHURGHQHJRFLRDFRQVXPLGRU

0RGHORVGH1HJRFLR
TXHVHUHILHUHDEXVLQHVVWREXVLQHVVRQHJRFLRD
QHJRFLR %XVLQHVV WR *RYHUQPHQW R 1HJRFLR D
*RELHUQR TXH HV &RQVXPHU WR FRQVXPHU
FRQVXPLGRU D FRQVXPLGRU  \ 33 SRU VXV VLJODV
SDLUWRSDLU SDUDSDU $OJXQDVFRPSDxtDVWLHQHQ
P~OWLSOHVPRGHORVGHQHJRFLR

Interiores.indd 129

5/9/13 6:29 PM

0RGHOR%&%XVLQHVVWR&RQVXPHU
(QHVWDOHFFLyQKDEODUHPRVVREUHHOSULPHUPRGHOR
PHQFLRQDGR %& EXVLQHVVWRFRQVXPHU  R GH
QHJRFLR D FRQVXPLGRU (Q XQ PRGHOR GH %& ODV
WUDQVDFFLRQHV FRPHUFLDOHV VH GDQ HQWUH XQD
RUJDQL]DFLyQ \ XQ FRQVXPLGRU LQGLYLGXDO 8Q SULPHU
HMHPSORGHHVWHPRGHORGHQHJRFLRVRQORVSRUWDOHV
TXH RIUHFHQ KHUUDPLHQWDV GH E~VTXHGD FRQWHQLGRV
\VHUYLFLRVHQXQVROROXJDU
'HQWUR GH ORV SRUWDOHV PiV UHFRQRFLGRV VH
HQFXHQWUDQ *RRJOH <DKRR 061%LQJ \ $2/ /RV
SRUWDOHV QR YHQGHQ XQ SURGXFWR GLUHFWDPHQWH PiV
ELHQJHQHUDQVXVLQJUHVRVYHQGLHQGRHVSDFLRVSDUD
DQXQFLRVRDFFHVRDVHUYLFLRVDYDQ]DGRV

2WUR PRGHOR GHQWUR GH HVWH HVTXHPD HV HO GH


YHQWDVDOSRUPHQRUHQOtQHDGHQWURGHHVWHVHFWRU
VH HQFXHQWUDQ WLHQGDV TXH YHQGHQ WRGRV VXV
SURGXFWRV HQ OtQHD SRU HMHPSOR $PD]RQFRP
'HFRPSUDVFRP R LWXQHV \ RWUDV TXH FRPELQDQ
VXV YHQWDV HQ XQD WLHQGD ItVLFD FRQ XQD WLHQGD
YLUWXDO  SRU HMHPSOR :DOPDUW /LYHUSRRO \ 3DODFLR
GH+LHUUR
(VWH VHFWRU HV DOWDPHQWH FRPSHWLWLYR \D TXH OD
EDUUHUD GH HQWUDGD HV EDMD $FWXDOPHQWH H[LVWHQ
PLOHV GH SHTXHxDV PHGLDQDV \ JUDQGHV WLHQGDV
HQ OtQHD RIUHFLHQGR VXV SURGXFWRV (O PRGHOR GH
LQJUHVRVGHHVWHWLSRGHQHJRFLRHVWiEDVDGRHQHO
SURGXFWR FRQ ORV FRQVXPLGRUHV SDJDQGR SRU OD
FRPSUDGHXQDUWtFXORHQSDUWLFXODU

Interiores.indd 130

5/9/13 6:29 PM

0RGHOR%&%XVLQHVVWR&RQVXPHU
(OSURYHHUFRQWHQLGRVHVRWURHMHPSORGHOPRGHORGH
QHJRFLRV %& \ VH UHILHUH D FXDOTXLHUD TXH
GLVWULEX\H FRQWHQLGRV GH LQIRUPDFLyQ FRPR QRWLFLDV
GHIRUPDGLJLWDOP~VLFDIRWRVYLGHRV\DUWHDWUDYpV
GHOD:HE
/DPD\RUtDGHHVWRVQHJRFLRVFREUDQDVXVXVXDULRV
XQDFXRWDPHQVXDOSRUHMHPSOR:6-FRP+DUYDUG
%XVLQHVV 5HYLHZ R 5KDSVRG\FRP PLHQWUDV TXH
RWURV RIUHFHQ OD LQIRUPDFLyQ GH IRUPD JUDWXLWD H
LQFRUSRUDQ D VX VLWLR EDQQHUV FRQ DQXQFLRV SRU
HMHPSOR &%66SRUWVFRP HOXQLYHUVDOFRP R &11
FRPHQWUHRWURV

0RGHOR%&%XVLQHVVWR&RQVXPHU
2WUDV RIHUWDV TXH IRUPDQ SDUWH GH OD FDWHJRUtD
%&VRQSURFHVDGRUHVGHWUDQVDFFLRQHVFRPR
'HVSHJDUFRP \ +RWHOHVFRP  FUHDGRUHV GH
PHUFDGR FRPR H%D\ R PHUFDGROLEUHFRP
SURYHHGRUHVGHVHUYLFLRVFRPR*RRJOH$SSV\
SURYHHGRUHV GH FRPXQLGDGHV GLJLWDOHV FRPR
)DFHERRN/LQNHG,Q\7ZLWWHU
/DFODYHHQHVWHWLSRGHQHJRFLRHVWiHQVHUGXHxR
GH ORV FRQWHQLGRV GDUOH XQ YDORU DJUHJDGR D ORV
FRQWHQLGRV R WHQHU LQIRUPDFLyQ ~QLFD D OD TXH QR
VHSXHGDWHQHUDFFHVRVLQRHVDWUDYpVGHOVLWLR

Interiores.indd 131

5/9/13 6:29 PM

0RGHOR%&%XVLQHVVWR&RQVXPHU
3DUD FRPSUHQGHU GH PHMRU PDQHUD HVWH QHJRFLR
XWLOL]DUHPRV XQ HMHPSOR GH FDVR GH p[LWR GH
FRPHUFLR HOHFWUyQLFR TXH XWLOL]D HVWH PRGHOR GH
QHJRFLRRQOLQH
(O FDVR GH 0HUFDGR /LEUH   XQD HPSUHVD
DUJHQWLQD GHGLFDGD D OD LQWHUPHGLDFLyQ HQWUH ORV
XVXDULRV LQVFULWRV D VX VHUYLFLR GH FRPSUDV
YHQWDVSDJRV\VXEDVWDVSRU,QWHUQHW(Q0HUFDGR
/LEUH/RVXVXDULRVSXHGHQYHQGHUWDQWRSURGXFWRV
QXHYRV FRPR XVDGRV D SUHFLR ILMR R HQ OD
PRGDOLGDG GH VXEDVWDV 6XV RILFLQDV FHQWUDOHV VH
HQFXHQWUDQHQ%XHQRV$LUHV$UJHQWLQD

0HUFDGR/LEUHVHRULJLQyHQHODxRGH0LHQWUDV
0DUFRV *DOSHUtQ WHUPLQDED VX 0%$ HQ OD
8QLYHUVLGDGGH6WDQIRUGHVFULELyHOSODQGHQHJRFLRV
GH 0HUFDGR/LEUH 8QD YH] WHUPLQDGR HO 0%$ VH
GHGLFy D FRQIRUPDU OD FRPSDxtD TXH PiV WDUGH IXH
SUHVHQWDGD RILFLDOPHQWH \ TXH UiSLGDPHQWH VH
H[SDQGLy $FWXDOPHQWH HVWi HQ  SDtVHV \ HV HO 
OXJDUHQWpUPLQRVGHWUiILFRSDUDHFRPPHUFH
(O  GH VXV YHQWDV VRQ SURGXFWRV QXHYRV SHUR
RULJLQDOPHQWH HPSH]y FRQ YHQWD GH SURGXFWRV
XVDGRV (QWUH ORV SURGXFWRV R QHJRFLRV TXH KR\ \D
WLHQH 0HUFDGR /LEUH HVWi 0DUNHWSODFH 0HUFDGR
3DJR PHGLR GH SDJR SDUD HPSUHVDV HQ OtQHD 
0HUFDGR &OLFNV 3XEOLFLGDG  \ 0HUFDGR 6KRS
WLHQGDVHQOtQHD 

Interiores.indd 132

5/9/13 6:29 PM

0RGHOR%&%XVLQHVVWR&RQVXPHU
0HUFDGR/LEUHQRVRORKDVLGRXQFDVRGHp[LWRSDUD
VtPLVPRVLQRSDUDPLOHVGH3\PHVTXHYHQGHQHQ
HO SRUWDO GH 0HUFDGR/LEUH \ DGTXLHUHQ
DXWRPiWLFDPHQWH PLOHV GH YLVLWDV D VXV SURGXFWRV
7~ WDPELpQ SXHGHV FRPHQ]DU D YHQGHU GHVGH VX
SRUWDO VLQ QHFHVLGDG GH FRQWDU FRQ XQD WLHQGD
YLUWXDO
0iV DGHODQWH DQDOL]DUHPRV HO FDVR GH XQ
PLFURHPSUHVDULRPH[LFDQRH[LWRVRHQHVWHPRGHOR
GHQHJRFLRRQOLQH

0RGHOR%&%XVLQHVVWR&RQVXPHU
(QWRQFHV\DKHPRVDSUHQGLGRTXHHVWHPRGHORGH
QHJRFLRSXHGHVHUXQp[LWRSDUDWL\WXHPSUHVDVL
VDEHVLPSOHPHQWDUOR3HUR&yPRDGRSWDUHVWH
PRGHOR SDUD WX QHJRFLR" &RPR \D OR KHPRV
H[SOLFDGR HVWH PRGHOR VH UHVXPH HQ OD YHQWD GH
VHUYLFLRV R ELHQHV TXH WX HPSUHVD SRQH D
GLVSRVLFLyQGHOFRQVXPLGRUILQDOHQOtQHD

Interiores.indd 133

5/9/13 6:29 PM

3DUD FRPHQ]DU D YHQGHU FRQ HVWH PRGHOR GHEHUiV


SHQVDU
&XiOHVWXRIHUWDGHYDORU"
4XLpQFRQVWLWX\HWXDXGLHQFLD"
&XiOHVWXRSRUWXQLGDGGHPHUFDGR"
4XLpQHVWiHQWXHQWRUQRFRPSHWLWLYR"
&XiOHVWXYHQWDMDFRPSHWLWLYD"
&XiOHVWXHVWUDWHJLDGHPHUFDGR"

6LWXPRGHORGHQHJRFLRHV%&WHUHFRPHQGDPRV
WRPDUHQFRQVLGHUDFLyQDOJXQRVHOHPHQWRV
&RQVWUXLUXQDWLHQGDFRQHQWRUQRLQWXLWLYR
 4XHVHDDPLJDEOHDOXVR 
,QFOXLUE~VTXHGDGHSURGXFWRV
0RWRU GH E~VTXHGD R GLUHFWRULR GH SURGXFWRV
LGHQWLILFDEOH
 'DU VXILFLHQWH LQIRUPDFLyQ GH ORV SURGXFWRV
'HVFULSFLyQHLPiJHQHV 
 $xDGLU XQ SURFHVR GH VHOHFFLyQ GH SURGXFWRV
&DUULWR GH FRPSUD R SURFHVR SDUD DJUHJDU
DUWtFXORV
'HILQLUHOSURFHVRGHSDJRV 3DJR\UHJLVWUR 

Interiores.indd 134

5/9/13 6:29 PM

(Q XQD OHFFLyQ SRVWHULRU VHJXLUHPRV KDEODQGR GH


HVWRVHOHPHQWRVFODYHSDUDXQDWLHQGDRQOLQH
(Q UHVXPHQ SDUD SRGHU FRPHQ]DU D KDFHU
WUDQVDFFLRQHV D WUDYpV GHO FRPHUFLR HOHFWUyQLFR
VHJ~Q HO PRGHOR %& GHEHV LGHQWLILFDU OD
LPSRUWDQFLD GH WHQHU HO SURGXFWR FRUUHFWR HQ HO
OXJDUFRUUHFWR\HQHOPRPHQWRFRUUHFWR
< SDUD PDQWHQHU XQ EXHQ SRVLFLRQDPLHQWR XVDQGR
HVWH PRGHOR KD\ TXH UHFRQRFHU OD LPSRUWDQFLD GH
OD WRPD GH SHGLGR \ OD HQWUHJD GH SURGXFWRV HQ
WLHPSR \ IRUPD SDUD OD FRQVWUXFFLyQ GH OHDOWDG HQ
ORVFOLHQWHV\ODUHFRPHQGDFLyQGHERFDDERFD

&DVRGHp[LWR
%LHQ DKRUD TXH KHPRV FRQRFLGR ODV EDVHV GH HVWH
PRGHOR GH QHJRFLR RQOLQH TXHUHPRV SUHVHQWDUWH XQ
HMHPSORGHp[LWR
(O FDVR WUDWD GH XQ HPSUHVDULR PH[LFDQR
LQGHSHQGLHQWH LQJHQLHUR HQ WHOHFRPXQLFDFLRQHV
HJUHVDGRGHOD81$0
(Q VXV SULPHURV DxRV FRPHQ]y FRQ XQD HPSUHVD GH
FDEOHDGR \ FRQPXWDGRUHV \ DO SDVR GH DOJXQRV DxRV
OD HPSUHVD FHUUy 1XHVWUR PLFURHPSUHVDULR WXYR
GLIHUHQWHV LGHDV SDUD HPSUHQGHU XQ QHJRFLR HQ
WHOHFRPXQLFDFLRQHVHQWUHHOODV&yPRGDUHOVHUYLFLR
GHOODPDGDVGHODUJDGLVWDQFLDSRUXQSUHFLRPtQLPR"

Interiores.indd 135

5/9/13 6:29 PM

&DVRGHe[LWR
SHUR QLQJXQD GH VXV LGHDV IXQFLRQy FRPR pO OR
KXELHUD LPDJLQDGR 8Q GtD GHFLGLy FRPHUFLDOL]DU
ORFDOL]DGRUHV YHKLFXODUHV *36 SDUD EULQGDU
VHJXULGDG D ORV GXHxRV GH YHKtFXORV IORWLOODV
HPSUHVDVH[SRUWDGRUDV\FOLHQWHVGHWRGRWLSR
$Vt TXH VH SXVR HQ FRQWDFWR FRQ GLIHUHQWHV
SURYHHGRUHV GH HTXLSRV SUREiQGRORV HQ VXV
SURSLRV YHKtFXORV SDUD HYDOXDU OD FDOLGDG
)LQDOPHQWH GHFLGLy WUDEDMDU FRQ XQD FRPSDxtD
FKLQDHLPSRUWDUVXVHTXLSRVGHPDQHUDSHULyGLFD

&DVRGHe[LWR
1XHVWUR PLFURHPSUHVDULR FRPHQ]y D YHQGHU HO
VHUYLFLR GH ORFDOL]DFLyQ VDWHOLWDO GH YHKtFXORV GH
SXHUWDHQSXHUWDSHURVHGLRFXHQWDTXHQHFHVLWDUtD
WHQHU XQD IXHU]D GH YHQWD SDUD SRGHU FUHFHU
UiSLGDPHQWH $Vt IXp FRPR HO LQJHQLHUR SHQVy HQ OD
RSFLyQ GH DQXQFLDUVH HQ OtQHD \ OOHJDU D PLOHV GH
XVXDULRV/RSULPHURTXHKL]RIXHFUHDUVXWLHQGDHQ
OtQHD XWLOL]DQGR XQD SODQWLOOD ZHE SDUD FUHDU HO VLWLR
0X\ ELHQ DKRUD FRQWDED FRQ SUHVHQFLD HQ OtQHD
SHUR &XiQWDV SHUVRQDV SRGUtDQ OOHJDU D YHUOD"
(QWRQFHV QXHVWUR HPSUHVDULR GHFLGLy DQXQFLDUVH HQ
0HUFDGR/LEUH \ DO SRFR WLHPSR FRPHQ]DURQ D
FRQWDFWDUOR PXFKRV FOLHQWHV LQWHUHVDGRV HQ VX
SURGXFWR

Interiores.indd 136

5/9/13 6:29 PM

&DVRGHe[LWR
(OLQJHQLHURTXLVRSUREDURWURPpWRGRGHSXEOLFLGDG
\VHLQVFULELyD*RRJOH$GZRUGVGHPDQHUDTXHVX
DQXQFLR \ VLWLR ZHE DSDUHFLHUDQ DO FDER GH XQD
VLPSOH E~VTXHGD HQ *RRJOH 'H HVWD PDQHUD
FXDOTXLHU SHUVRQD TXH EXVFDUD SDODEUDV
UHODFLRQDGDVDVXSURGXFWRVHSRQGUtDQHQFRQWDFWR
FRQpO
$FWXDOPHQWH HO LQJHQLHUR YHQGH FDQWLGDGHV
LPSRUWDQWHVGHHTXLSRVORFDOL]DGRUHV\ODFRPSDxtD
FKLQDORKDFRQYHUWLGRHQVXSULQFLSDOGLVWULEXLGRUHQ
HO'LVWULWR)HGHUDOSRUORTXHFXDOTXLHUSHUVRQDTXH
TXLHUD YHQGHU HTXLSRV GHEHUi FRPSUDUORV FRQ
QXHVWURLQJHQLHUR

&LHUUH
&RPR SXHGHV YHU HVWH PRGHOR GH QHJRFLR
RQOLQHSXHGHD\XGDUWHDVHUXQFDVRH[LWRVR
<D HVWDPRV SRU FRQFOXLU OD OHFFLyQ HQ ODV
VLJXLHQWHV DSUHQGHUHPRV VREUH RWURV PRGHORV
GH QHJRFLR HQ OtQHD FRQ ORV TXH WDO YH] SRGUiV
LGHQWLILFDUWH SDUD FRPHQ]DU D DGRSWDU XQR GH
HOORV
3HUR DQWHV GH FDPELDU GH PRGHOR WH SHGLPRV
TXH SDUWLFLSHV HQ HO IRUR GH HVWD OHFFLyQ GDQGR
FXDWUR HMHPSORV TXH FRQR]FDV TXH XWLOLFHQ HO
PRGHOR%&HQOtQHD
+DVWDSURQWR

Interiores.indd 137

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 4: Modelos de Negocio en Lnea
______________________________________________________________________________

Instrucciones: Ya has concluido la leccin 4 del curso, ahora responde a las siguientes
preguntas y haz lo que se te pide para repasar los conceptos aprendidos.
1. En esta leccin se mencionaron todos los diferentes modelos de negocio en lnea.
Relaciona las columnas para cada tipo de modelo.
a) B2B
b) C2C
c) B2C
d) C2G
e) P2P

a) Par a par
b) Consumidor a Gobierno
c) Negocio a Negocio
d) Consumidor a Consumidor
e) Consumidor a Negocio

2. Qu es un modelo de negocio?

3. Enlista 4 de los elementos que fueron mencionados como indispensables para


considerar en cualquier modelo de negocio.
a)
b)
c)
d)
4. Piensa en dos ejemplos de organizaciones que utilicen el modelo de negocio Business
to Consumer: de Negocio a Consumidor.
5. Por qu los portales de bsqueda como AOL, Bing, Google, Yahoo, etc. utilizan el
modelo de negocio B2C? Argumenta.
6. En la leccin mencionamos un caso de xito de este modelo de negocio en lnea (B2B).
Investiga ms sobre el caso de Mercado libre en Internet. Tambin puedes consultar
alguna de las siguientes ligas:
http://mycie.wordpress.com/2009/10/02/el-extrano-caso-de-mercado-libre-punto-com/
http://www.historiasdegrandesexitos.com/2009/04/historia-de-mercado-libre.html

Interiores.indd 138

5/9/13 6:29 PM

7. Se mencion que para poder adoptar este modelo deberas responder a ciertas
preguntas. Aprovecha este momento para hacerlo:
a. Cul es tu oferta de valor?
b. Quin constituye tu audiencia?
c. Cul es tu oportunidad de mercado?
d. Quin est en tu entorno competitivo?
e. Cul es tu ventaja competitiva?
f. Cul es tu estrategia de mercado?
8. En la leccin se dieron algunos consejos para tener xito al utilizar este modelo de
negocio. Por qu es importante incluir suficiente informacin de tus productos o
servicios?

9. Recuerdas el caso de xito del microempresario mexicano? Piensa si conoces algn


caso de xito similar.

10. En menos de un prrafo, explica el modelo de negocio B2C de negocio a consumidor.

Interiores.indd 139

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 5
Modelos de Negocio en Lnea 2
Duracin:

30 min

Objetivo de aprendizaje: Distinguir los diferentes modelos de negocio online


Subtemas:

Net marketplaces
Redes industriales privadas
Ventajas del B2B

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 7:
- Cuadro con 4 clulas

D 2:
- Texto en el fondo

- Consideraciones generales
1. Net marketplaces

D 10:
- Logo Grainger

1.1 E-distribuidor
1.2 E-procurement

Interiores.indd 140

5/9/13 6:29 PM

1.3 Intercambios
1.4 Consorcio industrial

2. Redes industriales privadas

3. Ventajas de B2B

D 20:
- Logo VW

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

D 20:
- Escribe en el foro de esta leccin cuatro
ejemplos que conozcas que utilicen el modelo
B2B en lnea.

Interiores.indd 141

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ0RGHORVGHQHJRFLRHQ
OtQHD%%

+RODELHQYHQLGRRWUDYH]DHVWHFXUVRGHLQWURGXFFLyQ
DO FRPHUFLR HOHFWUyQLFR FRPR FRPHQWDPRV HQ OD
OHFFLyQ DQWHULRU H[LVWHQ GLVWLQWRV PRGHORV GH QHJRFLR
GHFRPHUFLRHQOtQHD/RVUHFXHUGDV"
%LHQ HO WHPD JHQHUDO SDUD HVWD OHFFLyQ VLJXH VLHQGR
PRGHORV GH QHJRFLR HQ OtQHD \ QRV HQIRFDUHPRV HQ
HOPRGHOR%XVLQHVVWR%XVLQHVV
/RVVXEWHPDVTXHUHYLVDUHPRVVRQ
1HWPDUNHWSODFHV
5HGHVLQGXVWULDOHVSULYDGDV
9HQWDMDVGHO%%
(OREMHWLYRGHDSUHQGL]DMHGHHVWDOHFFLyQVLJXHVLHQGR
GLVWLQJXLUORVGLIHUHQWHVPRGHORVGHQHJRFLRRQOLQH

Interiores.indd 142

5/9/13 6:29 PM

,QWURGXFFLyQ
(O PRGHOR GH QHJRFLR EXVLQHVV WR EXVLQHVV VH
UHILHUH D DTXHOORV QHJRFLRV FX\RV FOLHQWHV VRQ
RWUDV RUJDQL]DFLRQHV \ DXQTXH QR WRGRV ORV
QHJRFLRV HQ OtQHD VLJXHQ HVWH PRGHOR HV
LPSRUWDQWHFRQRFHUOR\DTXHSXHGHDEULURSFLRQHV
LQWHUHVDQWHVSDUDWXHPSUHVD
(Q (VWDGRV 8QLGRV VH HVWLPD TXH HVWH WLSR GH
QHJRFLR HV  YHFHV PiV JUDQGH TXH HO H
FRPPHUFH %& (Q  ORV LQJUHVRV GH ORV
GLIHUHQWHV QHJRFLRV %% HQ OtQHD DVFHQGLHURQ D
ORVELOORQHVGHGyODUHV

(OWHPDGHHFRPPHUFH%%SXHGHVHUFRPSOHMR
GHELGR D ODV PXFKDV IRUPDV HQ TXH HO ,QWHUQHW
SXHGH XWLOL]DUVH SDUD DSR\DU HO LQWHUFDPELR GH
ELHQHV\SDJRVHQWUHRUJDQL]DFLRQHVFDGHQDVGH
YDORUHILFLHQWHV\FRODERUDFLyQ
(QJHQHUDOSRGHPRVKDEODUGHGRVVLVWHPDV%%
HQ OtQHD ORV FRQRFHV" VRQ ORV 1HW
PDUNHWSODFHVRLQWHUFDPELRV\5HGHVLQGXVWULDOHV
SULYDGDV(VWRVDVXYH]VHGLYLGHQHQVXEWLSRV
TXHGLVFXWLUHPRVHQODVLJXLHQWHVHFFLyQ

Interiores.indd 143

5/9/13 6:29 PM

3ULPHUR HQWHQGDPRV HVWDV GRV FDWHJRUtDV


JHQHUDOHV/RV QHW PDUNHWSODFHV XQHQ D WUDYpV
GH ,QWHUQHW D YHQGHGRUHV \ FRPSUDGRUHV
SRWHQFLDOHV HQ XQ VROR PHUFDGR GLJLWDO +D\
PXFKRV WLSRV GH QHW PDUNHWSODFHV \ VH SXHGHQ
FODVLILFDU GH DFXHUGR D ORV PHFDQLVPRV GH
HVWDEOHFHU SUHFLRV VXEDVWD QHJRFLDGR SUHFLR
ILMR GHDFXHUGRDOWLSRGHPHUFDGRTXHDWLHQGHQ
R SRU SURSLHGDG GH OD PLVPD LQGXVWULD R
LQWHUPHGLDULRV 

3RUVXSDUWHODVUHGHVLQGXVWULDOHVUH~QHQDXQJUXSR
HVWUDWpJLFR GH HPSUHVDV TXH FRODERUDQ SDUD
GHVDUUROODUFDGHQDVGHYDORUHILFLHQWHVSDUDVDWLVIDFHU
ODGHPDQGD(VWDFDWHJRUtDVHDVHPHMDDODVUHGHVGH
FRODERUDFLyQLQWHUQD
$KRUD KDEODUHPRV VREUH ODV VXEFDWHJRUtDV GHQWUR GH
QHWPDUNHWSODFHV\ODVUHGHVLQGXVWULDOHV
&RPR PHQFLRQDPRV ORV QHW PDUNHWSODFHV VH
SXHGHQ FODVLILFDU GH GLVWLQWDV IRUPDV HQ HVWH FDVR
SUHVHQWDPRV XQD FODVLILFDFLyQ FHQWUDGD HQ HO WLSR GH
VROXFLyQ TXH RIUHFH DO QHJRFLR \ VH WRPDQ HQ FXHQWD
ODV YDULDEOHV OR TXH HO QHJRFLR FRPSUD \ FyPR
FRPSUD

Interiores.indd 144

5/9/13 6:29 PM

1HWPDUNHWSODFHV
/RTXHHOQHJRFLRFRPSUDSXHGHQVHULQSXWVGLUHFWRV
ELHQHV XWLOL]DGRV HQ OD SURGXFFLyQ  R LQGLUHFWRV
ELHQHV XWLOL]DGRV SDUD DSR\DU OD SURGXFFLyQ  \
FyPR FRPSUD SXHGH VHU D ODUJR SOD]R FRQ XQ
FRQWUDWR GH FRODERUDFLyQ ILUPDGR R WHPSRUDO HQ HO
FXiO ODV FRPSUDV VRQ HVSRUiGLFDV \ QR H[LVWH XQD
UHODFLyQHVWDEOHFLGDGHSRUPHGLR
$KRUDYHDPRVORVFXDWURWLSRVGHQHWPDUNHWSODFHV
TXHREWHQHPRVGHHVWDFODVLILFDFLyQ
(GLVWULEXLGRU

,QWHUFDPELRV

(SURFXUHPHQW

&RQVRUFLR
,QGXVWULDO

(GLVWULEXLGRU
8Q SULPHU WLSR GH PHUFDGR HV VHU HGLVWULEXWRU R
GLVWULEXLGRU HOHFWUyQLFR (VWH WLSR GH SURYHHGRU
RIUHFH XQ FDWiORJR HQ OtQHD TXH FRQWLHQH ORV
SURGXFWRVGHPLOHVGHPDQXIDFWXUHURVGLUHFWRV(VWH
WLSR GH FRPHUFLR HV FRPSDUDEOH D $PD]RQ SHUR
GLULJLGRDODLQGXVWULD
/RV HGLVWULEXLGRUHV VRQ LQWHUPHGLDULRV TXH RIUHFHQ
D FOLHQWHV LQGXVWULDOHV XQ VyOR OXJDU GRQGH FRPSUDU
VXVELHQHVLQGLUHFWRVFRQIRUPHORVQHFHVLWHQ
/RVSUHFLRVGHORVSURGXFWRVQRUPDOPHQWHVRQILMRV
SHUR VH RIUHFHQ GHVFXHQWRV D JUDQGHV FOLHQWHV \
RWURVLQFHQWLYRVFRPRFUpGLWR

Interiores.indd 145

5/9/13 6:29 PM

(GLVWULEXLGRU
/RV EHQHILFLRV SDUD ORV FOLHQWHV VRQ UHFRUWDU HO WLHPSR
GH E~VTXHGD EDMDU HO FRVWR GH WUDQVDFFLyQ WHQHU XQD
DPSOLDVHOHFFLyQHQWUHJDUiSLGD\SUHFLRVEDMRV
(Q JHQHUDO ORV HGLVWULEXLGRUHV DWLHQGHQ D PXFKDV
LQGXVWULDV FRQ SURGXFWRV GH PXFKRV SURYHHGRUHV
3XHGHVSHQVDUHQXQHMHPSORGHXQHGLVWULEXLGRU"
8Q HMHPSOR GH HVWH PRGHORV HV OD SODWDIRUPD HQ OtQHD
GH 2IILFH 0D[ %XVLQHVV VROXWLRQV ODQ]DGD HQ 0DU]R
GH  EXVFDQGR IDFLOLWDU OD JHVWLyQ GH SHGLGRV
HQWUHJDV \ IDFWXUDFLyQ SHUPLWLU OD DGPLQLVWUDFLyQ GH
FyGLJRV FDWHJRUL]DFLyQ GH SURGXFWRV \ RIUHFHU
IXQFLRQDOLGDGHV FRPR SRGHU FRPSDUDU DUWtFXORV
IiFLOPHQWH

(GLVWULEXLGRU
2WUR FDVR UHFRQRFLGR HQ (VWDGRV 8QLGRV \ TXH \D
YHQGHHQOtQHDHQ0p[LFRHVHOGH*UDLQJHUFRP6X
PRGHOR VH FHQWUD HQ FRQYHUWLUVH HQ HO SULQFLSDO
GLVWULEXLGRU GH VXPLQLVWURV 052 0DQWHQLPLHQWR
5HIDFFLyQ \ 2SHUDFLyQ  (O FDWiORJR LPSUHVR GH
*UDLQJHU SHVD PiV GH  NLORV \ D VX FDWiORJR HQ
OtQHDDJUHJDQPiVGHSURGXFWRV
$KRUD YHDPRV XQ VHJXQGR WLSR GH 1HW PDUNHWSODFH
HO HSURFXUHPHQW TXH HV XQ LQWHUPHGLDULR TXH
FRQHFWD D FLHQWRV GH SURYHHGRUHV HQ OtQHD
RIUHFLHQGR SDUWHV GH UHSDUDFLyQ \ PDQWHQLPLHQWR D
QHJRFLRV TXH SDJDQ XQD FXRWD SRU DFFHGHU DO
FDWiORJR

Interiores.indd 146

5/9/13 6:29 PM

(SURFXUHPHQW
(QFLHUWDIRUPDHVWHPRGHORGHQHJRFLRHVXQD
H[SDQVLyQ GHO HGLVWULEXLGRU DO UHXQLU FDWiORJRV
HQ OtQHD GH PXFKRV SURYHHGRUHV \ FREUDQGR
FRPLVLyQ SRU YHQWDV UHDOL]DGDV \ FXRWDV SRU
DFFHGHUDODUHG
$ OD YH] HVWDV HPSUHVDV RIUHFHQ VHUYLFLRV GH
DGPLQLVWUDFLyQ GH OD FDGHQD GH YDORU WDQWR D
YHQGHGRUHV FRPR FRPSUDGRUHV 3DUD ORV
FRPSUDGRUHV ODV FRPSDxtDV GH HSURFXUHPHQW
RIUHFHQDXWRPDWL]DUORVSURFHVRVGHyUGHQHVGH
FRPSUDUHTXLVLWRVIDFWXUDFLyQ\SDJRV

$ORVYHQGHGRUHVOHVRIUHFHVHUYLFLRVGHFUHDFLyQGH
FDWiORJRV DGPLQLVWUDFLyQ GH FRQWHQLGRV \ SHGLGRV
IDFWXUDFLyQ HQYtRV HQWUH RWURV /RV FRPSUDGRUHV
REWLHQHQ OD YHQWDMD GH SRGHU REWHQHU SURGXFWRV GH
GLIHUHQWHVHPSUHVDV\KDFHUFRPSDUDFLRQHVHQWUHOD
RIHUWD
(Q 0p[LFR $GTXLUD HV XQD HPSUHVD HQ OtQHD TXH
VLJXHHVWHPRGHOR
6X REMHWLYR HV RSWLPL]DU OD JHVWLyQ GH FRPSUDV \ HO
SURFHVR GH DSURYLVLRQDPLHQWR XWLOL]DQGR VROXFLRQHV
WHFQROyJLFDV
3UHVHQWiQGRVH FRPR XQ LQWHUPHGLDULR HQWUH
SURYHHGRUHV \ FOLHQWHV $GTXLUD DJLOL]D OD FDGHQD GH
YDORUGHODVHPSUHVDVTXHXWLOL]DQVXVVHUYLFLRV

Interiores.indd 147

5/9/13 6:29 PM

,QWHUFDPELRV
2WUR PRGHOR GHQWUR GH ORV 1HW PDUNHWSODFHV VRQ
ORV,QWHUFDPELRVTXHVRQPHUFDGRVHQOtQHDTXH
FRQHFWDQ D SURYHHGRUHV \ FRPSUDGRUHV HQ XQ
DPELHQWH HQ WLHPSR UHDO  (VWRV PHUFDGRV VRQ
SDUDVHJPHQWRVHVSHFtILFRVGHODLQGXVWULD
/RV LQWHUFDPELRV REWLHQHQ JDQDQFLDV DO FREUDU
XQD FRPLVLyQ SRU WUDQVDFFLyQ \ HO SUHFLR GH ORV
SURGXFWRV VH GHWHUPLQD SRU QHJRFLDFLRQHV HQ
OtQHDVXEDVWDRSUHFLRILMR

6LQ HPEDUJR HVWH PRGHOR QR KD VLGR PX\ H[LWRVR


GHELGR D TXH DO FUHDU XQ PHUFDGR JOREDO S~EOLFR
ORV SURYHHGRUHV WLHQHQ TXH YHQGHU VXV SURGXFWRV
FRQ XQ PDUJHQ PX\ EDMR \D TXH VXV SUHFLRV
FRPSLWHQ GLUHFWDPHQWH FRQ SURYHHGRUHV D QLYHO
PXQGLDO
3RU RWUR ODGR ORV FRQVRUFLRV LQGXVWULDOHV VRQ
PHUFDGRVTXHSHUPLWHQDFOLHQWHVFRPSUDULQVXPRV
GHXQJUXSRVHOHFFLRQDGRGHSDUWLFLSDQWHV(QHVWH
WLSR GH PHUFDGRV VH HVWDEOHFHQ FRQWUDWRV D ODUJR
SOD]R \ VH GHVDUUROODQ UHODFLRQHV GH FOLHQWH
SURYHHGRU XQLHQGR ORV HVIXHU]RV GH OD LQGXVWULD
SDUDHVWDUHQVLQFURQtD

Interiores.indd 148

5/9/13 6:29 PM

(O REMHWLYR GH ORV FRQVRUFLRV LQGXVWULDOHV HV XQLILFDU


ODVFDGHQDVGHVXPLQLVWURGHQWURGHXQDLQGXVWULDHQ
ORV GLIHUHQWHV QLYHOHV /DV JDQDQFLDV DGTXLULGDV DO
RSHUDU HVWH WLSR GH PHUFDGR VH UHLQYLHUWHQ HQ OD
PLVPD LQGXVWULD $OJXQRV HMHPSORV GH HVWH PRGHOR
VRQ([RVWDUSDUDODLQGXVWULDDHURHVSDFLDO6XSSO\2Q
SDUD OD LQGXVWULD DXWRPRWUL] \ 4XDGUHP SDUD OD
LQGXVWULDPLQHUD
(O PRGHOR GH 1HW 0DUNHWSODFHV HQ JHQHUDO KD
SDVDGR SRU IDVHV GH SUXHED \ HUURU TXH OH KDQ
SHUPLWLGR HYROXFLRQDU \ UHFRQRFHU TXH HO YDORU UHDO
HVWi HQ FDPELDU HO SURFHVR GH SURFXUHPHQW R
DGTXLVLFLyQODFDGHQDGHVXPLQLVWURV\HOSURFHVRGH
FRODERUDFLyQHQWUHHPSUHVDV

/DV WUDQVDFFLRQHV %% TXH VH UHDOL]DQ HQ OtQHD


FUHFHQPXQGLDOPHQWHHQ(VWDGRV8QLGRVHQWUHHO
 \  DQXDO 7DQWR FRPSUDGRUHV FRPR
YHQGHGRUHVDGRSWDQFDGDYH]FRQPD\RUIDFLOLGDG
HO XVR GH KHUUDPLHQWDV GLJLWDOHV SDUD HO SURFHVR
GHFRPSUDYHQWD
4XpYHQWDMDVYHVHQORV1HW0DUNHWSODFHV"7H
LQYLWRDGDUWXRSLQLyQHQHOIRUR
$KRUD KDEOHPRV VREUH ODV UHGHV LQGXVWULDOHV
SULYDGDV TXH VRQ DPELHQWHV GH FRPXQLFDFLyQ
EDVDGRV HQ ,QWHUQHW TXH YDQ PiV DOOi GH ORV
SURFHVRV GH DGTXLVLFLyQ \ HQJOREDQ HO FRPHUFLR
FRODERUDWLYR

Interiores.indd 149

5/9/13 6:29 PM

5HGHVLQGXVWULDOHVSULYDGDV
(VWDV UHGHV VXUJHQ FRPR XQD VROXFLyQ D ODV
QHFHVLGDGHV GH FRPXQLFDFLyQ HQWUH JUDQGHV
HPSUHVDV \ VXV SURYHHGRUHV \ DFWXDOPHQWH
FRQIRUPDQODPD\RUSDUWHGHOHFRPPHUFH%%
(PSUHVDV FRPR *( 'HOO &RPSXWHU &LVFR 6\VWHPV
0LFURVRIW ,%0 1LNH &RFD&ROD \ :DOPDUW VRQ VyOR
DOJXQDV JUDQGHV HPSUHVDV RSHUDQGR UHGHV
LQGXVWULDOHV SULYDGDV H[LWRVDV (O PDQWHQHU ORV
SURFHGLPLHQWRV GH HVWDV UHGHV FRQILGHQFLDOHV OH GDQ
XQDYHQWDMDFRPSHWLWLYDDODVHPSUHVDV

5HGHVLQGXVWULDOHVSULYDGDV
9HDPRVXQHMHPSORGHFyPRIXQFLRQDQHVWDVUHGHV
,PDJLQHPRV XQD HPSUHVD GH SURGXFWRV KLJLpQLFRV $O
UHJLVWUDUVH XQD FRPSUD GH XQ SURGXFWR HQ HO
VXSHUPHUFDGR VH HQYtD D OD HPSUHVD \ VXV
SURYHHGRUHV HO QLYHO H[DFWR GH GHPDQGD SDUD FDGD
SURGXFWR
&RQ HVWD LQIRUPDFLyQ VH LQLFLD OD SURGXFFLyQ
DEDVWHFLPLHQWR \ WUDQVSRUWH SDUD UHDSURYLVLRQDU D ORV
GLVWULEXLGRUHVGHOSURGXFWR(VWHVLVWHPDEDVDGRHQOD
GHPDQGDGHSHQGHGHOIXQFLRQDPLHQWRDGHFXDGRGHOD
FDGHQD GH VXPLQLVWURV \ HO ,QWHUQHW KD SHUPLWLGR
HILFLHQWDUHVWRVSURFHVRV

Interiores.indd 150

5/9/13 6:29 PM

5HGHVLQGXVWULDOHVSULYDGDV
,QWHJUDU UHGHV LQGXVWULDOHV SULYDGDV DO VLVWHPD GH
XQD HPSUHVD QR HV GHO WRGR VHQFLOOR (PSUHVDV
OtGHUHVFRPR2UDFOH,%0\6$3RIUHFHQRSFLRQHV
GH %% SHUR LPSOHPHQWDU HVWRV PyGXORV SXHGH
UHVXOWDUFRVWRVRVLQRVHFXHQWDFRQXQVLVWHPDGH
DEDVWHFLPLHQWRLQWHJUDGR
2WUD RSFLyQ SDUD HPSUHVDV PiV SHTXHxDV VRQ
DOWHUQDWLYDVHQODQXEHR6DD6TXHKDQDSDUHFLGR
HQ HO PHUFDGR \ RIUHFHQ IXQFLRQHV SDUD
DGPLQLVWUDUODFDGHQDGHVXPLQLVWURV

9HQWDMDVGH%%
$KRUDKDEOHPRVVREUHDOJXQDVGHODVYHQWDMDVTXH
SUHVHQWD HO PRGHOR %% WDQWR SDUD FRPSUDGRUHV
FRPRYHQGHGRUHV

6HUHGXFHQFRVWRVDGPLQLVWUDWLYRV
%DMDQFRVWRVSDUDFRPSUDGRUHV
6HUHGXFHQFRVWRVGHLQYHQWDULR
%DMDQFRVWRVGHWUDQVDFFLyQDODXWRPDWL]DUSDUWHVGHO
SURFHVRGHDGTXLVLFLyQ
0HMRUDU OD FDOLGDG GH SURGXFWRV DO LQFUHPHQWDU OD
FRRSHUDFLyQHQWUHODVHPSUHVDV\VXVSURYHHGRUHV
5HFRUWDUHOWLHPSRGHSURGXFFLyQ
7UDQVSDUHQFLDHQSUHFLRV

5HFRQRFHVDOJXQDRWUDYHQWDMD"

Interiores.indd 151

5/9/13 6:29 PM

9HQWDMDVGH%%
8Q EXHQ HMHPSOR GH %% HV HO FDVR GHO 1HW
PDUNHWSODFHFRQVWUXLGRSRU9RONVZDJHQ9:SURGXMR
PiVGHPLOORQHVGHFDUURVFDPLRQHV\FDPLRQHWDV
HQ  JHQHUDQGR FDVL  PLO PLOORQHV HQ
JDQDQFLDV &RQ PiV GH  HPSOHDGRV RSHUD
SODQWDVHQ(XURSDIULFD$VLD\$PpULFD
(O SURFHVR GH DGTXLVLFLyQ \ OD UHODFLyQ FRQ
SURYHHGRUHV HV XQD SDUWH FUtWLFD GH VX p[LWR
JDVWDQGR DSUR[LPiGDPHQWH  PLO PLOORQHV HQ
FRPSRQHQWHV SDUWHV DXWRPRWULFHV \ PDWHULDOHV
LQGLUHFWRV +R\ HQ GtD 9RONVZDJHQ DGPLQLVWUD FDVL
WRGDV VXV UHODFLRQHV FRQ SURYHHGRUHV YtD FRPHUFLR
HOHFWUyQLFR

'HVGH HO  FUHy VX SODWDIRUPD 9:*URXS6XSSO\


FRP XQD SODWDIRUPD SULYDGD TXH OH KD SHUPLWLGR
LQWHJUDU D VXV SURYHHGRUHV D VXV SURFHVRV GH
QHJRFLR LQWHUQRV \ FRQWURODU FXLGDGRVDPHQWH TXLpQ
SDUWLFLSD FRPR SURYHHGRU 7RGRV ORV SURYHHGRUHV
SXHGHQ DFFHGHU D OD SODWDIRUPD D WUDYpV GH XQ
QDYHJDGRU VLHPSUH \ FXDQGR KD\DQ VLGR
DXWRUL]DGRV
6X FDWiORJR HQ OtQHD WLHQH DSUR[LPDGDPHQWH 
SURGXFWRV GH  SURYHHGRUHV TXH FODVLILFDQ VXV
SURGXFWRV GH DFXHUGR D XQ HVWiQGDU HVWDEOHFLGR /D
SODWDIRUPD KD SHUPLWLGR D 9: \ VXV SURYHHGRUHV
SURGXFLU D SUHFLRV PiV EDMRV DXPHQWDU OD
FRODERUDFLyQ HQWUH HPSUHVDV HQWUHJDU SURGXFWRV
PiV UiSLGDPHQWH \ PRGHUQL]DU HO SURFHVR GH
PDQXIDFWXUD

Interiores.indd 152

5/9/13 6:29 PM

&LHUUH
5HFDSLWXODQGR HO PRGHOR GH QHJRFLR %% VH SXHGH
GLYLGLU HQ  UDPDV 1HW PDUNHWSODFHV \ 5HGHV
LQGXVWULDOHV SULYDGDV /RV QHW PDUNHWSODFHV VRQ
PHUFDGRV HQ OtQHD TXH SXHGHQ WRPDU GLIHUHQWHV IRUPDV
FRPR HGLVWULEXLGRU HSURFXUHPHQW LQWHUFDPELRV \
FRQVRUFLRV LQGXVWULDOHV /DV UHGHV LQGXVWULDOHV SULYDGDV
SHUPLWHQ OD FRODERUDFLyQ HQWUH HPSUHVDV JUDQGHV \ VXV
SURYHHGRUHVIDFLOLWDQGRORVSURFHVRVGHDEDVWHFLPLHQWR
/RV PRGHORV %% EXVFDQ DSURYHFKDU ORV DYDQFHV GH
,QWHUQHW SDUD EULQGDU VROXFLRQHV \ DJLOL]DU ORV SURFHVRV
GHDEDVWHFLPLHQWRGHODVHPSUHVDV
(QODVLJXLHQWHOHFFLyQKDEODUHPRVVREUHRWURVPRGHORV
GHQHJRFLRD~QPiVLQQRYDGRUHV+DVWDSURQWR

Interiores.indd 153

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 5: Modelos de Negocio en Lnea
______________________________________________________________________________

Instrucciones: Ya has concluido la leccin 5 del curso, ahora responde a las siguientes
preguntas y haz lo que se te pide para repasar los conceptos aprendidos.
1. El tema principal de esta leccin fu el modelo de negocio B2B. Explica qu quieren
decir sus siglas y define este modelo de negocio.

2. Cules son los dos sistemas de Modelo de Negocio B2B en Lnea?


a)
b)
3. Circula la respuesta correcta. Los netmarket places unen en el mercado digital a:
a) Vendedores y Compradores potenciales

b) Vendedores con otros vendedores

4. Por su parte las redes industriales renen a un _____________ de empresas que


colaboran para desarrollar cadenas de valor eficientes para satisfacer la demanda.
5. Inserta la letra de cada concepto en la definicin correcta:
a) E- Distribuidor

b) E- Procurement

c) Intercambio

d) Consorcio Industrial

____ Intermediarios que ofrecen a los consumidores un catlogo con los productos de miles de
manufactureros directos en un solo lugar.
____ Mercados que permiten a clientes comprar insumos de un grupo seleccionado de
participantes.
____ Mercados en lnea que conectan a proveedores y compradores en un ambiente en tiempo
real. Estos mercados son para segmentos especficos de la industria.
____ Intermediario que conecta a cientos de proveedores en lnea, ofreciendo partes de
reparacin y mantenimiento a negocios que pagan una cuota por acceder al catlogo.
6.
Las ________________________________________ son ambientes de comunicacin
basados en Internet que van ms all de los procesos de adquisicin y engloban el comercio
colaborativo. Estas, surgen para resolver la necesidad de comunicar a las grandes empresas
con sus proveedores.

Interiores.indd 154

5/9/13 6:29 PM

7. Qu ejemplos de empresas mencionamos que operen redes industriales famosas?

8. Enlista algunas ventajas del modelo de negocio B2B tanto para compradores como para
vendedores.

9. En esta leccin desarrollamos el caso de xito de una empresa que integr a su negocio
un Net Marketplace con una plataforma privada que le permiti controlar procesos
internos y a sus proveedores. Qu empresa es?

10. Conoces alguna empresa o red de empresas que hayan integrado el modelo de
negocio B2B en lnea?

Interiores.indd 155

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 6
Modelos de Negocio en Lnea 3
Duracin:

30 min

Objetivo de aprendizaje: Distinguir los diferentes modelos de negocio online


Subtemas:

P2P: de par a par


C2C: de consumidor a consumidor
Mobile commerce

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D2
-Texto de fondo: tema, subtemas y objetivo
Diapositiva 3:
- Grficos que ilustren esto a manera de
comic.

Desarrollo
1. P2P: De par a par
- Teora del modelo
-Cmo adoptar este modelo?

D 4:
- Texto de fondo: El modelo de C2C:
Consumidor a Consumidor
- Aadir logotipos de las marcas mencionadas
D 5:
-De fondo:
Foro entre compradores
Catlogos visuales
Servicios de subasta electrnica

Interiores.indd 156

5/9/13 6:29 PM

2.C2C: De consumidor a consumidor


- Teora del modelo
- Cmo integrar este modelo a tu negocio?

Contacto directo con compradores


finales
Espacio publicitario relativamente
econmico

D 6:
-Texto: Modelo de negocio P2P: de par a par
- Imgenes que ilustren la comparticin de
archivos
D 7:
- Logotipos empresas mencionadas en el
fondo

3. Mobile Commerce
- Estadsticas de usuarios de telefona mvil y
banda ancha
- APPS
- Mtodos de pago mvil

D 8:
-Texto de fondo: Comercio Mvil, APPS
D 9:
- Imgenes de celulares, apps de e commerce
y navegacin
D 10:
- Porcentajes en el fondo de pantalla
D 11:
- Imgenes de pantalla de APPS Mviles de
las marcas mencionadas
- Texto: Por dnde empezar?
D 12:
- Grficos que den la sensacin de "fcil
navegacin"
D 13-14:
-Texto de fondo:
1. Revisa tus alternativas
2. Contacta a tu banco
3. Integra el pago mvil
D 15:
-Texto de fondo: Cifras AMIPCI
Logotiopos marcas mencionadas
D 16:
-Grfica en el fondo de pantalla para que el
locutor haga el anlisis sobre de ella.

Cierre
- Resumen

Interiores.indd 157

D 17:
- Texto de fondo: Qu modelo crees que te

5/9/13 6:29 PM

- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 158

ser ms til para hacer negocios en lnea?


Por qu?

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ0RGHORVGH1HJRFLRHQ
/tQHD 

,QIRUPDFLyQ*HQHUDO
%LHQYHQLGR GH QXHYR (Q ODV ~OWLPDV OHFFLRQHV
KHPRV YHQLGR GHVDUUROODQGR HO WHPD GH 0RGHORV
GH 1HJRFLR HQ /tQHD  KDVWD DKRUD FRQRFLPRV
DTXHOORV PRGHORV GH QHJRFLR TXH LPSOLFDQ
GLUHFWDPHQWH D XQD HPSUHVD DKRUD QRV
HQIRFDUHPRVHQPRGHORVPHQRVWUDGLFLRQDOHV

Interiores.indd 159

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O WHPD JHQHUDO GH HVWD OHFFLyQ VLJXH VLHQGR
0RGHORV GH 1HJRFLR HQ /tQHD \ ORV VXEWHPDV
TXHODFRPSRQHQVRQ
33'HSDUDSDU
&&'HFRQVXPLGRUDFRQVXPLGRU
&RPHUFLR0yYLO
(OREMHWLYRGHDSUHQGL]DMHVHUiGLVWLQJXLUORV
GLIHUHQWHVPRGHORVGHQHJRFLRRQOLQH\H[SOLFDUOD
GLIHUHQFLD

&&&RQVXPLGRUDFRQVXPLGRU
(PSHFHPRV FRQ HO PRGHOR GH && &RQVXPLGRU D
&RQVXPLGRU HO FXDO SHUPLWH D ORV FRQVXPLGRUHV
FRQHFWDUVHFRQRWURVFRQVXPLGRUHV\KDFHUQHJRFLR
D WUDYpV GH SRUWDOHV HQ ,QWHUQHW TXH IXQJHQ FRPR
LQWHUPHGLDULRV \ FREUDQ SRU VXV VHUYLFLRV (VWH
PRGHOR FRQVLVWH HQ XQ LQWHUFDPELR GH SURGXFWRV \
VHUYLFLRVDPDQHUDGHVXEDVWD
/RV VLWLRV GH ,QWHUQHW TXH IDFLOLWDQ HVWH WLSR GH
QHJRFLR HQWUH FOLHQWHV ILQDOHV FRQVWLWX\HQ
~QLFDPHQWH XQD SODWDIRUPD TXH IDFLOLWD HVWH
LQWHUFDPELR\VHOHVFRQRFHFRPRHPDUNHWSODFHV
&RQ HVWDV FDUDFWHUtVWLFDV UHFRQRFHV DOJ~Q H
PDUNHWSODFH"

Interiores.indd 160

5/9/13 6:29 PM

$OJXQRV HMHPSORV GH HVWRV SRUWDOHV VHUtDQ H%D\


WRGLWRFRP\0HUFDGR/LEUH(QJHQHUDOHOPRGHORGH
LQJUHVRV SDUD HOORV HV D WUDYpV GH FXRWDV SRU
WUDQVDFFLyQ
(QWUHODVFDUDFWHUtVWLFDVGHHVWHPRGHORHVWiQ
)RURHQWUHFRPSUDGRUHV
&DWiORJRV YLVXDOHVTXH SHUPLWHQ OD FRPSDUDFLyQ
GHSURGXFWRV\SUHFLRV
6HUYLFLRV GH VXEDVWD HOHFWUyQLFD&RQWDFWR GLUHFWR
FRQFRPSUDGRUHVILQDOHV
(VSDFLRSXEOLFLWDULRUHODWLYDPHQWHHFRQyPLFR

33'HSDUDSDU
/D PDQHUD HQ OD TXH VH SXHGH SDUWLFLSDU GH HVWH
PRGHOR HV LQVFULELpQGRVH D DOJXQR GH HVWRV H
PDUNHWSODFHV GHGLFDGDV D FRQHFWDU FOLHQWHV FRQ
RWURVFOLHQWHV\HPSH]DUDKDFHUQHJRFLRV
/RV QHJRFLRV 33 GH SDU D SDU D\XGDQ D ORV
FRQVXPLGRUHV D FRPSDUWLU VHUYLFLRV RQOLQH \ VXV
LQJUHVRV SURYLHQHQ GH FXRWDV GH LQVFULSFLyQ
DQXQFLRV \ FXRWDV SRU WUDQVDFFLyQ (VWH PRGHOR
FRQVLVWH HQ TXH ORV XVXDULRV FRPSDUWHQ DUFKLYRV
TXHWLHQHQHQVXVSURSLDVFRPSXWDGRUDV

Interiores.indd 161

5/9/13 6:29 PM

33'HSDUDSDU
(O33HVXQPRGHORTXHQDFLyFRPRSURWRFRORGH
LQWHUFDPELR GH DUFKLYRV TXH WLHQH XQD IRUPD GH
HVWDEOHFHU UHODFLRQHV GH SURGXFFLyQ /D
FRPSDUWLFLyQ GH DUFKLYRV 33 HV OD FDUD PiV
YLVLEOH GH QXPHURVDV IRUPDV GH RUJDQL]DFLyQ
FRPXQLWDULD
(QORV~OWLPRVDxRVDOJXQRVGHORVP~OWLSOHVVLWLRV
TXH RIUHFtDQ ODV EDVHV GH GDWRV SDUD EXVFDU
DUFKLYRV HQ FRPSXWDGRUDV DMHQDV SRU PHGLR GH
SURWRFRORVVXIULHURQVDQFLRQHVSRUYLRODFLRQHVDOD
3URSLHGDG,QWHOHFWXDOTXHORVREOLJDURQDFHUUDU

33'HSDUDSDU
3HUR DOJXQDV HPSUHVDV FRPR *RRJOH R
)DFHERRN KDQ VDELGR FRPSUHQGHU HVWR \
FDQDOL]DQ ORV FRQWHQLGRV TXH SURGXFH OD
FRPXQLGDGDSURSLiQGRVHGHODJDQDQFLDTXHHVWR
JHQHUD
3DUD ILQDOL]DU HVWD OHFFLyQ DQDOL]DUHPRV XQ
PRGHORGHQHJRFLRTXHHVWiDGTXLULHQGRFDGDYH]
PiV LPSRUWDQFLD HQ HVWD VRFLHGDG HO FRPHUFLR
PyYLORPFRPPHUFH
(VWH PRGHOR GH QHJRFLR WRPD ODV EDVHV GHO
FRPHUFLRHOHFWUyQLFR\ODVDGHF~DGHPDQHUDTXH
WRGDV ODV WUDQVDFFLRQHV SXHGHQ VHU HMHFXWDGDV
GHVGH XQ WHOpIRQR PyYLO X RWUR GLVSRVLWLYR PyYLO
FRPRVPDUWSKRQHVRWDEOHWV

Interiores.indd 162

5/9/13 6:29 PM

&RPHUFLR0yYLO
(O JUDQ FUHFLPLHQWR TXH KD WHQLGR OD WHOHIRQtD
FHOXODU \  ODV FDSDFLGDGHV GH QDYHJDFLyQ SRU
,QWHUQHW FRQ OD TXH FXHQWDQ JUDQ SDUWH GH ORV
GLVSRVLWLYRV FHOXODUHV GLVSRQLEOHV HQ HO PHUFDGR
KDFHQGHOPRELOH&RPPHUFHXQQXHYRPHGLRSDUD
ODYHQWD\GLVWULEXFLyQGHSURGXFWRVRVHUYLFLRV
3RUGRQGHVHPLUHODJHQWHHVWiHQVXVWHOpIRQRV
LQWHOLJHQWHV SHUR PXFKRV QR HVWiQ KDEODQGR
HVWiQ QDYHJDQGR \ XVDQGR DSOLFDFLRQHV (VWR
KDFH DO PRGHOR GH QHJRFLR P FRPPHUFH XQ
EODQFR WHQWDGRU SDUD ORV YHQGHGRUHV \
PHUFDGyORJRV

7DQVRORHQ0p[LFRKD\PLOORQHVGHXVXDULRV
GHVHUYLFLRVGHWHOHIRQtDPyYLO\ODVVXVFULSFLRQHV
DOVHUYLFLRGHEDQGDDQFKDPyYLOHVWiQ
DXPHQWDQGRVLJQLILFDWLYDPHQWH6HJ~QGDWRV
UHFLHQWHVGH&RIHWHODFWXDOPHQWHKD\PLOORQHV
GHPH[LFDQRVTXHWLHQHQDFFHVRD,QWHUQHWGHVGH
VXFHOXODUXQDXPHQWRGHOUHVSHFWRDODxR
SDVDGR
$QLYHOPXQGLDODSUR[LPDGDPHQWHELOORQHVGH
SHUVRQDVWLHQHQDFFHVRDODZHEGHVGHVX
VPDUWSKRQH

Interiores.indd 163

5/9/13 6:29 PM

(VWHPRGHORGHQHJRFLRHVFRQRFLGRFRPROD
QXHYDJHQHUDFLyQGHOFRPHUFLRHOHFWUyQLFR3DUD
H[SORWDUHOSRWHQFLDOGHHVWHPRGHORGLIHUHQWHV
FRPSDxtDVWHOHIyQLFDVHLQVWLWXFLRQHVEDQFDULDV
KDQWUDEDMDGRSDUDGHVDUUROODUVPDUWSKRQHV
FDSDFHVGHOOHYDUDFDERHVWDVWUDQVDFFLRQHV
%iVLFDPHQWHHVWHPRGHORDSR\DDODVDSOLFDFLRQHV
GHQHJRFLR $336 SDUDVXXVRHQODWHFQRORJtD
LQDOiPEULFD'HHVWDPDQHUDFDGDYH]PiV
VHUYLFLRV\SURGXFWRVSXHGHQDGTXLULUVHSRUPHGLR
GHOWHOpIRQRLQWHOLJHQWHVLQQHFHVLGDGGHWHQHUXQD
FRPSXWDGRUDSDUDHIHFWXDUWUDQVDFFLRQHVHQOtQHD

$OJXQDV HPSUHVDV \D RIUHFHQ OD SRVLELOLGDG GH


YHQWDSRUPHGLRGH$336PyYLOHV
+DV XWLOL]DGR WX WHOpIRQR R WDEOHW SDUD KDFHU
DOJXQDWUDQVDFFLyQ"
(MHPSORV FRPXQHV VRQ &LQHSROLV &LQHPH[
,QWHUMHW\LWXQHV
(YLGHQWHPHQWH HVWH PRGHOR GH QHJRFLR HV XQD
JUDQ RSRUWXQLGDG SDUD WX QHJRFLR 3HUR SRU
GyQGHHPSH]DU"
6L WX GHVHDV DGRSWDU HVWH PRGHOR GH QHJRFLR WH
VXJHULPRV GHVDUUROODU WX $33 PyYLO \ DGDSWDU WX
VLWLR ZHE SDUD TXH SXHGD VHU YLVLWDGR GHVGH
WHOpIRQRV PyYLOHV \ GH LJXDO PDQHUD SXHGDV
SURFHVDUSDJRVIDFLOPHQWH

Interiores.indd 164

5/9/13 6:29 PM

3LHQVDHQODVUD]RQHVSRUODVTXHWXVFOLHQWHV
YLVLWDQWXVLWLRZHEVREUHWRGRVLHVWiQHQFDPLQR
DDOJ~QOXJDU(VWRWHD\XGDUiDVLPSOLILFDU\
SULRUL]DUORVERWRQHVTXHGHEHUiQHVWDU
GLVSRQLEOHVHQWX$33PyYLO
$VHJ~UDWHGHTXHHQODSDQWDOODGHXQVPDUWSKRQH
RWDEOHWVHDIiFLOQDYHJDUHQWXVLWLRZHEODV
FRVDVSULQFLSDOHVTXHEXVFDWXS~EOLFRGHEHQVHU
IiFLOHVGHORFDOL]DU7X$33QRVXVWLWX\HWXWLHQGD
YLUWXDOSHURODFRPSOHPHQWD
(QODOHFFLyQVREUH2QOLQH0DUNHWLQJ
VHJXLUHPRVKDEODQGRVREUHWHPDVUHODFLRQDGRVDO
PFRPPHUFH

&RPHUFLR0yYLO
$KRUDKDEOHPRVVREUHSDJRVHQFRPHUFLRPyYLO
3DUDDOJXQRVVHFWRUHVHQWUHHOORVDOJXQRV
FRPHUFLDQWHVXWLOL]DURSFLRQHVGHSDJRPyYLOHVWi
HPSH]DQGRDWHQHUVHQWLGR6LHVWiVEXVFDQGRD
DFHSWDUSDJRVPyYLOHVSDUDWXQHJRFLRWHQHQFXHQWD
ORVVLJXLHQWHVSDVRV
5HYLVDWXVDOWHUQDWLYDV/DSULPHUDRSFLyQHVHO
XVRGHXQGLVSRVLWLYROHFWRUGHWDUMHWDSDUDSURFHVDU
SDJRVGHWDUMHWDVGHFUpGLWR(VWHVHUYLFLRSXHGHV
FRQWUDWDUORFRQLQVWLWXFLRQHVEDQFDULDVWHPDTXH
SURIXQGL]DUHPRVHQODOHFFLyQVREUHPHGLRVGH
SDJRV

Interiores.indd 165

5/9/13 6:29 PM

/DVHJXQGDRSFLyQHVODGHRIUHFHUSDJRVVLQ
FRQWDFWR(VWRSHUPLWHDORVFRQVXPLGRUHVSDJDU
SRUORVELHQHV\VHUYLFLRVPHGLDQWHXQ
LQWHUPHGLDULRTXH\DWLHQHDOPDFHQDGDVX
LQIRUPDFLyQEDQDFDULDSDUDHIHFWXDUHOSDJR
&RQWDFWDDWXEDQFR6LWXHPSUHVD\DGLVSRQH
GHXQDFXHQWDEDQFDULDFRQXQEDQFRQDFLRQDO
DYHULJXDVLRIUHFHXQVHUYLFLRGHSDJRPyYLOFRPR
XQDH[WHQVLyQGHWXDFWXDOFXHQWDEDQFDULD
,QWHJUDHOSDJRPyYLO
,QGHSHQGLHQWHPHQWHGHODRSFLyQTXHHOLMDV
QHFHVLWDUiVLQWHJUDUHOVLVWHPDFRQWXDFWXDO
IXQFLRQDPLHQWRGHVLVWHPDGHSDJR

(VWDVDFFLRQHVRSUHSDUDWLYRVSDUDUHFLELUSDJRV
PyYLOHVWHEHQHILFLDUiQGHPDQHUDFDVLLQPHGLDWD
/D$VRFLDFLyQ0H[LFDQDGH,QWHUQHWHQVXHVWXGLR
GH(&RPPHUFHFRPSUREyTXHHOGH
ORVLQWHUQDXWDVHYDOXDGRVKDQUHDOL]DGRFRPSUDV
PHGLDQWHVXGLVSRVLWLYRPyYLOVLHQGRODVWLHQGDV
PiVYLVLWDGDV,WXQHV\$QGURLG0DUNHW
$QDOLFHPRVODVLJXLHQWHJUiILFD

Interiores.indd 166

5/9/13 6:29 PM

&LHUUH
$HVWHSXQWRSRGHPRVFRQFOXLUTXHH[LVWHQ
GLIHUHQWHVIRUPDVGHKDFHUQHJRFLRVHQOtQHD
7RGDVHOODVWLHQHQYHQWDMDV\FDUDFWHUtVWLFDV
GLIHUHQWHV1RVJXVWDUtDFRQRFHUWXRSLQLyQ
&RPHQWDHQHOIRUR
4XpPRGHORFUHHVTXHWHVHUiPiV~WLOSDUD
KDFHUQHJRFLRVHQOtQHD"3RUTXp"
+DVWDSURQWR

Interiores.indd 167

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 6: Modelos de Negocio en Lnea
______________________________________________________________________________

Instrucciones: Ya has concluido la leccin 6 del curso. Por favor responde a las siguientes
preguntas y haz lo que se te pide para repasar los aprendizajes adquiridos.
1. En qu consiste el modelo de negocio C2C?

2. Mencionamos que existen sitios de internet que facilitan este tipo de negocio: EMarketplaces. Recuerdas los ejemplos que mencionamos?

3. Enlista tres caractersticas de este modelo de negocio y los portales en donde se da el


intercambio de productos o servicios.
a)
b)
c)
4. En qu consiste el modelo de negocio P2P?

5. Mencionamos que este modelo de negocio tiene una fuerte desventaja. Cul es?

6. Qu empresas han adoptado este tipo de modelo de negocio canalizando contenidos


producidos por la comunidad?

7. Cmo definiras el comercio mvil?

Interiores.indd 168

5/9/13 6:29 PM

8. Selecciona la opcin correcta. Existen _________ millones de mexicanos con acceso a


Internet desde su celular; 73.9 % ms que en 2011.
a) 8.5 M

b) 9.7 M

c) 12.3 M

d) 6.7 M

9. Qu es un APP de negocio? Menciona 2 ejemplos.

10. Ahora que has conocido los diferentes modelos de negocio. Cul o cules
implementars para tu negocio en lnea?

Interiores.indd 169

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 7
Creando presencia en lnea 1
Duracin:

30 min

Objetivo de aprendizaje: Identificar cmo desarrollar un sistema es necesario para el


xito de un sitio de e-commerce y distinguir los elementos
clave de un sitio web de comercio electrnico para delinear
cmo se incorporarn al sitio de la empresa.
Subtemas:

Desarrollo del sistema


Elementos clave de un sitio web de e-commerce

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo
- Primeras consideraciones

D 4:
- Imgenes de laptops, smartphones y tablets

1.Desarrollo del sistema

D8:
- Diagrama de un SDLC

1.1 Planeacin

D 9:
- Zoom en planeacin

Interiores.indd 170

D 3:
- Texto en el fondo

5/9/13 6:29 PM

1.2 Diseo del sistema

D 12:
- Zoom en Diseo de sistema

1.3 Construccin del sistema

D 14:
- Zoom en construccin del sistema

1.4 Prueba

D 15:
- Diagrama con las 3 cajas con las opciones

1.5 Implementacin

D 18:
- Zoom en prueba

- Resumen

D 20:
- Zoom en implementacin
- Porcentajes de tiempo dedicado a
mantenimiento
D 22:
- Diagrama SDLC completo

2. Elementos clave de un sitio web

D 24:
- Imgenes de catlogos

2.1 Catlogo en lnea

D 26:
- Demostracin en el navegador

2.2 Carrito de compras y one-click payment

D 27:
- Demostracin en el navegador

2.3 Procesamiento de pagos


2.4 Envos
2.5 Sistema de inventario
2.6 Atencin al consumidor

Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.

D 29:
- Van de entregas con cajas
D 39:
- Texto en el fondo: preguntas frecuentes,
servicio de chat en tiempo real, tecnologa
inteligente
D 41:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

- Ejercicios de Prctica

Interiores.indd 171

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ&UHDQGRSUHVHQFLDHQOtQHD 

,QIRUPDFLyQ*HQHUDO
+ROD%LHQYHQLGRDODOHFFLyQGHOFXUVR
$KRUD TXH FRQRFHV ORV GLVWLQWRV PRGHORV GH QHJRFLR
TXH RIUHFH HO FRPHUFLR HOHFWUyQLFR SRGHPRV SDVDU D
ODVLJXLHQWHVHFFLyQGHOFXUVR
&yPRFUHDUSUHVHQFLDHQOtQHD"
(QODVVLJXLHQWHVOHFFLRQHVHVWDUHPRVKDEODQGRGHORV
FRPSRQHQWHV FODYH GHO HFRPPHUFH SDUD TXH ORJUHV
DSOLFDUORVDWXSUiFWLFDHPSUHVDULDO
5HFXHUGD TXH SDUD FUHDU SUHVHQFLD HQ OtQHD H
LQFXUVLRQDU HQ HO FRPHUFLR HOHFWUyQLFR VH QHFHVLWDQ
FRQVLGHUDU DVSHFWRV GH QHJRFLRV WHFQROyJLFRV \
VRFLDOHV SRU OR TXH  DERUGDUHPRV HVWRV WHPDV D OR
ODUJRGHOFXUVR&RPHQFHPRV

Interiores.indd 172

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(OWHPDJHQHUDOGHHVWDVHVLyQVHUi&UHDQGRSUHVHQFLD
HQOtQHD<DSUHQGHUHPRVVREUH
(O'HVDUUROORGHOVLVWHPD
 (OHPHQWRV FODYH GH XQ VLWLR ZHE GH FRPHUFLR
HOHFWUyQLFR
(O2EMHWLYRGHDSUHQGL]DMHHVSHUDGRSDUDHVWDVHVLyQHV
,GHQWLILFDUFyPRGHVDUUROODUXQVLVWHPDHVQHFHVDULRSDUD
HOp[LWRGHXQVLWLRGHHFRPPHUFH\GLVWLQJXLUORV
HOHPHQWRVFODYHGHXQVLWLRZHEGHFRPHUFLRHOHFWUyQLFR
SDUDGHOLQHDUFyPRVHLQFRUSRUDUiQDOVLWLRGHODHPSUHVD

,QWURGXFFLyQ
(OGtDGHKR\HVLQQHJDEOHTXHHO,QWHUQHWHVSDUWH
GH OD YLGD GLDULD GH ODV SHUVRQDV &RPR YLPRV HQ
OHFFLRQHVDQWHULRUHVFDGDYH]VRQPiVORVDYDQFHV
WHFQROyJLFRV TXH FRQHFWDQ PXFKRV DVSHFWRV GH
QXHVWUDYLGDD,QWHUQHW
3RU HVWR FRQWDU FRQ XQD SUHVHQFLD HQ OtQHD SDUD
FRPHUFLDOL]DUSURGXFWRV\VHUYLFLRVVHKDFRQYHUWLGR
HQ XQD HVWUDWHJLD IXQGDPHQWDO SDUD WRGRV ORV
QHJRFLRV \ HPSUHQGHGRUHV GHO PXQGR 7X
HPSUHVD\DFXHQWDFRQXQDSUHVHQFLDHQOtQHD"

Interiores.indd 173

5/9/13 6:29 PM

,QWURGXFFLyQ
(O SULPHU SDVR VHUi GHVDUUROODU XQ FODUR
HQWHQGLPLHQWR GH ORV REMHWLYRV GH QHJRFLR SDUD
TXHDSDUWLUGHHOORVVHSXHGDHOHJLUODWHFQRORJtD
LQGLFDGDSDUDDOFDQ]DUORV
(O VHJXQGR SDVR LPSOLFDUi FRPSUHQGHU DOJXQRV
HOHPHQWRV EiVLFRV GH OD LQIUDHVWUXFWXUD GHO
FRPHUFLRHOHFWUyQLFRSDUDVHOHFFLRQDUDTXHOODTXH
PHMRUVHDGHF~DDWXVQHFHVLGDGHVHPSUHVDULDOHV

,QWURGXFFLyQ
$Vt FRQ XQ SODQ H LQIRUPDFLyQ VXILFLHQWH SRGUiV
WRPDUODVGHFLVLRQHVQHFHVDULDVSDUDLPSOHPHQWDU
XQD WLHQGD HQ OtQHD SDUD W~ HPSUHVD
3UHFLVDPHQWH DO WHUPLQDU HVWD OHFFLyQ WH
SHGLUHPRV TXH UHIOH[LRQHV VREUH ORV REMHWLYRV GH
WX HPSUHVD SDUD TXH D SDUWLU GH HOORV SXHGDV
GLVHxDUWXHVWUDWHJLDGHHFRPPHUFH
(O GHVDUUROODU XQ VLWLR GH FRPHUFLR HOHFWUyQLFR
LPSOLFDUiWRPDUGHFLVLRQHVHQYDULDViUHDV

Interiores.indd 174

5/9/13 6:29 PM

,QWURGXFFLyQ
(Q FXDQWR D UHFXUVRV KXPDQRV VHUi QHFHVDULR
FRQWDU FRQ XQ HTXLSR GH SHUVRQDV FDSDFLWDGDV
SDUD FUHDU \ DGPLQLVWUDU XQD SiJLQD GH FRPHUFLR
HOHFWUyQLFRH[LWRVD(VWHHTXLSRWRPDUiGHFLVLRQHV
VREUH WHFQRORJtD GLVHxR GHO VLWLR \ SROtWLFDV GH
LQIRUPDFLyQ SHUR HV LPSRUWDQWH TXH FRPSUHQGDV
HVWRV WHPDV SDUD PRQLWRUHDU \ JXLDU HO SURFHVR
DVHJXUDQGR HO p[LWR \ PDQWHQLHQGR DO HTXLSR
HQIRFDGRHQORVREMHWLYRVRUJDQL]DFLRQDOHV

,QWURGXFFLyQ
$GHPiV GH GHFLVLRQHV VLVWpPLFDV VREUH UHFXUVRV
KXPDQRV VH WRPDUiQ GHFLVLRQHV VREUH FDSDFLGDG
RUJDQL]DFLRQDO KDUGZDUH VRIWZDUH LQIUDHVWUXFWXUD
GHWHOHFRPXQLFDFLRQHV\GLVHxRGHVLWLR
7RGDV HVWDV GHFLVLRQHV VH GHEHQ WRPDU
FRQVLGHUDQGRODVGHPDQGDVGHORVFOLHQWHVTXLHQHV
TXHUUiQHQFRQWUDUORTXHEXVFDQFRQIDFLOLGDGYHUHO
SURGXFWRFRPSUDUOR\UHFLELUORUiSLGDPHQWH$SDUWLU
GHHVWRVXUJLUiHOSODQSDUDHOSUR\HFWRGHFRPHUFLR
HOHFWUyQLFR

Interiores.indd 175

5/9/13 6:29 PM

'HVDUUROORGHOVLVWHPD
$O GHVDUUROODU XQ VLWLR GH FRPHUFLR HOHFWUyQLFR VH
UHFRPLHQGD VHJXLU FLHUWRV SDVRV GH PDQHUD
VLVWpPLFD
6H SXHGH LPSOHPHQWDU HO PRGHOR GH FLFOR GH
YLGDGHGHVDUUROORGHVLVWHPDVR6'/&SRUVXV
VLJODV HQ LQJOpV TXH SHUPLWH FRPSUHQGHU ORV
REMHWLYRV GH QHJRFLR GH FXDOTXLHU VLVWHPD \
GLVHxDUHVWUDWHJLDV\VROXFLRQHVSDUDDOFDQ]DUORV

'HVDUUROORGHOVLVWHPD
3DUD SODQHDU XQ VLWLR GH FRPHUFLR HOHFWUyQLFR VH
VXJLHUHVHJXLUORVVLJXLHQWHVSDVRV
3ODQHDFLyQ
'LVHxRGHVLVWHPD
3UXHEDHLPSOHPHQWDFLyQ
$FRQWLQXDFLyQVHGHWDOODFDGDXQRGHHOORV

Interiores.indd 176

5/9/13 6:29 PM

3ODQHDFLyQ
3DUDODIDVHGHSODQHDFLyQSUHJ~QWDWH4Xp
TXHUHPRVTXHHVWDSiJLQDGHFRPHUFLR
HOHFWUyQLFRKDJDSRUQXHVWURQHJRFLR"/D
UHVSXHVWDDHVWDSUHJXQWDGHEHGLULJLUODVGHFLVLRQHV
TXHVHWRPHQ
&RPRSDUWHGHOSURFHVRVHGHEHQGHILQLUORVREMHWLYRV
GHQHJRFLRTXHHOVLWLRZHEGHEHGHFXPSOLUDSDUWLU
GHpVWRVVHGHWHUPLQDUiQODVIXQFLRQDOLGDGHVGHO
VLVWHPD\ODLQIRUPDFLyQTXHHOVLVWHPDGHEHSURGXFLU
SDUDDOFDQ]DUORVREMHWLYRV$VtODVGHFLVLRQHVGH
QHJRFLRGLULJLUiQODWHFQRORJtD\QRDOUHYpV

3ODQHDFLyQ
8Q HMHPSOR FRQFUHWR GH OD HWDSD GH SODQHDFLyQ
VHUtD WHQHU SRU HMHPSOR HO REMHWLYR GH
SHUVRQDOL]DU HO SURGXFWR TXH YHQGHPRV SDUD
FDGDFOLHQWH
(Q GRQGH OD IXQFLRQDOLGDG GHO VLVWHPD OOHYH XQ
KLVWRULDO GH ORV FOLHQWHV TXH YLVLWDQ WX VLWLR GH
PDQHUD TXH HO UHTXLVLWR SDUD HO VLVWHPD VHUtD
FRQWDU FRQ OD IXQFLRQDOLGDG GH UHJLVWUR SRU YLVLWD
HV GHFLU FDSDFLGDG GH GDWD PLQLQJ R PLQHUtD GH
GDWRVSDUDLGHQWLILFDUORVUHFRUULGRVTXHKDFHQORV
FRQVXPLGRUHV\SURJUDPDUUHVSXHVWDVDSURSLDGDV

Interiores.indd 177

5/9/13 6:29 PM

3ODQHDFLyQ
&RQ HVWH WLSR GH LQIRUPDFLyQ SRGUiV GLVHxDU HO
VLWLR ZHE HVSHUDGR SRU ORV FOLHQWHV \ DVt ORJUDU
SHUVRQDOL]DUORTXHDSDUHFHHQHOVLWLR
2 ELHQ  VL GHVHDV HQWHQGHU OD HIHFWLYLGDG GH WXV
HVWUDWHJLDV GH PDUNHWLQJ OD IXQFLRQDOLGDG GHO
VLVWHPDGHEHUiOOHYDUFRQWUROGHOVLWLRMXQWRFRQXQ
VLVWHPDGHUHSRUWHVPLHQWUDVTXHORVUHTXLVLWRVGH
LQIRUPDFLyQ SDUD FXPSOLU FRQ HVWH REMHWLYR GHEHQ
FRQWDELOL]DU HO Q~PHUR GH YLVLWDV ODV SiJLQDV TXH
VH YLVLWDQ ORV SURGXFWRV FRPSUDGRV H
LGHQWLILFDUORVSRUFDPSDxDSXEOLFLWDULD

'LVHxRGHVLVWHPD
8QD YH] TXH VH LGHQWLILFDQ ORV REMHWLYRV GHO
QHJRFLR ODV IXQFLRQDOLGDGHV GHO VLVWHPD \ OD
LQIRUPDFLyQ TXH VH UHTXLHUH REWHQHU SDUD VX
IXQFLRQDPLHQWRVHGHEHGHWHUPLQDUFyPRVHYDD
SUHVHQWDUHVWDIXQFLRQDOLGDG"
3DUDHVWRVHGHEHQGLVHxDUODVHVSHFLILFDFLRQHV
GHOVLVWHPDODVFXDOHVGDQXQDGHVFULSFLyQGHORV
SULQFLSDOHV FRPSRQHQWHV GH pVWH \ OD UHODFLyQ
HQWUH FDGD FRPSRQHQWH (VWH GLVHxR HVWDUi
FRPSXHVWRSRUXQGLVHxROyJLFR\XQRItVLFR

Interiores.indd 178

5/9/13 6:29 PM

'LVHxRGHVLVWHPD
(O GLVHxR OyJLFR GHVFULEH HO IOXMR GH LQIRUPDFLyQ
HQ HO VLWLR GH HFRPPHUFH ODV IXQFLRQHV GH
SURFHVDPLHQWR TXH GHEHQ VHU UHDOL]DGDV ODV
EDVHV GH GDWRV TXH VH XWLOL]DUiQ OD VHJXULGDG \
SURFHGLPLHQWRV GH UHVSDOGR LQVWLWXLGDV \ ORV
FRQWUROHV TXH VHUiQ XWLOL]DGRV HQ HO VLVWHPD
0LHQWUDV TXH HO GLVHxR ItVLFR WUDGXFH HO GLVHxR
OyJLFR HQ FRPSRQHQWHV ItVLFRV FRPR VHUtD HO
PRGHOR HVSHFtILFR GHO VHUYLGRU TXH VHUi XWLOL]DGR
HOVRIWZDUHTXHVHXWLOL]DUiHWF

&RQVWUXFFLyQGHOVLVWHPD
(O VLJXLHQWH SDVR HV OD FRQVWUXFFLyQ GHO VLVWHPD
SDUD HO FXDO VH GHEHUi GHFLGLU TXLpQ YD D FRQVWUXLU \
DORMDU HO VLWLR 6H SXHGH FRQWUDWDU D XQ SURYHHGRU
H[WHUQR SDUD KDFHU FXDOTXLHUD GH pVWDV GRV FRVDV R
DPEDV R ELHQ VH SXHGH GHFLGLU TXH VH KDUiQ GHQWUR
GHODHPSUHVD
6LVHGHFLGHFRQVWUXLUHOVLWLRFRQXQHTXLSRLQWHUQRVH
GHEHFRQVLGHUDUODH[SHULHQFLD\KDELOLGDGHVTXHWLHQH
HQHVWHWHPD6LHOFRQRFLPLHQWRHVOLPLWDGRVHSXHGHQ
HQFRQWUDU SODQWLOODV SUHHVWDEOHFLGDV HQ OtQHD
KHUUDPLHQWD TXH YHUHPRV FyPR XWLOL]DU HQ OD VLJXLHQWH
OHFFLyQ

Interiores.indd 179

5/9/13 6:29 PM

&RQVWUXFFLyQGHOVLVWHPD
$OJXQDV RSFLRQHV GH SDTXHWHUtD SDUD OD FRQVWUXFFLyQ
GH VLWLRV SDUD SHUVRQDV FRQ DOJR GH H[SHULHQFLD VRQ
0LFURVRIW&RPPHUFH6HUYHU\,%0:HE6SKHUH
6L VH WLHQH PiV FRQRFLPLHQWR VREUH GLVHxR ZHE VH
SXHGH XWLOL]DU VRIWZDUH FRPR $GREH 'UHDPZHDYHU
0LFURVRIW ([SUHVVLRQ y DOJ~Q VRIWZDUH GH XVR OLEUH
FRPR .RPSR]HU 6H GHEHUiQ HYDOXDU ODV YHQWDMDV \
GHVYHQWDMDV GH HVWDV RSFLRQHV DVt FRPR UHDOL]DU XQ
DQiOLVLV GH FRVWREHQHILFLR (Q OD VLJXLHQWH OHFFLyQ
KDEODUHPRV VREUH ORV SDVRV D VHJXLU SDUD FUHDU XQ
VLWLRZHEGHFRPHUFLRHOHFWUyQLFR

(Q FXDQWR DO DORMDPLHQWR GHO VLWLR OD PD\RUtD GH ODV
HPSUHVDV TXH UHDOL]DQ FRPHUFLR HOHFWUyQLFR GHFLGHQ
FRQWUDWDU D XQ SURYHHGRU H[WHUQR TXH DORMH VX VLWLR
ZHE \ JDUDQWLFH VX IXQFLRQDPLHQWR ODV  KRUDV GHO
GtD SRU XQD FXRWD PHQVXDO 2WUDV RSFLRQHV VRQ FR
ORFDOL]DU HO VHUYLGRU :HE R XWLOL]DU XQ SURYHHGRU GH
VHUYLFLRVHQODQXEHHOFXDORIUHFHHVSDFLRYLUWXDO/R
PiVLPSRUWDQWHHVVHOHFFLRQDUXQSURYHHGRUTXHVHD
VHJXUR \ ILGHGLJQR TXH UHDOPHQWH SXHGD GDU XQ
VHUYLFLR ODV  KRUDV GHO GtD GXUDQWH WRGR HO DxR \
TXH SHUPLWD D WX VLWLR FUHFHU FRQIRUPH FUH]FD WX
QHJRFLR
&RQRFHVDDOJ~QSURYHHGRU"

Interiores.indd 180

5/9/13 6:29 PM

&RQVWUXFFLyQGHOVLVWHPD
(Q UHDOLGDG VRODPHQWH ODV HPSUHVDV JUDQGHV
GHFLGHQ DORMDU VX VLWLR ZHE HQ VXV VHUYLGRUHV \D
TXH HVWR WUDH FRVWRV PiV HOHYDGRV DO WHQHU TXH
FRPSUDU \ PDQWHQHU KDUGZDUH VRIWZDUH
LQVWDODFLRQHV ItVLFDV UHQWD GH OtQHDV FRQWUDWDU
SHUVRQDO FDSDFLWDGR \ FRQVWUXLU FDSDFLGDGHV GH
VHJXULGDG\UHVSDOGR
(QODOHFFLyQDQDOL]DUHPRVFRQPD\RUGHWDOOHODV
GLIHUHQWHVRSFLRQHVGHDORMDPLHQWRRKRVWLQJ

3UXHED
8QD YH] TXH HO VLVWHPD VH KD FRQVWUXLGR \
SURJUDPDGR VH GHEH SUREDU HO SURFHVR 3ULPHUR VH
GHEH SUREDU FDGD XQLGDG GH PDQHUD DLVODGD
HYDOXDQGR HO IXQFLRQDPLHQWR GH FDGD XQD GH PDQHUD
LQGLYLGXDO 8QD YH] TXH FDGD XQLGDG IXQFLRQD
DGHFXDGDPHQWHVHSUXHEDHOVLVWHPDSDUDHYDOXDUHO
VLWLRFRPRXQWRGRGHODPLVPDIRUPDTXHORKDUtDXQ
XVXDULR FRP~Q \ YHULILFDQGR OD IXQFLyQ GH WRGRV ORV
FDPLQRVTXHXQXVXDULRSXHGHWRPDUDOHQWUDUDOVLWLR
/D VHJXQGD IDVH GH SUXHED FRQVLVWH HQ YHULILFDU TXH
ORV REMHWLYRV GH QHJRFLR SODQWHDGRV RULJLQDOPHQWH VH
DOFDQFHQ FRQ HO VLWLR FUHDGR (VWD HYDOXDFLyQ GHEH
UHDOL]DUOD SHUVRQDO FODYH HQ OD HPSUHVD FRPR OR VRQ
ORV JHUHQWHV GH PDUNHWLQJ SURGXFFLyQ YHQWDV \ OD
JHUHQFLDJHQHUDO

Interiores.indd 181

5/9/13 6:29 PM

,PSOHPHQWDFLyQ
(O ~OWLPR SDVR HV HO GH LPSOHPHQWDFLyQ TXH HQ
UHDOLGDG GDUi LQIRUPDFLyQ SDUD YROYHU D HPSH]DU HO
FLFOR 8Q VLWLR GH FRPHUFLR HOHFWUyQLFR HVWDUi HQ XQ
FRQVWDQWHSURFHVRGHFDPELRPHMRUD\FRUUHFFLyQ
(VWXGLRV UHYHODQ TXH HO  GH ODV DFWLYLGDGHV GH
PDQWHQLPLHQWR YDQ GLULJLGDV D VLWXDFLRQHV GH
HPHUJHQFLD FRPR FDPELRV HQ HO VHUYLGRU TXH
WXPEDQHOVLWLR 2WURVHGLULJHDFDPELRVHQORV
UHSRUWHV \ GRFXPHQWRV GH GDWD DVt FRPR ODV OLJDV
TXHOOHYDQDODEDVHGHGDWRV(ORWURGHOWLHPSR
GHGLFDGR D PDQWHQLPLHQWR VH GHGLFD D OD
DGPLQLVWUDFLyQ JHQHUDO GHO VLWLR FRPR DFWXDOL]DU
SUHFLRV\SURGXFWRV 

,PSOHPHQWDFLyQ
(V QHFHVDULR FRQVLGHUDU TXH XQ VLWLR ZHE GH
FRPHUFLRHOHFWUyQLFRGHEHVHUGLQiPLFR\VXp[LWRD
ODUJRSOD]RGHSHQGHUiHQJUDQSDUWHGHOSHUVRQDO
HQFDUJDGR GH DFWXDOL]DUOR GH DFXHUGR D ODV
FDPELDQWHVFRQGLFLRQHVGHOPHUFDGR
$&7,9,'$' 3LHQVD HQ XQ VLWLR GLQiPLFR \
FRQVWDQWHPHQWH DFWXDOL]DGR TXH KD\DV YLVLWDGR \ WH
KD\DQ TXHGDGR JDQDV GH YROYHU &yPR YLVXDOL]DV HO
WX\R"

Interiores.indd 182

5/9/13 6:29 PM

,PSOHPHQWDFLyQ
(O HTXLSR HQFDUJDGR GH PDQWHQHU HO VLWLR GHEHUi
HVWDU DWHQWR D ORV FRPHQWDULRV \ UHFRPHQGDFLRQHV
GH FOLHQWHV GHVDUUROODU XQ VLVWHPD GH PRQLWRUHR \
SUXHED SDUD DVHJXUDU VHPDQDOPHQWH HO EXHQ
IXQFLRQDPLHQWRGHOVLWLR\GHFRPSDUDUHOVLWLRFRQ
DTXHOORV GH ORV FRPSHWLGRUHV HQ WpUPLQRV GH
GLVHxR WLHPSR TXH WRPD FDUJDU OD SiJLQD \
H[SHULHQFLDGHOXVXDULR\DTXHXQVLWLRGLVIXQFLRQDO
UiSLGDPHQWH KDUi TXH ORV FOLHQWHV EXVTXHQ RWUDV
RSFLRQHV

'HVDUUROORGHOVLVWHPD
5HSDVHPRV$OGHVDUUROODUXQVLWLRZHEGHFRPHUFLR
HOHFWUyQLFR VH GHEHUi FRQVLGHUDU XQ HQIRTXH
VLVWpPLFRHQHOTXHORVSDVRVDVHJXLUVHDQ
 3ODQHDFLyQ 4Xp TXHUHPRV TXH HVWH VLWLR KDJD SRU
QXHVWURQHJRFLR"
 'LVHxR GH VLVWHPD 4Xp QHFHVLWDPRV TXH HO VLWLR
KDJDSDUDORJUDUORVREMHWLYRVTXHKHPRVSODQWHDGR"
 &RQVWUXFFLyQ GHO VLVWHPD 4XLpQ YD D FRQVWUXLU HO
VLWLR"'yQGHVHDORMDUi"
 3UXHED )XQFLRQDQ WRGDV ODV OLJDV" &yPR HV OD
H[SHULHQFLDGHOXVXDULR"
 ,PSOHPHQWDFLyQ &yPR SXHGR DFWXDOL]DU \ PHMRUDU
HOVLWLR"

Interiores.indd 183

5/9/13 6:29 PM

(OHPHQWRVFODYHGHXQVLWLRZHE
&RPR SDUWH GHO GLVHxR GHO VLVWHPD VH GHEHUiQ
FRQVLGHUDUFLHUWRV HOHPHQWRVFODYHSDUDFXDOTXLHU
VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR 0XFKD GH OD
SDTXHWHUtD GH VRIWZDUH GLVSRQLEOH \D UH~QH OD
PD\RUSDUWHGHHVWDVIXQFLRQHVLQGLVSHQVDEOHV6LQ
HPEDUJR HV QHFHVDULR FRQRFHUODV SDUD SRGHU
HYDOXDU ODV GLIHUHQWHV RSFLRQHV GH SDTXHWHUtD \
VHOHFFLRQDU OD DGHFXDGD SDUD WX QHJRFLR $Vt
SRGUiVDVHJXUDUTXHHOFRQVXPLGRUORJUHKDFHUXQD
FRPSUD\TXLHUDYROYHUDXWLOL]DUWXVLWLR

&DWiORJRHQOtQHD
8Q SULPHU HOHPHQWR HV HO FDWiORJR GH SURGXFWRV HQ
OtQHDHOFXDORIUHFHXQDOLVWDGHWRGRVORVSURGXFWRVR
VHUYLFLRV TXH RIUHFH OD HPSUHVD (O FDWiORJR SXHGH
DSDUHFHU GH PDQHUD VHQFLOOD PRVWUDQGR XQ WH[WR
GHVFULSWLYR\IRWRVGHOSURGXFWRRHVWDUPiVHODERUDGR
\FRQWDUFRQYLGHRVVRQLGRVRDQLPDFLRQHV
&RPRPHQFLRQDPRVHQOHFFLRQHVDQWHULRUHVHO,QWHUQHW
WLHQHODYHQWDMDGHSRGHURIUHFHUXQDJUDQFDQWLGDGGH
LQIRUPDFLyQGHPDQHUDVHQFLOOD\HFRQyPLFD

Interiores.indd 184

5/9/13 6:29 PM

&DWiORJRHQOtQHD
3DUD EHQHILFLR GH WXV FOLHQWHV HV UHFRPHQGDEOH
RIUHFHU WRGD OD LQIRUPDFLyQ QHFHVDULD VREUH FDGD
SURGXFWR 1R WH OLPLWHV LQFOX\H WRGD OD LQIRUPDFLyQ
UHTXHULGD\DJUHJDYDULDVIRWRVSDUDFDGDSURGXFWR
7DPELpQHVQHFHVDULRPRVWUDUWRGRVORVSURGXFWRV\
HQ FDVR GH HVWDU DJRWDGRV FXiQGR HVWDUiQ
GLVSRQLEOHVQXHYDPHQWH"
0XFKDVHPSUHVDVKDQRSWDGRSRULQFOXLUXQEXVFDGRU
TXH SHUPLWH DO FOLHQWH HQFRQWUDU UiSLGDPHQWH DTXHO
SURGXFWR TXH GHVHD DO LQWURGXFLU DOJXQDV SDODEUDV
FODYH 7H VXJHULPRV FRQVLGHUDU HVWD HVWUDWHJLD DO
GHVDUUROODUWXVLWLRSHQVDQGRHQDTXHOODVSDODEUDVTXH
XWLOL]DUiQWXVFOLHQWHVDOEXVFDUHOSURGXFWR

&DUULWRGHFRPSUD\2QHFOLFNSD\PHQW
8QD YH] TXH HO FRQVXPLGRU UHYLVD HO FDWiORJR HQ
OtQHD GHEH VHU FDSD] GH VHOHFFLRQDU DTXHOORV
SURGXFWRVTXHOHLQWHUHVDQSDUDVXFRPSUD
8Q FDUULWR GH FRPSUDV HQ OtQHD SHUPLWH DO
FRPSUDGRU VHOHFFLRQDU ORV DUWtFXORV HGLWDU VX OLVWD \
UHDOL]DU OD FRPSUD (O SURJUDPD FDOFXODUi HO WRWDO GH
OD WUDQVDFFLyQ WRPDQGR HQ FXHQWD FRVWRV GH HQYtR
LPSXHVWRVDSOLFDEOHV\SURPRFLRQHV8QDYDULDFLyQDO
FDUULWRGHFRPSUDVHVODRSFLyQRQHFOLFNHQODTXH
HO FRQVXPLGRU DFFHGH D OD FRPSUD GHO SURGXFWR R
VHUYLFLRFRQGDUXQVRORFOLFDXQERWyQ

Interiores.indd 185

5/9/13 6:29 PM

&DUULWRGHFRPSUD\2QHFOLFNSD\PHQW
(O FOLHQWH GHEHUi HVWDU UHJLVWUDGR HQ HO VLWLR \ WHQHU
XQD IRUPD GH SDJR DSUREDGD GH PDQHUD TXH HQ
FRPSUDV IXWXUDV VH SHGLUi XQD FODYH SDUD DXWHQWLFDU
DOXVXDULR\SURFHGHUDUHDOL]DUHOSDJR
/D YHQWDMD TXH WUDH HVWH WLSR GH VHUYLFLRV D ODV
HPSUHVDVHVTXHXQDYH]TXHHOFOLHQWHUHJLVWUyVXV
GDWRV\IRUPDGHSDJRHQHOVLWLRODSUREDELOLGDGGH
TXH YXHOYD D KDFHU XQD FRPSUD HQ HVH VLWLR HV PX\
DOWD

&DUULWRGHFRPSUD\2QHFOLFNSD\PHQW
(O FDUULWR GH FRPSUDV \ HO VHUYLFLR GH RQHFOLFN
QRUPDOPHQWHWUDEDMDQHQFRQMXQWRFRQHOVRIWZDUHGH
SURFHVDPLHQWR GH SDJRV &XDQGR HO SDJR VH KDFH
FRQ XQD WDUMHWD GH FUpGLWR HO VRIWZDUH YHULILFD ORV
GDWRV\HOFUpGLWRHQODWDUMHWD\JHQHUDHOFREUR(Q
XQD OHFFLyQ SRVWHULRU KDEODUHPRV VREUH ODV
GLIHUHQWHVIRUPDVGHSDJRTXHVHSXHGHQRIUHFHUHQ
XQVLWLRZHE(QJHQHUDOODUHFRPHQGDFLyQHVFRQWDU
SDJRDWUDYpVGHWDUMHWDGHFUpGLWR\DOJXQRVPHGLRV
DOWHUQRV SDUD DWUDHU D XQD PD\RU FDQWLGDG GH
FOLHQWHV

Interiores.indd 186

5/9/13 6:29 PM

(QYtRV
3DUD FRPSOHWDU OD YHQWD HQ OtQHD VH GHEH KDFHU OD
HQWUHJD GHO SURGXFWR ([LVWHQ GLVWLQWRV PpWRGRV GH
HQYtR SDUD ORV SURGXFWRV YHQGLGRV HQ OtQHD 6L HO
YROXPHQORDPHULWDVHSXHGHFRQWDUFRQXQDIORWLOODTXH
KDJDODUHSDUWLFLyQGHRWUDPDQHUDVHGHEHHVWDEOHFHU
XQ FRQWUDWR FRQ DOJXQD FRPSDxtD GH PHQVDMHUtD \
SDTXHWHUtD (VWDIHWD '+/ 836 HQWUH RWURV  (V
UHFRPHQGDEOH FRQWUDWDU XQ VHUYLFLR GH SDTXHWHUtD TXH
SHUPLWD UDVWUHDU HO SDTXHWH HQ OtQHD \D TXH
SURSRUFLRQDU HVWRV GDWRV EULQGD FRQILDQ]D DO
FRQVXPLGRU

(QYtRV
$O FOLHQWH VH OH SRGUiQ RIUHFHU YDULDV RSFLRQHV GH
HQYtR FRPR HQWUHJD DO GtD VLJXLHQWH HQWUHJD HQ
GRVRWUHVGtDVHQWUHRWUDV
(QFXDQWRDOSUHFLRGHOHQYtRVHGHEHUiGHFLGLUVL
LUiFRQVLGHUDGRHQHOSUHFLRGHOSURGXFWRRVHUiXQ
FRVWR DGLFLRQDO DO TXH LQFXUULUi HO FOLHQWH DO
PRPHQWRGHSURFHVDUVXFRPSUD
(O RIUHFHU OD SURPRFLyQ GH HQYtR JUDWLV VH KD
YXHOWRSRSXODU\HVXQDPDQHUDGHDWUDHUFOLHQWHV
TXHQRTXLHUHQLQFXUULUHQXQJDVWRDGLFLRQDO

Interiores.indd 187

5/9/13 6:29 PM

(QYtRV
6LVXQHJRFLRFXHQWDFRQXQHVSDFLRItVLFR FRPR
XQD WLHQGD GHSDUWDPHQWDO  HO FRQVXPLGRU SXHGH
KDFHU OD FRPSUD SRU ,QWHUQHW \ GHFLGLU HQ TXp
WLHQGD UHFRJHU HO SURGXFWR 3RU ~OWLPR VL ORV
ELHQHV VRQ LQWDQJLEOHV VH GHEH RIUHFHU OD RSFLyQ
GHGHVFDUJDHQODTXHHOFRQVXPLGRUWLHQHDFFHVR
LQPHGLDWR DO SURGXFWR \D TXH QR H[LVWH OD
QHFHVLGDG GH HQYtR $OJXQRV HMHPSORV GH ELHQHV
QR ItVLFRV VRQ P~VLFD YLGHRV VHUYLFLRV GH
FRQWUDWDFLyQ\JHVWLyQGHUHFXUVRVKXPDQRV

(QYtRV
(Q FXDQWR D ODV GHYROXFLRQHV H[SHUWRV
UHFRPLHQGDQ RIUHFHU XQ SHULRGR HQ HO TXH VL HO
FRQVXPLGRU QR HVWi VDWLVIHFKR FRQ VX FRPSUD
SXHGDKDFHUXQDGHYROXFLyQ\VHOHUHHPEROVHVX
SDJR\DTXHHVWRUHGXFHODSHUFHSFLyQGHULHVJR
DO KDFHU XQD FRPSUD HQ OtQHD (O Q~PHUR GH GtDV
TXH VH GDQ SDUD KDFHU OD GHYROXFLyQ GHSHQGHUi
GHOQHJRFLR(QJHQHUDOVHRIUHFHQGHKDVWD
GtDV \ HO FDUJR GHO HQYtR SRU GHYROXFLyQ SXHGH
FRUUHUSRUSDUWHGHODHPSUHVDRHOFRQVXPLGRU

Interiores.indd 188

5/9/13 6:29 PM

(QYtRV
(V LPSRUWDQWH TXH OD LQIRUPDFLyQ VH RIUH]FD GH
PDQHUD FODUD HQ HO VLWLR ZHE (Q JHQHUDO VH
FDOFXODXQDWDVDGHGHYROXFLyQHQWUH\SDUD
SURGXFWRVItVLFRVYHQGLGRVHQOtQHD(OGHWHUPLQDU
HO SRUFHQWDMH GH SURGXFWR TXH HVWi VLHQGR
GHYXHOWRSHUPLWLUiUHILQDUHOSURFHVRGHGHYROXFLyQ
\ UHGXFLUOR 3DUD OOHYDU XQ FRQWURO DGHFXDGR GHO
SURGXFWR HO VLVWHPD GH HQYtRV \ GHYROXFLRQHV
GHEHHVWDUYLQFXODGRDOVLVWHPDGHLQYHQWDULR\D
VXYH]ODRIHUWDHQHOVLWLR

6LVWHPDGHLQYHQWDULR
3DUD OOHYDU HO FRQWURO GHO VWRFN R LQYHQWDULR GH
SURGXFWRV TXH OD HPSUHVD WLHQH DOPDFHQDGRV VH
OOHYD XQ FRQWURO GH LQYHQWDULRV GH PDQHUD TXH VH
PDQWHQJD HO ULWPR GH SHGLGRV SDUD DWHQGHU D ODV
GHPDQGDV GH ORV FOLHQWHV /RV LQYHQWDULRV SDUD
SURGXFWRVTXHVHDQXQFLDQHQ,QWHUQHWQRGHEHQGH
HVWDU HQ OtQHD QHFHVDULDPHQWH VH SXHGH OOHYDU HO
FRQWURO GH PDQHUD WUDGLFLRQDO VLQ HPEDUJR FXDQGR
OD PDJQLWXG GH OD HPSUHVD FUHFH \ ORV SHGLGRV
DXPHQWDQ HO LQYHQWDULR \ VX JHVWLyQ VH GLILFXOWDQ H
LQFUHPHQWD HO ULHVJR GH TXH DOJ~Q SURGXFWR TXH QR
HVWiGLVSRQLEOHVLJDDODYHQWDHQODWLHQGDYLUWXDO

Interiores.indd 189

5/9/13 6:29 PM

6LVWHPDGHLQYHQWDULR
3RU HVWR VH YXHOYH LPSUHVFLQGLEOH FRQWDU FRQ XQ
VLVWHPD GH LQYHQWDULRV \D TXH HVWRV VLVWHPDV
SHUPLWHQTXHORVLQYHQWDULRVHVWpQFRPSOHWDPHQWH
LQWHJUDGRVFRQORVSRUWDOHVDWUDYpVGHORVFXDOHV
VH OOHYDQ D FDER ODV YHQWDV SDUD TXH GH HVWD
PDQHUD XQ SURGXFWR TXH QR HVWp HQ H[LVWHQFLD
TXHGH IXHUD GH FDWiORJR DXWRPiWLFDPHQWH \
UHJUHVHDOSRUWDOFXDQGRVHGLVSRQJDQXHYDPHQWH
GHOPLVPR

6LVWHPDGHLQYHQWDULR
'H LJXDO PDQHUD HVWRV VLVWHPDV SHUPLWHQ TXH
WRGD OD  LQIRUPDFLyQ GH YHQWDV VH LQWHJUH
DXWRPiWLFDPHQWH FRQ ODV ILQDQ]DV DJLOL]DQGR ORV
VLVWHPDV FRQWDEOHV (Q UHVXPHQ XQ VLVWHPD GH
LQYHQWDULRV WUDH GLIHUHQWHV EHQHILFLRV SHUR
SULQFLSDOPHQWH HOLPLQD OD QHFHVLGDG GH OOHYDU XQ
LQYHQWDULR ItVLFR GH IRUPD DQXDO R WULPHVWUDO
DGHPiV GH HYLWDU XQD PDOD JHVWLyQ TXH SXHGD
LQFUHPHQWDU ORV FRVWRV GH DOPDFHQDPLHQWR R
LQFOXVRQRVDWLVIDFHUHOSHGLGRGHOFOLHQWH

Interiores.indd 190

5/9/13 6:29 PM

$WHQFLyQDOFRQVXPLGRU
2WUR DVSHFWR LPSRUWDQWH SDUD OD VDWLVIDFFLyQ GHO
FOLHQWH HV HO VHUYLFLR TXH VH OH EULQGD DO DWHQGHU
VXV GXGDV H LQTXLHWXGHV SRU HOOR HO HVSDFLR GH
DWHQFLyQ DO FRQVXPLGRU HQ OtQHD HV RWUR
FRPSRQHQWHLPSRUWDQWHGHOFRPHUFLRHOHFWUyQLFR
*HQHUDOPHQWH ODV WLHQGDV YLUWXDOHV PDQHMDQ XQ
IRUPDWR GH FKDW R IRUR HQ GRQGH DOJ~Q HMHFXWLYR
DWLHQGHDODVVROLFLWXGHVGHORVFLEHUFRQVXPLGRUHV
HQWLHPSRUHDO

$WHQFLyQDOFRQVXPLGRU
'H PDQHUD DGLFLRQDO VH SXHGH LQFOXLU HQ OD WLHQGD
YLUWXDO XQ HVSDFLR SDUD HQYLDU FRPHQWDULRV R ELHQ
LQFOXLUXQDGLUHFFLyQGHFRUUHRHOHFWUyQLFRDODFXDOVH
FDQDOL]DQORVFRPHQWDULRVRGXGDVGHORVFOLHQWHV
5HFRUGHPRV OD FDUDFWHUtVWLFD GH LQWHUDFWLYLGDG ODV
WHFQRORJtDV GHO HFRPPHUFH SHUPLWHQ TXH H[LVWD
LQWHUDFFLyQ FRQWLQXD HQWUH HO SURYHHGRU \ HO
FRQVXPLGRU DVHPHMiQGRVH D OD H[SHULHQFLD GH OD
LQWHUDFFLyQ ItVLFD GLUHFWD SHUR ORJUDQGR TXH VHD GH
IRUPDPDVLYD\JOREDO

Interiores.indd 191

5/9/13 6:29 PM

$WHQFLyQDOFRQVXPLGRU
(O VHUYLFLR DO FOLHQWH HQ ,QWHUQHW HV LQFOXVR PiV
LPSRUWDQWHTXHHQHOPXQGRUHDO\DTXHHQ,QWHUQHW
QR H[LVWH HO FRQWDFWR GLUHFWR FRQ HO FOLHQWH \ pVWH
SDUD FRQILDU HQ HO SURGXFWR R VHUYLFLR WDQ VyOR
FXHQWDFRQODLQIRUPDFLyQTXHSURSRUFLRQDODWLHQGD
YLUWXDO 3RU HOOR FRQWHVWDU UiSLGDPHQWH ORV FRUUHRV
HOHFWUyQLFRV GH FOLHQWHV SRWHQFLDOHV OHV GHPXHVWUD
ODSUHVHQFLDGHOYHQGHGRUGHWUiVGHOVLWLRZHE
&RQVLGHUD ORV VLJXLHQWHV HOHPHQWRV DO GLVHxDU WX
HVWUDWHJLDGHDWHQFLyQDOFRQVXPLGRU

3UHJXQWDV IUHFXHQWHV XQD SiJLQD FRQ OD OLVWD GH


SUHJXQWDV FRPXQHV \ VXV UHVSXHVWDV RIUHFH XQD
PDQHUD VHQFLOOD \ HFRQyPLFD GH DQWLFLSDU \ DWHQGHU
GXGDVGHWXVFOLHQWHV
6HUYLFLR GH FKDW HQ WLHPSR UHDO \D PHQFLRQDPRV
HVWDHVWUDWHJLDTXHSHUPLWHDXQUHSUHVHQWDQWHGHOD
HPSUHVD LQWHUDFWXDU SRU FKDW FRQ XQR R PiV
FRQVXPLGRUHVHQWLHPSRUHDO
7HFQRORJtD LQWHOLJHQWH HVWDEOHFHU VLVWHPDV GH
UHVSXHVWD LQPHGLDWD SDUD GDU DYLVR TXH VH HVWi
WUDEDMDQGR HQ OD VROLFLWXG \ VH GDUi UHVSXHVWD D OD
EUHYHGDGFRQILUPDUHQYtRV\UHSRUWDUHOHVWDWXVGHXQ
SHGLGR

Interiores.indd 192

5/9/13 6:29 PM

&LHUUH
(O FRQVLGHUDU HVWRV HOHPHQWRV DO GLVHxDU WX VLWLR ZHE
GH FRPHUFLR HOHFWUyQLFR SHUPLWLUi D WXV FOLHQWHV WHQHU
XQD H[SHULHQFLD IDYRUDEOH DO PRPHQWR GH LQWHUDFWXDU
FRQ pO 5HIOH[LRQD VREUH OD H[SHULHQFLD FRPSOHWD GHO
XVXDULRGHVGHHOPRPHQWRHQTXHHPSLH]DDEXVFDU
WXSURGXFWRRVHUYLFLRHQWUDDWXSiJLQDHQFXHQWUDOR
TXH EXVFD UHDOL]D OD FRPSUD UHFLEH HO SURGXFWR \
HPSLH]D D XWLOL]DUOR /D DWHQFLyQ D ORV GHWDOOHV VHUi
LPSRUWDQWH$OPRPHQWRGHHPSH]DUDSODQHDUWXVLWLR
ZHE FRQVLGHUD XQ HQIRTXH VLVWpPLFR FRQVLGHUDQGR
TXH HO ORJUDU XQ VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR
H[LWRVRGHSHQGHGHXQDUHWURDOLPHQWDFLyQFRQVWDQWH

5HFXHUGDWRPDUHQFXHQWDORVGLIHUHQWHVHOHPHQWRV
FODYH GH XQ VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR TXH
KHPRV H[SOLFDGR D OR ODUJR GH OD OHFFLyQ \ OR
LPSRUWDQWHTXHHVQRSHUGHUGHYLVWDWXVREMHWLYRVGH
QHJRFLR DO HVWDU WRPDQGR GHFLVLRQHV GH GLVHxR H
LQIUDHVWUXFWXUDWHFQROyJLFD<DKDVGHVDUUROODGRORV
REMHWLYRV GH WX QHJRFLR HQ UHODFLyQ DO FRPHUFLR
HOHFWUyQLFR" 4Xp TXLHUHV ORJUDU DO LQFRUSRUDU HVWH
QXHYR PRGHOR GH QHJRFLR"7yPDWH XQ WLHPSR \
GHILQHWXVREMHWLYRV
&RPR PHQFLRQDPRV DQWHULRUPHQWH HQ OD VLJXLHQWH
OHFFLyQKDEODUHPRVVREUHORTXHHVWHQHUSUHVHQFLD
HQ OtQHD \ GLVFXWLUHPRV DOJXQDV KHUUDPLHQWDV TXH
SRGUiVXWLOL]DUSDUDFUHDUWXVLWLRZHE+DVWDSURQWR

Interiores.indd 193

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 7: Creando Presencia en Lnea
______________________________________________________________________________
Instrucciones: Ya has concluido la leccin 7 del curso. Por favor responde a las siguientes
preguntas y haz lo que se te pide para repasar los aprendizajes adquiridos.
1. Qu beneficios tiene un negocio al contar con presencia en lnea?

2. Existen dos opciones para crear tu sitio web:


a)
b)
3. En esta leccin se recomend seguir un orden al crear un sitio web y propusimos el
Enfoque Sistmico. Este enfoque propone diferentes fases de desarrollo, relaciona
cada proceso con la fase a la que corresponde:
a) Planeacin
b) Diseo de Sistema
c) Construccin del Sistema
d) Prueba

e) Implementacin

a) Funcionan todas las ligas? Cmo es la experiencia del


b) Qu queremos que esta pgina de comercio
electrnico haga por nuestro negocio?
c) Cmo puedo actualizar y mejorar el sitio?
d) Qu necesitamos que el sitio haga para lograr los objetivos
que hemos planteado?
usuario?
e) Quin va a construir el sitio? Dnde se alojar?

4. Se mencionaron diferentes elementos clave para el funcionamiento de un sitio web.


Define cada uno de los siguientes elementos en tus propias palabras:

Carrito de Compra
One Click Payment
Catlogo en lnea
Procesamiento de pagos
Envos
Sistema de inventario
Atencin al consumidor

5. Por qu se mencion que el servicio a cliente en Internet es an ms importante que el


servicio en comercios presenciales?

Interiores.indd 194

5/9/13 6:29 PM

6. Enlista algunas acciones que puedes llevar a cabo para ofrecer una mejor atencin a tus
consumidores en lnea y resolver sus posibles dudas.

7. Crear tu propio sitio web o contratar a alguien que lo haga por ti tienen ventajas y
desventajas. Completa el siguiente cuadro:
VENTAJAS

DESVENTAJAS

Contratar a alguien

1.
2.

1.
2.

Crear el sitio internamente

1.
2.

1.
2.

8. Por qu es importante elegir una buena compaa de servicios de envos en caso de


que tus productos deban ser entregados?

9. Piensa en una tienda en lnea que haya captado tu atencin y que consideres que ha
sido creada de modo excelente y se mantiene en constante renovacin. Ahora piensa en
otra que sea todo lo contrario.

10. Ejercicio: Ingresa a tu sitio web si es que ya lo tienes y has una lista de posibles mejoras
y reas de oportunidad para que sea ms funcional y atractiva. (Si an no la tienes
puedes hacer el ejercicio en el sitio de algn conocido).

Interiores.indd 195

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 8
Creando presencia en lnea 2
Duracin:

30 min

Objetivo de aprendizaje: Describir qu es tener presencia en lnea, determinar los pasos


a seguir para crear un sitio web de comercio electrnico e
identificar otros medios para comercializar productos en lnea.
Subtemas:

Qu es tener presencia en lnea?


Crear tu sitio web de comercio electrnico

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a internet

Agenda:
Contenido:
Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

Notas de Produccin:
D 1:
- Texto en el fondo
D 3:
- Texto en el fondo

Desarrollo
1.Qu es tener una presencia en lnea?

Interiores.indd 196

5/9/13 6:29 PM

2. Crear tu propio sitio web de comercio


electrnico

D 7:
- Texto en el fondo: 1. Un dominio, 2. Un
sitio web, 3. Hospedaje, 4. Cuentas de
correo personalizadas

2.1 El dominio
D 9:
- Ejemplo de una pgina de registro
2.2 El sitio web

D 17:
- Texto en el fondo: funcionalidad,
informativo, fcil de usar, navegacin
redundante, facilidad de compra, mltiples
navegadores, grficos simples
Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 197

D 20:
- Pasar las preguntas de reflexin en el
fondo de la pantalla para que comenten en
el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ&UHDQGRSUHVHQFLDHQ
OtQHD 

,QIRUPDFLyQ*HQHUDO
%LHQYHQLGRGHYXHOWD<DKDVSHQVDGRVREUHORV
REMHWLYRV SDUD WX QHJRFLR HQ UHODFLyQ DO FRPHUFLR
HOHFWUyQLFR" %LHQ SXpV HQ HVWD OHFFLyQ
KDEODUHPRV VREUH OR TXH HV WHQHU SUHVHQFLD HQ
OtQHD \ YHUHPRV DOJXQDV  KHUUDPLHQWDV TXH WH
SHUPLWLUiQ FUHDU XQ VLWLR ZHE GH FRPHUFLR
HOHFWUyQLFR
(O WHPD JHQHUDO SDUD HVWD VHVLyQ HV &UHDQGR
SUHVHQFLDHQOtQHD
<GHVDUUROODUHPRVORV6XEWHPDV
4XpHVWHQHUXQDSUHVHQFLDHQOtQHD"
&UHDUWXVLWLRZHEGHFRPHUFLRHOHFWUyQLFR

Interiores.indd 198

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O2EMHWLYRGHDSUHQGL]DMHVHUi'HVFULELUTXpHV
WHQHUSUHVHQFLDHQOtQHDGHWHUPLQDUORVSDVRVD
VHJXLUSDUDFUHDUXQVLWLRZHEGHFRPHUFLR
HOHFWUyQLFRHLGHQWLILFDURWURVPHGLRVSDUD
FRPHUFLDOL]DUSURGXFWRVHQOtQHD
&RPRKHPRVPHQFLRQDGRDQWHULRUPHQWHHQOD
DFWXDOLGDGHVPX\EHQHILFLRVRSDUDFXDOTXLHU
QHJRFLRFRQWDUFRQXQDSUHVHQFLDHQOtQHD\DTXHHV
XQDKHUUDPLHQWDGHPDUNHWLQJ\FRPXQLFDFLyQTXH
SHUPLWHRIUHFHUDORVFRQVXPLGRUHVLQIRUPDFLyQ
VREUHORVSURGXFWRV\VHUYLFLRVTXHRIUHFHOD
HPSUHVD

4XpHVWHQHUXQDSUHVHQFLDHQOtQHD"
8QD GH ODV PDQHUDV PiV VHQFLOODV \ UiSLGDV TXH
WLHQHQ ORV FOLHQWHV GH HQFRQWUDU XQD HPSUHVD R
LQIRUPDFLyQ GH FXDOTXLHU SURGXFWR R VHUYLFLR
GHWHUPLQDGRHVXVDQGR,QWHUQHW
/RV GLUHFWRULRV HQ ORV SHULyGLFRV \ ODV UHYLVWDV
LPSUHVDVHVWiQFDGDYH]PiVREVROHWRV
6LWXFRPSHWHQFLDHVWiRQOLQH\WXQRHVWDUiVHQXQD
VHULDGHVYHQWDMD
7H LQYLWR D UHIOH[LRQDU &yPR SXHGHV OODPDU OD
DWHQFLyQ GH DTXHOODV SHUVRQDV TXH EXVFDQ ORV
SURGXFWRV\VHUYLFLRVTXHWXHPSUHVDRIUHFH"

Interiores.indd 199

5/9/13 6:29 PM

4XpHVWHQHUXQDSUHVHQFLDHQOtQHD"
3DUDWHQHUSUHVHQFLDHQOtQHDHVQHFHVDULRFUHDUXQ
VLWLR ZHE \ FRQWDU FRQ GLUHFFLRQHV GH FRUUHR
HOHFWUyQLFR &RQ VRODPHQWH XQD FRPSXWDGRUD FRQ
FRQH[LyQD,QWHUQHWXQQRPEUHSDUDWXVLWLRZHE\XQ
HVSDFLRGRQGHFRORFDUORSRGUiVHPSH]DUDFRQVWUXLU
WXSUHVHQFLDHQOtQHD
&RPR FRPHQWDPRV HQ OD OHFFLyQ DQWHULRU
GHSHQGLHQGRGHODH[SHULHQFLDGHOHTXLSRHQFDUJDGR
GHGLVHxDUHOVLWLR\RWURVUHFXUVRVGLVSRQLEOHVFRPR
WLHPSR \ SUHVXSXHVWR SRGUiV GHFLGLU VL FUHDV WX
SiJLQD GHVGH FHUR R OD DORMDV HQ XQD SODWDIRUPD GH
WHUFHURV

&UHDUWXSURSLRVLWLRZHE
6LGHFLGHVFUHDUWXSURSLRVLWLRZHESDUDUHDOL]DU
FRPHUFLRHOHFWUyQLFRQHFHVLWDV
8QGRPLQLR
8QVLWLRZHE
+RVSHGDMH
&XHQWDVGHFRUUHR
(QHVWDOHFFLyQYHUHPRVORVSULPHURVGRVSDVRV
SDUDFRQWLQXDUFRQHO\HQODOHFFLyQ
6DEHVORTXHHVXQGRPLQLR"(VHOQRPEUHFRQHO
TXHVHUiVLGHQWLILFDGRHQ,QWHUQHW\SHUPLWLUiDORV
XVXDULRVORFDOL]DUWXSiJLQDIiFLOPHQWH3RUHMHPSOR
HQODGLUHFFLyQZZZHFRQRPLDJREP[HFRQRPLD
JREP[HVHOGRPLQLR

Interiores.indd 200

5/9/13 6:29 PM

(O'RPLQLR
/RV GRPLQLRV SXHGHQ VHU UHJLVWUDGRV D WUDYpV GH
XQD HQWLGDG UHJLVWUDQWH DFUHGLWDGD TXH HV XQD
HPSUHVD HQFDUJDGD GH JHVWLRQDU HO SURFHVR GH
UHJLVWURGHGRPLQLRSDUDVXVFOLHQWHV
(Q 0p[LFR DOJXQDV GH ODV HPSUHVDV TXH RIUHFHQ
HVWHVHUYLFLRVRQSRUHMHPSOR
DORMDWHFRP
VXHPSUHVDFRP
QHXER[FRP
LQWHUQHWZRUNVFRPP[
DNN\P[
HQWUHPXFKRVRWURVPiV

(O'RPLQLR
(Q JHQHUDO HO SURFHVR GH UHJLVWUDU WX GRPLQLR HV
EDVWDQWH VHQFLOOR 'HEHUiV VHOHFFLRQDU OD HQWLGDG
UHJLVWUDQWHDFUHGLWDGDDWUDYpVGHODFXDOUHDOL]DUiV
WXUHJLVWUR\UHYLVDUHQVXVLWLRZHEVLHOGRPLQLRTXH
GHVHDVXWLOL]DUD~QHVWiGLVSRQLEOH
(O QRPEUH GH GRPLQLR GHEH VHU FRUWR IiFLO GH
UHFRUGDU \ GHVFULELU HO SURGXFWR R VHUYLFLR TXH
RIUHFHV $O HQFRQWUDU XQ GRPLQLR GLVSRQLEOH SDUD WX
HPSUHVD R PDUFD GHEHUiV UHJLVWUDUOR \ SDJDU XQD
FXRWDDQXDO

Interiores.indd 201

5/9/13 6:29 PM

$OJXQDV HQWLGDGHV UHJLVWUDQWHV DFUHGLWDGDV WDPELpQ


RIUHFHQ VHUYLFLRV GH KRVWLQJ R DORMDPLHQWR DVt TXH
SRGUiV HOHJLU HQWUH ORV SDTXHWHV TXH pVWDV RIUHFHQ
(VWHWHPDORYHUHPRVXQSRFRPiVDGHODQWH
6LQRORKDVKHFKRUHDOL]DXQDOOXYLDGHLGHDVVREUH
SRVLEOHVQRPEUHVGHGRPLQLRVSDUDWXHPSUHVD
&RPR PHQFLRQDPRV HQ OD OHFFLyQ  HO GLVHxR GH WX
VLWLRZHEGHEHUiUHVSRQGHUDORVREMHWLYRVGHQHJRFLR
GH OD HPSUHVD $QDOL]DQGR ODV QHFHVLGDGHV
HVSHFtILFDV GH WX VLWLR \ ORV UHFXUVRV GLVSRQLEOHV
GHEHUiV GHWHUPLQDU VL HO GLVHxR GHO VLWLR VH KDUi
LQWHUQDPHQWHRVHFRQWUDWDUiDXQSURYHHGRU

(OVLWLRZHE
6LVHGHFLGHFRQWUDWDUDDOJXLHQH[WHUQRSDUDUHDOL]DUHO
GLVHxRHVLPSRUWDQWHFRPXQLFDUODVQHFHVLGDGHVGHOD
HPSUHVD\QRSHUGHUGHYLVWDORVREMHWLYRVHVWDEOHFLGRV
3RU RWUD SDUWH VL VH GHFLGH TXH HO GLVHxR OR KDJD XQ
HTXLSR LQWHUQR VH GHEHUi WRPDU HQ FXHQWD OD
H[SHULHQFLD GH pVWH GLVHxDQGR H LPSOHPHQWDQGR VLWLRV
ZHE DVt FRPR HOHJLU HO VRIWZDUH TXH VH XWLOL]DUi SDUD
GHVDUUROODUHOVLWLR
$Vt PLVPR WDPELpQ H[LVWHQ PXFKDV SURGXFWRV \
KHUUDPLHQWDV EiVLFDV TXH SHUPLWHQ FUHDU XQ VLWLR ZHE
GH FRPHUFLR HOHFWUyQLFR VLQ WHQHU FRQRFLPLHQWR VREUH
SURJUDPDFLyQ

Interiores.indd 202

5/9/13 6:29 PM

(OVLWLRZHE
/D PD\RUtD GH ODV HQWLGDGHV UHJLVWUDQWHV
DFUHGLWDGDV TXH PHQFLRQDPRV DQWHULRUPHQWH
RIUHFHQ SODQWLOODV SUHHVWDEOHFLGDV D TXLHQHV
UHJLVWUDQ VX GRPLQLR FRQ HOORV \ SXHGHQ VHU XQD
RSFLyQ YLDEOH IiFLO \ GH EDMR FRVWR SDUD FUHDU WX
VLWLR
5HFXHUGDTXHHVQHFHVDULRVHOHFFLRQDUXQDSODQWLOOD
TXH LQFOX\D ODV IXQFLRQHV QHFHVDULDV SDUD SRQHU WX
WLHQGDHQOtQHD\UHDOL]DUFRPHUFLRHOHFWUyQLFR
$FRQWLQXDFLyQYHUHPRVSDVRDSDVRFyPRFUHDUXQ
VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR FRQ GLIHUHQWHV
KHUUDPLHQWDV

(OVLWLRZHE
(VWRVVLJXLHQWHVVLWLRVHQWUHPXFKRVRWURV
SURSRUFLRQDQRSFLRQHVGH3ODQWLOODVSUHHVWDEOHFLGDV
PX\IiFLOHVGHXVDU

VKRSLI\FRPP[
QHXER[FRP
PHUFDGRVKRSFRP
VXHPSUHVDFRP

7HLQYLWRDSRQHUSDXVDDOYLGHR\H[SORUDUDOJXQRV
GHHVRVVLWLRVYHUiVTXHHQUHDOLGDGHVPX\VHQFLOOR
HPSH]DUXQDWLHQGDHQOtQHD

Interiores.indd 203

5/9/13 6:29 PM

(OVLWLRZHE
$KRUD ELHQ 6L VH WLHQH XQ SRFR PiV GH
FRQRFLPLHQWR VREUH SURJUDPDFLyQ ZHE VH SXHGHQ
XWLOL]DUVRIWZDUHFRPR0LFURVRIW&RPPHUFH6HUYHU\
,%0:HE6SKHUH
7DPELpQ H[LVWHQ ORV VLVWHPDV GH JHVWLyQ GH
FRQWHQLGRVRSHQVRXUFHFRPRMRRPODRUJRGUXSDO
FRPTXHSHUPLWHGHVDUUROODUVLWLRVZHELQWHUDFWLYRV
(VWDVSODWDIRUPDVWHSHUPLWHQDJUHJDUH[WHQVLRQHVR
IXQFLRQHV HVSHFtILFDV SDUD WX VLWLR \ WH GDQ PiV
IOH[LELOLGDG HQ HO GLVHxR TXH ODV SODQWLOODV
SUHHVWDEOHFLGDV

3RU HMHPSOR HQ HO FDVR GHO VLVWHPD GH JHVWLyQ GH
FRQWHQLGRV GH -RRPOD VH SXHGH XWLOL]DU OD H[WHQVLyQ
GH 9LUWXH0DUW TXH HV XQD RSFLyQ FRPSOHWD SDUD
LPSOHPHQWDUFRPHUFLRHOHFWUyQLFRHQWXVLWLRZHE
8QD WHUFHUD RSFLyQ VHUtD FUHDU HO VLWLR ZHE GHVGH
FHUR XWLOL]DQGR VRIWZDUH GH SURJUDPDFLyQ FRPR
$GREH 'UHDPZHDYHU 0LFURVRIW ([SUHVVLRQ y DOJ~Q
VRIWZDUH GH XVR OLEUH FRPR .RPSR]HU 3DUD FUHDU HO
VLWLR ZHE XVDQGR HVWDV KHUUDPLHQWDV VH GHEH WHQHU
H[SHULHQFLDHQSURJUDPDFLyQ\GLVHxRZHE

Interiores.indd 204

5/9/13 6:29 PM

(OVLWLRZHE
$O QR VHU SDTXHWHUtD GH FRPHUFLR HOHFWUyQLFR VH
GHEHUiQ LQFRUSRUDU FDGD XQD GH ODV DSOLFDFLRQHV
QHFHVDULDV SDUD XQ VLWLR ZHE GH HFRPPHUFH SRU
VHSDUDGR FRPR VHUtD HO FDWiORJR HQ OtQHD HO
FDUULWR GH FRPSUDV \ RWURV HOHPHQWRV TXH
GLVFXWLPRVHQODOHFFLyQ
,QGHSHQGLHQWHPHQWHGHTXLpQGLVHxDHOVLWLRZHER
TXp SURJUDPD VH XWLOLFH SDUD KDFHUOR KD\ FLHUWRV
HOHPHQWRVGHOGLVHxRTXHGHEHVFRQVLGHUDU
$OJXQD YH] KDV HQWUDGR D XQD SiJLQD :HE
TXHWHJHQHUDXQDPDODH[SHULHQFLD"

5HIOH[LRQD 4Xp HV OR TXH HVSHUDV GH XQ VLWLR


ZHE" 4Xp HOHPHQWRV SXHGHQ KDFHU TXH
WHQJDVXQDPDODH[SHULHQFLD"
7DO YH] P~VLFD R DXGLR TXH FRPLHQ]D
DXWRPiWLFDPHQWHWHQHUTXHYHUXQDLQWURGXFFLyQR
DQXQFLR DO HQWUDU D OD SiJLQD 3RSXSV OLJDV TXH
QR IXQFLRQDQ SiJLQDV R LPiJHQHV TXH VH FDUJDQ
OHQWDPHQWHRFRQWHQLGRQRDFWXDOL]DGR
(QJHQHUDOHVWDVH[SHULHQFLDVQHJDWLYDVSHUPLWHQ
GHWHUPLQDU ORV IDFWRUHV QHFHVDULRV SDUD WHQHU XQ
GLVHxRH[LWRVR
(O SULPHUR GH HOORV HV IXQFLRQDOLGDG H LPSOLFD
WHQHU SiJLQDV TXH IXQFLRQHQ FDUJXHQ
UiSLGDPHQWH \ GLULMDQ DO FOLHQWH KDFLD OD RIHUWD GH
SURGXFWRV

Interiores.indd 205

5/9/13 6:29 PM

(OVLWLRZHE
8Q VLWLR ZHE WDPELpQ GHEH VHU LQIRUPDWLYR FRQ
OLJDV TXH VHDQ IiFLOHV GH HQFRQWUDU \ GLULMDQ D ORV
FOLHQWHV KDFLD PiV LQIRUPDFLyQ VREUH WL \ VREUH ORV
SURGXFWRVTXHRIUHFHV
2WUR IDFWRU LPSRUWDQWH HV TXH HO VLWLR VHD IiFLO GH
XVDU TXH FXDOTXLHUD TXH DFFHGD D pO SXHGD
XWLOL]DUOR
(O VLWLR :HE WDPELpQ GHEH WHQHU XQD QDYHJDFLyQ
UHGXQGDQWHTXHSHUPLWDDOXVXDULROOHJDUDOPLVPR
FRQWHQLGRSRUGLIHUHQWHVYtDV
/D IDFLOLGDG GH FRPSUD HV XQ HOHPHQWR
LQGLVSHQVDEOH SDUD HO p[LWR QR VH GHEHQ QHFHVLWDU
PiVGHGRVFOLFNVSDUDKDFHUXQDFRPSUD

(OVLWLRZHE
(OVLWLRZHEGHEHIXQFLRQDUHQRDOPHQRVHQORVPiV
SRSXODUHV\HVQHFHVDULRDVHJXUDUTXHQRVHSLHUGDQ
IXQFLRQHVLPSRUWDQWHVDODEULUHOVLWLRHQXQQDYHJDGRU
XRWUR
2WUR IDFWRU LPSRUWDQWH HV TXH HO VLWLR GHEH FRQWHQHU
JUiILFRV VLPSOHV TXH QR GLVWUDLJDQ DO XVXDULR R OR
PROHVWHQ \ TXH QR WHQJD FRQWURO VREUH HOORV FRPR
VHUtDDXGLRTXHQRVHSXHGHDSDJDU 
3RU~OWLPRHVQHFHVDULRTXHHOVLWLRZHEWHQJDWH[WR
OHJLEOHHYLWDQGRIRQGRVRIXHQWHVTXHGLVWRUVLRQHQHO
WH[WR

Interiores.indd 206

5/9/13 6:29 PM

5HFDSLWXODQGR ORV RFKR IDFWRUHV PiV LPSRUWDQWHV


SDUD WHQHU XQ VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR
H[LWRVRVRQ









)XQFLRQDOLGDG
,QIRUPDWLYR
)iFLOGHXVDU
1DYHJDFLyQUHGXQGDQWH
)DFLOLGDGGHFRPSUD
0~OWLSOHVQDYHJDGRUHV
*UiILFRVVLPSOHV
7H[WROHJLEOH

&LHUUH
<DHVWDPRVSRUFRQFOXLUHVWDOHFFLyQ
+HPRV KDEODGR VREUH TXp VH QHFHVLWD SDUD FUHDU
SUHVHQFLD HQ OtQHD \ QRV HQIRFDPRV HQ GRV SDUWHV
HVHQFLDOHV UHJLVWUDU XQ GRPLQLR \ FUHDU WX VLWLR ZHE
GHFRPHUFLRHOHFWUyQLFR
(Q OD VLJXLHQWH OHFFLyQ KDEODUHPRV VREUH KRVWLQJ
FXHQWDVGHFRUUHR\DOJXQDVRSFLRQHVDOWHUQDVSDUD
WHQHUSUHVHQFLDHQOtQHD

Interiores.indd 207

5/9/13 6:29 PM

&LHUUH
$QWHV GH WHUPLQDU H[SHULPHQWD FRQ ODV GLIHUHQWHV
KHUUDPLHQWDV TXH KHPRV SUHVHQWDGR \ UHIOH[LRQD
VREUH VL HO GLVHxR GHO VLWLR OR KDUiV GH PDQHUD
LQWHUQDRH[WHUQD
&XiOFUHHVTXHVHDODPiVFRQYHQLHQWHSDUDWX
QHJRFLR"
1RVYHPRVHQODSUy[LPDVHVLyQ

Interiores.indd 208

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 8: Creando Presencia en Lnea
______________________________________________________________________________
Instrucciones: Ya has concluido la leccin 8 del curso. Por favor responde a las siguientes
preguntas y haz lo que se te pide para repasar los aprendizajes adquiridos.
1. Puedes comenzar a construir tu presencia en lnea con solamente una computadora
con conexin a Internet, un nombre para tu sitio web y un espacio donde colocarlo?

2. Si decides crear tu propio sitio web para realizar comercio electrnico necesitas contar
con ciertos elementos. Define cada uno de ellos:

Un dominio:
Un sitio web:
Hospedaje:
Cuentas de correo:

3. Menciona 2 empresas encargadas de gestionar el proceso de dominio para sus clientes:


a)
b)
4. Elige la opcin correcta. El dominio debe de ser:
a) Corto y difcil de recordar
b) Largo e irrepetible

c) Corto y Fcil de recordar

5. Recuerdas que mencionamos que hay plantillas que son tiles para construir tu sitio
web personalmente? Menciona 3 plantillas que hayamos mencionado o conozcas.
6. Investiga un poco ms sobre algunos sistemas de gestion de contenido como:
joomla.org o drupal.com.

7. Otra manera de crear el sitio desde cero es utilizando software de programacin.


Investiga un poco ms sobre Adobe Dreamweaver, Microsoft Expression o Kompozer.

Interiores.indd 209

5/9/13 6:29 PM

8. Qu elementos de un sitio web pueden hacer que tengas una mala experiencia? Es
decir elementos que causan molestia al usuario.

9. Se mencionaron 8 factores importantes para ser considerados al crear un sitio web de


e-commerce. Explica en una lnea a que se refiere cada uno.

Funcionalidad::
Informativo:
Fcil de usar:
Navegacin redundante:
Facilidad de compra:
Mltiples navegadores:
Grficos simples:
Texto legible:

10. Piensa qu opcin utilizars para crear tu sitio de e-commerce y elige la opcin correcta.
a) Contratar a alguien que lo haga por ti
b) Designar a un equipo interno que desarrolle todo desde cero
c) Crearlo internamente utilizando alguna plantilla

Interiores.indd 210

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 9
Creando presencia en lnea 3
Duracin:

30 min

Objetivo de aprendizaje: Describir qu es tener presencia en lnea, determinar los pasos


a seguir para crear un sitio web de comercio electrnico e
identificar otros medios para comercializar productos en lnea.
Subtemas:

Crear tu sitio web


Plataformas de terceros
Opciones alternas para tener presencia en lnea
Los buscadores y SEO

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
- Imagen de un servidor

D 3:
- Texto en el fondo

1.1 Hospedaje

Interiores.indd 211

5/9/13 6:29 PM

1.2 Cuentas de correo personalizadas

D 6:
- Texto en el fondo: servicio las 24 horas del
da, permita a tu sitio crecer conforme crezca
tu negocio

2. Plataformas de terceros

D 9:
- Logos decompras.com y mercadolibre.com

3. Otras opciones para tener presencia en lnea

D 11:
- Logo Groupon
D 13:
- Logos de Twitter, Facebook, G+ y Blogger

4. Los buscadores y SEO

Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 212

D 19:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ&UHDQGRSUHVHQFLDHQOtQHD 

,QIRUPDFLyQ*HQHUDO
%LHQYHQLGRGHQXHYR<DH[SHULPHQWDVWHFRQODV
KHUUDPLHQWDV TXH SUHVHQWDPRV OD OHFFLyQ
DQWHULRU"'HFLGLVWHFXiOVHUiODPiVDGHFXDGD
SDUDWXVLWLR"
5HFXHUGD TXH OD OLVWD TXH SUHVHQWDPRV QR HV
H[KDXVWLYDSRUORTXHSXHGHVVHJXLULQYHVWLJDQGR
DOJXQRV RWURV SURGXFWRV GLVSRQLEOHV TXH SXHGDQ
VHU XQD PHMRU RSFLyQ SDUD DOFDQ]DU ORV REMHWLYRV
GHWXQHJRFLR
6LJDPRV FRQ ORV VLJXLHQWHV SDVRV SDUD FUHDU WX
VLWLR ZHE \ DQDOLFHPRV DOJXQDV RWUDV RSFLRQHV
SDUDWHQHUSUHVHQFLDHQOtQHD

Interiores.indd 213

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O WHPD JHQHUDO GH HVWD VHVLyQ FRQWLQ~D VLHQGR
&UHDQGR3UHVHQFLDHQ/tQHD
6LQHPEDUJRKR\GHVDUUROODUHPRVORVWHPDV
&UHDUWXVLWLRZHE
3ODWDIRUPDVGHWHUFHURV
2SFLRQHVDOWHUQDVSDUDWHQHUSUHVHQFLDHQOtQHD
/RVEXVFDGRUHV\6(2
<HOREMHWLYRGHDSUHQGL]DMHHVSHUDGRHVTXHDO
ILQDOL]DUHVWDVHVLyQGHWHUPLQHVORVSDVRVDVHJXLU
SDUDFUHDUXQVLWLRZHEGHFRPHUFLRHOHFWUyQLFRH
LGHQWLILTXHVRWURVPHGLRVSDUDFRPHUFLDOL]DU
SURGXFWRVHQOtQHD

+RVSHGDMH
S
M
5HFXHUGDVTXpHQODOHFFLyQVHPHQFLRQyTXH
RWUD GH ODV FRQVLGHUDFLRQHV DO FRQVWUXLU XQ VLWLR
ZHE GH FRPHUFLR HOHFWUyQLFR HV GyQGH VH YD D
DORMDU HO VLWLR" (O KRVSHGDMH SRGUtD FRPSDUDUVH DO
WHUUHQR VREUH HO FXDO VH FRQVWUX\H XQD FDVD  (Q
HVWH VHQWLGR WX VLWLR VHUtD OD FRQVWUXFFLyQ \ HO
GRPLQLRODGLUHFFLyQGHODFDVD
$O WHQHU XQ VLWLR HQ OtQHD WRGD OD LQIRUPDFLyQ TXH
FRQWLHQH GHEH JXDUGDUVH HQ XQ VHUYLGRU ([LVWHQ
RSFLRQHVGHKRVSHGDMH
 3URYHHGRU GH KRVSHGDMH  &RORFDOL]DU  /D
QXEH\6HUYLGRUHVSURSLRV9HDPRVFDGDXQD

Interiores.indd 214

5/9/13 6:29 PM

+RVSHGDMH
/DSULPHUDRSFLyQHVVHOHFFLRQDUDXQSURYHHGRU
TXH SRU XQD FXRWD PHQVXDO VH HQFDUJD GH ORV
DVSHFWRV WpFQLFRV \ GH SHUVRQDO QHFHVDULRV SDUD
PRQWDU \ PDQWHQHU XQ VHUYLGRU ZHE (VWD RSFLyQ
HYLWD D OD HPSUHVD FRVWRV GH PDQWHQLPLHQWR
VXSHUYLVLyQUHSDUDFLyQ\RSHUDFLyQGHOVHUYLGRU

+RVSHGDMH
2WUD RSFLyQ HV FRORFDOL]DU HO VHUYLGRU :HE (VWR
LPSOLFDFRPSUDURUHQWDUXQVHUYLGRU:HEORFDOL]DGRHQ
HO HVSDFLR ItVLFR GHO SURYHHGRU (O SURYHHGRU VH KDFH
UHVSRQVDEOHGHGDUPDQWHQLPLHQWRDOHTXLSR\FHGHHO
FRQWUROGHODVRSHUDFLRQHV
8QD WHUFHUD RSFLyQ HV XWLOL]DU XQ SURYHHGRU GH
VHUYLFLRVHQODQXEHHOFXDORIUHFHHVSDFLRYLUWXDO
/R PiV LPSRUWDQWH HV VHOHFFLRQDU XQ SURYHHGRU TXH
VHD VHJXUR \ ILGHGLJQR TXH UHDOPHQWH SXHGD GDU XQ
VHUYLFLRODVKRUDVGHOGtDGXUDQWHWRGRHODxR\TXH
SHUPLWDDWXVLWLRFUHFHUFRQIRUPHFUH]FDWXQHJRFLR

Interiores.indd 215

5/9/13 6:29 PM

+RVSHGDMH
$OJXQDV HQWLGDGHV UHJLVWUDQWHV DFUHGLWDGDV
WDPELpQ RIUHFHQ VHUYLFLRV GH KRVWLQJ \ RIUHFHQ
GLIHUHQWHV SDTXHWHV SDUD TXH HOLMDV GH DFXHUGR D
WXVQHFHVLGDGHV
6L GHFLGHV DORMDU WX VLWLR ZHE HQ WXV SURSLRV
VHUYLGRUHV GHEHUiV FRQVLGHUDU FRVWRV HOHYDGRV
FRVWRVHOHYDGRVDOWHQHUTXHFRPSUDU\PDQWHQHU
KDUGZDUHVRIWZDUHLQVWDODFLRQHVItVLFDVUHQWDGH
OtQHDV FRQWUDWDU SHUVRQDO FDSDFLWDGR \ FRQVWUXLU
FDSDFLGDGHVGHVHJXULGDG\UHVSDOGR

+RVSHGDMH
8QDYH]UHYLVDGDVHVWDVRSFLRQHV
SRUFXiORSWDUtDV"SRUTXp"
7HLQYLWDPRVDTXHQRVPDQGHVWXVFRPHQWDULRVD
WUDYpVGHOIRURGHGLVFXVLyQ
(OFRUUHRHOHFWUyQLFRHVXQDPDQHUDLQGLVSHQVDEOH
SDUDODFRPXQLFDFLyQFRQFOLHQWHV\SURYHHGRUHV
DOKDFHUHFRPPHUFH$OUHJLVWUDUWXGRPLQLR
PXFKDVGHODVHQWLGDGHVUHJLVWUDQWHVRIUHFHQ
SDTXHWHVFRQFXHQWDVGHFRUUHRSDUDWL\WXV
HPSOHDGRV7HUHFRPHQGDPRVDQDOL]DUVXRIHUWD

Interiores.indd 216

5/9/13 6:29 PM

&XHQWDVGHFRUUHR
2WUD RSFLyQ UHFRPHQGDEOH HV *RRJOH $SSV JRRJOH
DSSV SDUD QHJRFLRV TXH DSDUWH GH FXHQWDV GH
FRUUHR SHUVRQDOL]DGDV RIUHFH KHUUDPLHQWDV
FRPSOHPHQWDULDV FRPR *RRJOH &DOHQGDU R *RRJOH
'ULYH TXH SHUPLWH FUHDU HGLWDU \ FRPSDUWLU DUFKLYRV
HQOtQHD
6LSRUHOPRPHQWRQRGHVHDVHPSH]DUWXSURSLRVLWLR
GHHFRPPHUFHH[LVWHQRWUDVRSFLRQHVSDUD
FRPHUFLDOL]DUWXVSURGXFWRVHQOtQHD'RVGHODV
PiVXWLOL]DGDVVRQGHFRPSUDVFRP\PHUFDGROLEUH
FRPODVFXDOHVWHSHUPLWHQRIUHFHUWXVSURGXFWRVHQ
VXSODWDIRUPDHQOtQHD

3ODWDIRUPDVGHWHUFHURV
3XHGHV SRQHU SDXVD DO YLGHR SDUD QDYHJDU XQ
PRPHQWR HQ HVWRV VLWLRV \ FRQRFHUORV GH PRGR
JHQHUDO
\D ORV FRQRFtDV"KDEtDV FRPSUDGR DOJR FRPR
FOLHQWHHQDOJXQRGHHVWRVVLWLRV"
'HFRPSUDVFRP WH SHUPLWH RIUHFHU HO Q~PHUR GH
SURGXFWRVTXHGHVHHV\RIUHFHDORVFOLHQWHVXQD
YDULHGDG GH IRUPDV GH SDJR VLQ W~ WHQHU TXH
DGPLQLVWUDUODV

Interiores.indd 217

5/9/13 6:29 PM

3ODWDIRUPDVGHWHUFHURV
/RV SDJRV D ORV YHQGHGRUHV FDOHQGDULR VH
SURJUDPDQ FDGD  GtDV FRQILUPDQGR OD HQWUHJD
GHOSURGXFWRFRQHOFOLHQWH'HFRPSUDVFRPFREUD
XQDFRPLVLyQSRUYHQWDUHDOL]DGD
(O FDVR GH PHUFDGROLEUHFRP OR DQDOL]DPRV
SUHYLDPHQWHHQODOHFFLyQFRPRHMHPSORGHXQ
PRGHORGHQHJRFLR%&1HJRFLRDFRQVXPLGRV

2WUDVRSFLRQHVSDUDWHQHUSUHVHQFLD
8QD WHUFHUD RSFLyQ HV SRQHU RIHUWDV HQ SRUWDOHV
FRPR *URXSRQ y &OLFNRQHUR ZZZJURXSRQFRP
P[ \ ZZZFOLFNRQHURFRPP[ VRQ SRUWDODOHV
GLVHxDGRV SDUD LQIRUPDU \ RIUHFHU FXSRQHV GH
GHVFXHQWRV H[FOXVLYRV FRQ OR PHMRU SDUD KDFHU
YHU\FRPSUDUHQWXFLXGDGHQGLVWLQWDVDFWLYLGDGHV
\HVWDEOHFLPLHQWRV
&DGD 2IHUWD y &XSRQ GHEH HVWDU VXVFULWR SRU XQ
PtQLPRGHXVXDULRVGHQWURGHODVKRUDVHQODV
TXH VH HQFXHQWUD GLVSRQLEOH GLFKD RIHUWD *UDFLDV
D HVWR SXHGHQ JDUDQWL]DU RIHUWDV UHDOPHQWH
LQWHUHVDQWHV

Interiores.indd 218

5/9/13 6:29 PM

6LGHFLGHVD~QQRYHQGHUHQOtQHDUHFRPHQGDPRVDO
PHQRV FUHDU XQ VLWLR ZHE GRQGH VH RIUH]FD
LQIRUPDFLyQ VREUH OD HPSUHVD VXV SURGXFWRV \R
VHUYLFLRV GLVSRQLEOHV /RV FRQVXPLGRUHV QR SRGUiQ
KDFHUWUDQVDFFLRQHVDWUDYpVGHHOODSHURDOPHQRV
FRQWDUiV FRQ SUHVHQFLD HQ OtQHD TXH WH DFHUTXH D
DTXHOODVSHUVRQDVEXVFDQGRSURGXFWRVFRPRORVTXH
RIUHFHV 8QD RSFLyQ JUDWXLWD VHQFLOOD \ IiFLO GH
XWLOL]DUHV:L[:HHEO\y*RRJOHVLWHV
3DUD XWLOL]DU HVWDV KHUUDPLHQWD QR VH QHFHVLWDQ
FRQRFLPLHQWRV GH SURJUDPDFLyQ \D TXH RIUHFH
SODQWLOODVSUHHVWDEOHFLGDV\PX\VHQFLOODVGHXVDU

2WUD KHUUDPLHQWD LPSRUWDQWH TXH GHEHV LQFRUSRUDU


DWXHVWUDWHJLDVRQODVUHGVRFLDOUHGHVVRFLDOHV
0XFKDJHQWHEXVFDLQIRUPDFLyQVREUHSURGXFWRV\
VHUYLFLRVHQODSiJLQDGHIDFHERRNGHODHPSUHVD\
FRQWDUFRQXQDFXHQWDGHWZLWWHUWHSHUPLWHHVWDUHQ
FRQVWDQWH FRPXQLFDFLyQ FRQ WXV FOLHQWHV (Q OD
VLJXLHQWH OHFFLyQ YHUHPRV FyPR LQFRUSRUDU HVWDV
KHUUDPLHQWDVDWXSUHVHQFLDHQOtQHD\WXHVWUDWHJLD
GHPDUNHWLQJ
(O GLVHxR \ FRQWHQLGR GH OD SiJLQD LPSDFWDUi OD
H[SHULHQFLD GHO XVXDULR \ VXV GHFLVLRQHV GH
FRPSUDGHPDQHUDGHWHUPLQDQWHSHURGHVGHXQD
SHUVSHFWLYDGHQHJRFLRXQVLWLR:HEHVWDQYDOLRVR
FRPRHOQ~PHURGHYLVLWDVTXHUHFLEH

Interiores.indd 219

5/9/13 6:29 PM

/D PD\RUtD GH ORV FRQVXPLGRUHV DO TXHUHU


HQFRQWUDU XQ SURGXFWR XWLOL]DUiQ XQ EXVFDGRU
&RPR PHQFLRQDPRV HQ OD OHFFLyQ  ORV
EXVFDGRUHV QR H[SORUDQ WRGD OD ZHE VLQR XQ
tQGLFH GH OD ZHE \ ORV UHVXOWDGRV GH E~VTXHGD
GHSHQGHQ GHO DOJRULWPR XWLOL]DGR SRU FDGD
SURJUDPD 5HFRUGDUiV TXH DOJXQRV HMHPSORV GH
EXVFDGRUHVVRQ<DKRR*RRJOH\%LQJ

/RVEXVFDGRUHV
3DUD WX QHJRFLR VHUi LPSRUWDQWH DSDUHFHU HQ ORV
SULPHURV OXJDUHV GH OD OLVWD GH UHVXOWDGRV GH
E~VTXHGD \ DXQTXH ORV EXVFDGRUHV QR SXEOLFDQ
VXV DOJRULWPRV GH E~VTXHGD KD\ FLHUWRV
HOHPHQWRV TXH SHUPLWHQ OOHJDU D ORV SULPHURV
OXJDUHVGHUHVXOWDGRV
8QEXVFDGRULGHQWLILFDHQWXVLWLRSDODEUDVFODYH
\ODVLQGH[DSDUDFXDQGRVHOHSLGDXQDE~VTXHGD
HV LPSRUWDQWH TXH LQFOX\DV SDODEUDV FODYH TXH
GHVFULEDQFRQSUHFLVLyQORTXHKDFHVXRIUHFHVHQ
OD GHVFULSFLyQ GH WX VLWLR \ HQ OD VHFFLyQ GH
SDODEUDVFODYHGHWXFyGLJRIXHQWH

Interiores.indd 220

5/9/13 6:29 PM

/RVEXVFDGRUHV
([SHULPHQWDFDPELDODVSDODEUDV\GHVFXEUHTXp
SDODEUDV FODYH DWUDHQ PiV YLVLWDV 3RU HMHPSOR
FDUURV DQWLJXRV SXHGH WUDHU PiV YLVLWDQWHV TXH
FDUURVYLHMRV
 ,GHQWLILFD ORV QLFKRV GH PHUFDGR D ORV TXH VH
HQIRFDQ WXV SURGXFWRV HO LQFOXLU SDODEUDV FODYH
FRPR ]DSDWRV FyPRGRV SXHGH VHU PiV HIHFWLYR
TXH VLPSOHPHQWH ]DSDWRV \ DWUDHUi D HVH JUXSR
HVSHFtILFR GH SHUVRQDV EXVFDQGR ]DSDWRV
FyPRGRV

/RVEXVFDGRUHV
2IUHFHWXH[SHUWLVH\JHQHUDFRQWHQLGRV,QFOX\H
SiJLQDVGHSUHJXQWDVIUHFXHQWHVJXtDVUHODWRVGH
WX H[SHULHQFLD TXH SHUPLWDQ FRQILDQ]D FUHDU
FRQILDQ]D HQ HO XVXDULR \ PRWLYDUORV D XWLOL]DU WX
SiJLQD FRPR XQ OXJDU SDUD HQFRQWUDU FRQVHMR
DSR\R\JXtD
 /RJUD TXH RWURV VLWLRV FRQWHQJDQ OD OLJD D WX
VLWLR (VWR OR SXHGHV KDFHU D WUDYpV GH EORJV
HQOLVWiQGRWH HQ <DKRR 'LUHFWRULHV DEULHQGR XQD
SiJLQD GH )DFHERRN \ XQD FXHQWD GH 7ZLWWHU
GRQGHUH~QDVDORVVHJXLGRUHVGHWXVLWLR

Interiores.indd 221

5/9/13 6:29 PM

&RPSUDHVSDFLRSXEOLFLWDULRHOFRPSOHPHQWDUORV
UHVXOWDGRV GH E~VTXHGD QDWXUDOHV FRQ DQXQFLRV
SXEOLFLWDULRVHQOtQHDSHUPLWLUiDWUDHUPiVYLVLWDV
'HWHUPLQD ODV SDODEUDV FODYH \ SRQ XQ WRSH HQ WX
SUHVXSXHVWRSDUDHYLWDUJDVWRVHOHYDGRVHYDO~DORV
UHVXOWDGRVSDUDHQIRFDUWXHVWUDWHJLD
(OGHVDUUROODUXQPHUFDGRDQLYHOQDFLRQDOSXHGH
WRPDU WLHPSR HPSLH]D SRU GDUWH D FRQRFHU GH
PDQHUDORFDO6LWXSURGXFWRRVHUYLFLRYDGLULJLGRD
ODFRPXQLGDGORFDORVHSURGXFHHQODORFDOLGDGHV
UHFRPHQGDEOHLQFOXLUSDODEUDVFODYHTXHLQGLTXHQWX
ORFDOL]DFLyQSDUDDWUDHUDDTXHOODVSHUVRQDVTXHVH
HQFXHQWUDQ FHUFD 8Q HMHPSOR GH HVWR SRGUtD VHU
DUWHVDQtDFKLDSDQHFD

/RVEXVFDGRUHV
$&7,9,'$' 3LHQVD XQ SRFR VREUH ODV SDODEUDV
FODYH TXH GHVFULEHQ WX SURGXFWR R VHUYLFLR 6L
IXHUDV W~ TXLHQ TXLVLHUD HQFRQWUDUORV HQ ,QWHUQHW
TXpSDODEUDVSRQGUtDVHQHOEXVFDGRU"7RPDXQD
KRMD GH SDSHO \ HODERUD XQD OOXYLD GH LGHDV GH
SDODEUDVFODYHSDUDWXQHJRFLR
'HVSXpV UHDOL]D OD E~VTXHGD HQ HO EXVFDGRU GH WX
SUHIHUHQFLD %LQJ*RRJOH<DKRR 4XpUHVXOWDGRV
DSDUHFHQ" 6L \D HVWiV HQ OtQHD DSDUHFH WX VLWLR"
DSDUHFHQQHJRFLRVTXHRIUHFHQDOJRVLPLODU"
5HFXHUGD SRQHUWH HQ HO OXJDU GHO XVXDULR \ GH
DTXHOOD FOLHQWHOD TXH TXLHUDV DWUDHU DO GHWHUPLQDU
ODVSDODEUDVFODYHSDUDWXVLWLR

Interiores.indd 222

5/9/13 6:29 PM

&LHUUH
&RQ HVWD OHFFLyQ FRQFOXLPRV HO WHPD GH FUHDU WX VLWLR
ZHE GH FRPHUFLR HOHFWUyQLFR LGHQWLILFDQGR TXH
QHFHVLWDV WRPDU GHFLVLRQHV VREUH HO KRVWLQJ R
DORMDPLHQWR GH WX VLWLR \ FUHDU FXHQWDV GH FRUUHR
SHUVRQDOL]DGDV
7DPELpQGLVFXWLPRVDOJXQDVRSFLRQHVSDUDRIUHFHUWXV
SURGXFWRV HQ OtQHD R DO PHQRV WHQHU SUHVHQFLD HQ
OtQHD VL GHFLGHV D~Q QR FUHDU XQ VLWLR ZHE GH H
FRPPHUFH
3RU ~OWLPR RIUHFLPRV DOJXQDV UHFRPHQGDFLRQHV SDUD
ORJUDU TXH WX VLWLR DSDUH]FD HQ ORV UHVXOWDGRV GH
E~VTXHGDGHORVPRWRUHVGHE~VTXHGD
&RPR PHQFLRQDPRV HQ OD VLJXLHQWH OHFFLyQ YHUHPRV
FyPRDSURYHFKDUODVUHGHVVRFLDOHVSDUDHOp[LWRGHWX

Interiores.indd 223

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 9: Creando Presencia en Lnea
______________________________________________________________________________

Instrucciones: Una vez que hayas concluido la leccin 9 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. A qu se refiere el hospedaje de un sitio web?

2. Cules son las 4 opciones de hospedaje?

3. Enlista algunas ventajas de hospedarse con un proveedor


4. Co- localizar el servidor web implica ______________________ un servidor web
localizado en el espacio fsico del proveedor.
5. Existen ciertas desventajas en hospedar tu sitio web en servidores propios. Menciona
dos de ellas.
a)
b)
6. Danos tu opinin sobre Por qu crees que tener cuentas de correo electrnico
personalizadas representa una ventaja para tu negocio?

7. Qu alternativas existen para comercializar tus productos o servicios en lnea en caso


de no querer crear un sitio web de tu negocio?

Interiores.indd 224

5/9/13 6:29 PM

8. Cules plataformas o portales de terceros se mencionaron como ejemplos?

9. Responde Verdadero (V) o Falso (F):


- El nico propsito de tener un sitio web es llevar a cabo transacciones en lnea ____
- Existen ms de dos opciones para contar con presencia en lnea ____
- Algunas opciones de hospedaje son ms costosas que otras ____
- Las redes sociales son una opcin de tener presencia en lnea _____

10. Por qu es importante que tu sitio web de comercio electrnico est bien indexado en
la web? Cmo se relaciona esto con los buscadores y los consumidores finales?

Interiores.indd 225

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 10
Redes Sociales
Duracin:

30 min

Objetivo de aprendizaje:

Identificar las redes sociales ms utilizadas y reconocer cmo


utilizarlas para aumentar tu presencia en lnea y como
estrategia de marketing.

Subtemas:

Requisitos:

Redes Sociales
Comunidades virtuales
Social Media marketing

Computadora, Tablet o dispositivo desde el que pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Interiores.indd 226

Notas de Produccin:

Introduccin
- Bienvenida
- Recapitulacin de la leccin previa
- Tema y Subtemas
- Objetivo de Aprendizaje

D 2:
-Texto de fondo de pantalla: Tema, subtemas (bullets) y
objetivo educativo

Desarrollo
1. Redes Sociales

D 4:
- Grficos: una telaraa virtual que conecta a los usuarios
entre si, bloggs, foros, chats, etc.
D 5:
- Imagen representativa de comunicacin

D 3:
- Redes Sociales

5/9/13 6:29 PM

D 6:
- Texto: Social Commerce
Logotipos de Facebook y Twitter
D 7:
- Grfico ilustrativo (Por ejemplo un cartoon de una flecha
que da al blanco y despus el mismo cartoon de muchas
flechas que caen fuera del blanco)
D 8:
- Logotipo GAP o su pgina de facebook

2. Comunidades Virtuales

D 10:
-Texto: Comunidades Virtuales
Imgenes de grupos de individuos
D 11:
- Imagen representativa de vnculo afectivo, relacin,
identidad
D 12:
- Texto de fondo: Cual es el medio ms sencillo para
crear una comunidad participativa?
De nuevo logotipo de facebook y twitter
D 13:
- Imgenes de sitios o tiendas virtuales que tengan el
botn de facebook para ligar con la pgina de fb de la
empresa.
Imgenes de tarjeta de presentacin con direccin de
twitter.

3. Social Media Marketing

D 14:
-Texto: Social Media Marketing
D 16:
- Demostracin en pantalla para crear un evento
Imgenes de publicidad en facebook
D 17-19:
- Texto:
1. Disea una estrategia editorial
2.- Planifica la publicacin (Hootsuite, Objective Marketer,
Co Tweet)
3. Responde
D 20:

Interiores.indd 227

5/9/13 6:29 PM

- Texto de fondo mientras se menciona;


Adquirir ideas y detectar tendencias de mercado.
Mejorar productos que ya se tienen.
Mejorar el servicio al cliente, fomentando la
comunicacin.
Informacin sobre el nivel de presencia de tu
marca en el mercado.
Valoracin interna y externa de tu imagen
comercial.
Conocer a tu competencia.
Fomento de identidad y sensacin de pertenencia
en colaboradores
Referencias sobre posibles candidatos para tu
empresa.
Abrir un canal de ventas.

Cierre
- Resumen
- Preguntas de Reflexin
- Mencin de la leccin que le precede.
- Ejercicios de Prctica

Interiores.indd 228

D 22:
- Texto: Qu opinas?

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ5HGHV6RFLDOHV

,QWURGXFFLyQ
%LHQYHQLGRVGHQXHYR
<DKDQGHFLGLGRGHTXpPDQHUDFUHDUSUHVHQFLD
HQOtQHDSDUDFRPHQ]DUDSDUWLFLSDUGHOFRPHUFLR
HOHFWUyQLFR"
3XHVHQHVWDOHFFLyQH[SORUDUHPRVRWUDRSFLyQGH
KDFHUORDWUDYpVGHODVIDPRVDVUHGHVVRFLDOHV
3UHFLVDPHQWH HO WHPD JHQHUDO VHUi 2QOLQH
0DUNHWLQJ<GHVDUUROODUHPRVORVVXEWHPDV
 5HGHV6RFLDOHV
 &RPXQLGDGHVYLUWXDOHV
 6RFLDO0HGLDPDUNHWLQJ

Interiores.indd 229

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(OREMHWLYRGHDSUHQGL]DMHHVSHUDGRHVTXH
LGHQWLILTXHVODVUHGHVVRFLDOHVPiVXWLOL]DGDV\
UHFRQR]FDVFyPRXWLOL]DUODVSDUDDXPHQWDUWX
SUHVHQFLDHQOtQHD\FRPRHVWUDWHJLDGHPDUNHWLQJ

5HGHVVRFLDOHV
/DV UHGHV VRFLDOHV UHSUHVHQWDQ XQ HVSDFLR
LPSRUWDQWHGHRSLQLyQ\SRUHOORVRQXQDIXHQWHGH
LQIRUPDFLyQ UHOHYDQWH HQ GRQGH ORV XVXDULRV
HQFXHQWUDQ UHFRPHQGDFLRQHV GH VXV VHPHMDQWHV
TXH FRPSDUWHQ H[SHULHQFLDV \ RSLQLRQHV VREUH
FLHUWDV PDUFDV \ VHUYLFLRV OR TXH VH FRQYLHUWH HQ
XQ HQWRUQR SXEOLFLWDULR LQIOX\HQWH D OD KRUD GH
WRPDU GHFLVLRQHV SDUD UHDOL]DU XQD FRPSUD
0LHQWUDVTXHKDFHXQWLHPSRVHKDFtDXQDFRPSUD
LQGLYLGXDO  DKRUD VH EXVFD OR VRFLDO HV GHFLU OD
FRPSDUDFLyQGHRSLQLRQHVHQWRUQRDXQDPDUFD\
VXVSURGXFWRV

Interiores.indd 230

5/9/13 6:29 PM

5HGHV6RFLDOHV
/RV FRQVXPLGRUHV VH ItDQ GH OR TXH GLFHQ RWURV
XVXDULRV HQ IRURV \ EORJV SXHV KDQ SDVDGR GH VHU
FRQVXPLGRUHV DLVODGRV D XVXDULRV LQIRUPDGRV \
FRQHFWDGRV
3RU HOOR ODV HPSUHVDV GHEHQ WUDEDMDU HQ XQD
HVWUDWHJLD SDUD WHQHU SUHVHQFLD HQ ORV PHGLRV \
JHQHUDU XQD EXHQD RSLQLyQ S~EOLFD /DV HPSUHVDV
HVWiQ DSUHQGLHQGR PX\ ELHQ FRPR JHQHUDU
FRQRFLPLHQWR GLIXVLyQ FRPXQLFDFLyQ LPDJHQ GH
PDUFDUHSXWDFLyQRQOLQH\ILQDOPHQWHODYHQWD

5HGHV6RFLDOHV
/DV UHGHV VRFLDOHV FRQVWLWX\HQ XQD PDQHUD
LPSRUWDQWHGHFUHDUSUHVHQFLD\KDFHUSXEOLFLGDGHQ
,QWHUQHW $ HVWH WLSR GH FRPHUFLR HQ OtQHD VH OH
FRQRFH WDPELpQ FRPR 6RFLDO &RPPHUFH \ VX p[LWR
VH GHEH D OD SRVLELOLGDG GH FUHDU HVSDFLRV
LQWHUDFWLYRV TXH SHUPLWHQ XQ PD\RU DFHUFDPLHQWR
HQWUHORVFRQVXPLGRUHVILQDOHV
(OKHFKRGHTXHORVXVXDULRVLQWHUDFW~HQHQWUHVtSRU
PHGLR GH EORJJV IRURV \ FKDWV HV PX\ YDOLRVR \D
TXH OD RSLQLyQ GH RWUR FRQVXPLGRU SXHGH VHU PX\
YDORUDGD\RWRUJDXQDPD\RUVHJXULGDGGHFRPSUD

Interiores.indd 231

5/9/13 6:29 PM

5HGHV6RFLDOHV
&DGDYH]PiVSHUVRQDVIRUPDQSDUWHVGHUHGHV
VRFLDOHVFRPR)DFHERRNR7ZLWWHU\WRGRVHOORVVH
FRQYLHUWHQHQFRQVXPLGRUHVSRWHQFLDOHV
3HUR WDPELpQ HV LPSRUWDQWH VDEHU TXH SDUD TXH HO
FRPHUFLR HQ ODV UHGHV VRFLDOHV WHQJD UHVXOWDGRV
YLVLEOHV HV QHFHVDULR KDFHU FDPSDxDV ELHQ
GLUHFFLRQDGDV
(V GHFLU OOHJDU DO S~EOLFR TXH UHDOPHQWH HVWi
LQWHUHVDGR SDUD HYLWDU TXH XQD FDPSDxD GH VRFLDO
FRPPHUFH VH FRQYLHUWD HQ XQD PROHVWLD SDUD HO
XVXDULR

5HGHVVRFLDOHV
(Op[LWRGHOFRPHUFLRHQODVUHGHVVRFLDOHVHVOD
VHJPHQWDFLyQGHORVXVXDULRVHQQLFKRVGHQHJRFLR
FRQFUHWRVFDGDXQRSRUVHFWRUGHDFWLYLGDG6LHVWiV
HQHOVLWLRDGHFXDGRVHUiPiVIiFLO\PHGLEOHHO
UHWRUQRGHODLQYHUVLyQ
(OYtQFXORTXHVHSXHGHORJUDUFRQODDXGLHQFLDD
WUDYpVGHODVUHGHVVRFLDOHVODVFRQYLHUWHHQXQ
HVSDFLRSRWHQFLDOSDUDLPSXOVDUODVYHQWDV
7DQWRSDUDSRWHQFLDUODVFRPSUDVHOHFWUyQLFDVFRPR
SDUDLQFUHPHQWDUODVYHQWDVHQXQDWLHQGDItVLFDODV
UHGHVVRFLDOHVWLHQHQXQJUDQSRWHQFLDOOLVWRSDUDVHU
GHVSOHJDGR

Interiores.indd 232

5/9/13 6:29 PM

5HGHV6RFLDOHV
8QFDVRGHp[LWRHQHOVRFLDOFRPPHUFHSRGUtDVHU
*$3TXHFRQVLJXLyYHQGHUPLOORQHVGHGyODUHVHQ
XQGtDJUDFLDVDXQDSURPRFLyQHQ)DFHERRNDWUDYpV
GH*URXSRQ3HURWDPELpQKD\SHTXHxRVHPSUHVDULRV\
3\PHVTXHFUHDQSUHVHQFLDHQHVWHWLSRGHUHGHV\
DGTXLHUHQP~OWLSOHVFOLHQWHV
3DUDOOHYDUWXQHJRFLRDHVWRVHVSDFLRVVRFLDOHVSRU
HMHPSOR)DFHERRN7ZLWWHU*RRJOH0\6SDFH
/LQNHGLQ\RWUDVUHGHV~QLFDPHQWHGHEHVDEULUXQD
FXHQWD\FUHDUHOSHUILOGHWXQHJRFLRGHPDQHUDTXH
HVWpGLVSRQLEOH\SXHGDVHUHQFRQWUDEOHSRUPLOHVGH
XVXDULRV

5HGHV6RFLDOHV
$OKDFHUORHVLPSRUWDQWHTXHEXVTXHVFRQHFWDUWHFRQ
FOLHQWHVSRWHQFLDOHVGHDFXHUGRDWXRIHUWDGH
PHUFDGR6HFFLRQDQLFKRVGHPHUFDGRSRUJXVWRV
HGDGHV\RWURVFULWHULRVVLPLODUHV
/DVFRPXQLGDGHVYLUWXDOHVFRPRODVUHGHVVRFLDOHV
WDPELpQVRQHVSDFLRVHQORVTXHVHFRPSDUWHQ
RSLQLRQHVGHGLIHUHQWHVWHPDVDVtFRPRGH
SURGXFWRVRVHUYLFLRV8QDFRPXQLGDGHVXQFRQMXQWR
GHLQGLYLGXRVTXHFRPSDUWHQHOHPHQWRVHLQWHUHVHV
HQFRP~QFRQXQDLGHQWLGDGSRUHMHPSORUD]D
FUHHQFLDVLGLRPDFXOWXUDHGDGHWF

Interiores.indd 233

5/9/13 6:29 PM

&RPXQLGDGHV9LUWXDOHV
8QD FLEHUFRPXQLGDG HV FXDOTXLHU FRPXQLGDG GH
LQGLYLGXRV TXH WLHQHQ HQ ,QWHUQHW VX OXJDU GH UHXQLyQ
GLVFXVLyQFDPELRGHSXQWRVGHYLVWDHWF
'LFKDV FLEHUFRPXQLGDGHV SXHGHQ HQFRQWUDUVH HQ
HVSDFLRV YLUWXDOHV FRPR XQD FRPXQLGDG \ ORV
UHVSRQVDEOHV GH VX PDQHMR VRQ ORV &RPPXQLW\
0DQDJHUV
*HQHUDOPHQWHODVFRPXQLGDGHVYLUWXDOHVVHFUHDQFRQ
HO SURSyVLWR GH UHXQLU D OD JHQWH HQWRUQR D XQ LQWHUpV
HQ FRP~Q (O SHUWHQHFHU D HVWDV FRPXQLGDGHV OHV
JHQHUD LGHQWLGDG YtQFXORV HPRFLRQDOHV DIHFWLYRV \
UDFLRQDOHVFRQORVGLIHUHQWHVXVXDULRV

&RPXQLGDGHV9LUWXDOHV
7XSXHGHVWDQWRSHUWHQHFHUDHVWDVFRPXQLGDGHV
FRPRFUHDUXQDHQWRUQRDXQWHPDRSURGXFWRGH
LQWHUpV
&UHDUXQDFRPXQLGDGFRQWXVFOLHQWHVYDDGHSHQGHU
GHOWLSRGHVHUYLFLRTXHVHGHGHOSURGXFWRTXHVH
YHQGD\GHOSUHVXSXHVWRTXHVHWLHQH(OFUHDUXQD
FRPXQLGDGSURSLDGHXVXDULRVGRQGHSDUWLFLSHQH
LQWHUDFW~HQFOLHQWHV\VLPSDWL]DQWHVVHUiXQD
H[FHOHQWHPDQHUDGHIRUWDOHFHUWXVUHODFLRQHV\
YtQFXORVFRQHOORV

Interiores.indd 234

5/9/13 6:29 PM

&RPXQLGDGHV9LUWXDOHV
&UHDUHQWXVFOLHQWHVXQVHQWLGRGHSHUWHQHQFLD
KDFLDWXPDUFDHVHOREMHWLYRGHWRGDHVWUDWHJLDGH
0DUNHWLQJ
&XDOHVHOPHGLRPiVVHQFLOORSDUDFUHDUXQD
FRPXQLGDGSDUWLFLSDWLYD"
'HILQLWLYDPHQWHDSURYHFKDUODSODWDIRUPDGHODV
UHGHVVRFLDOHVGRQGH\DH[LVWHQPXFKRVXVXDULRV

&RPXQLGDGHV9LUWXDOHV
/DVGRVUHGHVVRFLDOHVPiVLPSRUWDQWHVGHODZHE
SXHGHQVHUXQEXHQFRPLHQ]RSDUDGDUDFRQRFHU
WXHPSUHVD0XFKDVJUDQGHVFRPSDxtDVREWLHQHQ
PLOHV\PLOORQHVGHIDQVHQ)DFHERRNR
VHJXLGRUHVHQ7ZLWWHUVyORSRUWHQHUUHQRPEUH\ORV
PLVPRVXVXDULRVODVEXVFDUiQHQPRWRUHVGH
E~VTXHGD
7DPELpQODV3<0(6WLHQHQEXHQDV
RSRUWXQLGDGHVHQODVUHGHVVRFLDOHV

Interiores.indd 235

5/9/13 6:29 PM

&RPXQLGDGHV9LUWXDOHV
7DPELpQGHEHVSURPRYHUWXSiJLQDHQRWURVVLWLRV
RQOLQHHPSH]DQGRSRUSRQHUXQERWyQTXHYLQFXOH
WXSiJLQDGH)DFHERRNHQWXVLWLRZHESDUD
D\XGDUDRWURVDHQFRQWUDUODRDQXQFLDQGRWX
FXHQWDGH7ZLWWHUHQWXVLWLR\HQWXVWDUMHWDVGH
QHJRFLRV
(QUHVXPHQKDFHUORTXHVHDQHFHVDULRSDUDTXH
ODJHQWHVHSDTXHHVWiVHQOtQHD\TXHGHVHDVTXH
IRUPHQSDUWHGHWXFRPXQLGDG

&RPXQLGDGHV9LUWXDOHV
8QDYH]TXHFUH]FDWXUHGRFRPXQLGDGWXWDUHD
VHUiPDQWHQHUHOFRQWDFWRFRQWXVFOLHQWHV\
IRPHQWDUODILGHOL]DFLyQSRUPHGLRGHDFFLRQHV
FRPRKDFHUOHVDOJ~QUHJDORHQRFDVLRQHV
IHOLFLWDUOHSRUVXFXPSOHDxRVRGDUOHDFFHVRD
SURPRFLRQHVH[FOXVLYDVSDUDVRFLRV
(VWDVUHGHV\FRPXQLGDGHVVRFLDOHVVHKDQ
FRQYHUWLGRHQKHUUDPLHQWDVFDGDYH]PiV
XWLOL]DGDVSDUDOOHJDUDOFUHFLHQWHQ~PHURGH
FRQVXPLGRUHVLQPHUVRVHQORVVRFLDOPHGLD

Interiores.indd 236

5/9/13 6:29 PM

6RFLDO0HGLD0DUNHWLQJ
(VWRVPHGLRVHPHUJHQWHVWLHQHQLQWHUHVDQWHV
DSOLFDFLRQHVHQPDUNHWLQJ\DTXHORV6RFLDO0HGLD
FRQWULEX\HQDXQDQXHYDPDQHUDGHFRPXQLFDFLyQ
HQWUHODHPSUHVD\HOFOLHQWHGRQGHODLQIRUPDFLyQ
IOX\HHQGRVVHQWLGRV
$KRUDHOXVXDULRVHVLHQWHPiVFHUFDQRDVXPDUFD
JUDFLDVDOSURFHVRGRQGHVHHVFXFKD\VHKDEOD
LJXDOPHQWH$QWHVHOFOLHQWHQDGDPDVHUDXQ
UHFHSWRUHQFDPELRDKRUDSXHGHRSLQDU\FRQWULEXLU

6RFLDO0HGLD0DUNHWLQJ
'DUDFRQRFHUWXVVHUYLFLRVRSURGXFWRVHQODV5HGHV
6RFLDOHVHVHVXQDWDUHDDUGXD\QHFHVLWDVODPD\RU
YLVLELOLGDGSRVLEOHHQODVUHGHVHQODVTXHWLHQHV
SUHVHQFLDSDUDORJUDUOR
3DUDHOORGHEHVFRQVLGHUDUTXHWXUHGGHFRQWDFWRV
GHSULPHUJUDGRHVIiFLOPHQWHYLVLEOHSHUR4Xp
SDVDFRQORVFRQWDFWRVGHQXHVWURVFRQWDFWRV"
$KtWDOYH]\DQRSRGDPRVOOHJDUIiFLOPHQWH\GHEHV
LQWHQWDUDJUHJDUORVDWXFRPXQLGDGSDUDKDFHUFUHFHU
ODUHGGHFRQWDFWRVTXHVHDMXVWHQFRQSUHFLVLyQDWX
WDUJHWFRQHOREMHWLYRGHDOFDQ]DUDFRQWDFWRVGH
VHJXQGR\WHUFHUJUDGR

Interiores.indd 237

5/9/13 6:29 PM

6RFLDO0HGLD0DUNHWLQJ
8QDEXHQDHVWUDWHJLDSDUDOOHJDUDPiVXVXDULRV
SXHGHVHUODFUHDFLyQGHHYHQWRVFRQOD
FRQILJXUDFLyQTXHSHUPLWHDORVLQYLWDGRVLQYLWDUD
RWUDVSHUVRQDVDXQLUVHRDVLVWLU7DPELpQSXHGHV
SHGLUDWXVIDQVTXHSURPRFLRQHQWXSiJLQD
2WUDHVWUDWHJLDGHPDUNHWLQJHQUHGHVVRFLDOHVHV
UHQWDUXQHVSDFLRSDUDGLIXQGLURSXEOLFDUWXVLWLR
(VWRWHQGUiXQSUHFLRHVSHFtILFRTXHYDUtD
DOUHGHGRUGHGOVSRUGtD\TXHVLQGXGDHVXQ
PpWRGRHILFLHQWHGHKDFHUSXEOLFLGDG

6RFLDO0HGLD0DUNHWLQJ
<VLJXLHQGRFRQHVWUDWHJLDVGHSXEOLFLGDGHQUHGHV
VRFLDOHVOD$VRFLDFLyQ0H[LFDQDGH,QWHUQHWSXEOLFy
WLSVSDUDXVDUWZLWWHUFRPRXQSURIHVLRQDO
'LVHxDXQDHVWUDWHJLDHGLWRULDO
(VPX\LPSRUWDQWHFRQWDUFRQXQDHVWUDWHJLDHGLWRULDO
SDUDORTXHVHYDDSXEOLFDU'HHVWDPDQHUDSXHGHV
GHILQLUORVWHPDVDSXEOLFDUHOHVWLORGHHVFULWXUDOD
H[WHQVLyQGHORVWH[WRVHLQFOXVRGHILQLUVLVHYDQD
WZLWWHDUFRQWHQLGRVGHWHUFHURVRVRODPHQWHSURSLRV

Interiores.indd 238

5/9/13 6:29 PM

6RFLDO0HGLD0DUNHWLQJ
3ODQLILFDODSXEOLFDFLyQ
3DUDODVHPSUHVDVHVLPSRUWDQWHWHQHUHQPHQWHOD
SRVLELOLGDGGHSURJUDPDUODSXEOLFDFLyQGH
PHQVDMHVFRQPXFKRWLHPSRGHDQWLFLSDFLyQGH
PDQHUDTXHVHSXEOLTXHHOFRQWHQLGRFRUUHFWRHQHO
PRPHQWRFRUUHFWR
$FWXDOPHQWHSRGHPRVHQFRQWUDUVRIWZDUHTXHQRV
D\XGHFRQODSXEOLFDFLyQGHFRQWHQLGRV$OJXQRV
HMHPSORVTXHSXHGHVH[SORUDUVRQ+RRWVXLWH
2EMHFWLYH0DUNHWHU&R7ZHHWHQWUHRWURV

6RFLDO0HGLD0DNHWLQJ
5HVSRQGH8QDGHODVJUDQGHVIRUWDOH]DVGH
7ZLWWHUSDUDKDFHUPDUNHWLQJHVODLQWHUDFFLyQFRQORV
VHJXLGRUHVGHPDQHUDFDVLLQPHGLDWDDVtTXHSDUD
VDFDUHOPD\RUSURYHFKRDHVWDUHGVRFLDOHV
QHFHVDULRWHQHUHQFXHQWDTXHGHEHPRVUHVSRQGHU\
FRQVLGHUDUODVRSLQLRQHVGHORVVHJXLGRUHV7DUGDU
PiVGHWUHVKRUDVHQUHVSRQGHUXQ7ZLWWRLQFOXVRQR
UHVSRQGHUHVLQWHUSUHWDGRFRPRXQDIDOWDGHLQWHUpV
6LGHFLGLPRV7ZLWWHDUGHIRUPDSURIHVLRQDOHO
UHVSRQGHUGHEHVHUXQDGHODVSULRULGDGHVDVtTXH
DQWHVGHHPSH]DUDSXEOLFDUHVPX\LPSRUWDQWH
GHFLGLUTXLpQFyPR\HQTXpPRPHQWRYDD
UHVSRQGHUODVFRQYHUVDFLRQHV

Interiores.indd 239

5/9/13 6:29 PM

6RFLDO0HGLD0DUNHWLQJ
/DIRUPDHQODTXHKDFHVSURPRFLyQDWXPDUFD\
GHVFULEHVWXVSURGXFWRVHVPX\LPSRUWDQWH3RU
HMHPSORVLWLHQHVFRPRQHJRFLRXQEDUSRGUtDV
FRPSDUWLUWXVUHFHWDVGHFRFWpOHVRKDFHUXQD
HQFXHVWDHQWUHORVFOLHQWHVVREUHVXEHELGDIDYRULWDVL
YHQGHVDSDUDWRVHOHFWUyQLFRVSRGUtDVGDU
LQVWUXFFLRQHVVREUHHOXVR\DUPDGRGHFDGD
SURGXFWR/DFODYHHVWiHQVHUFUHDWLYRRWRUJDUYDORU
DJUHJDGR\SRGHUGDUDOVHJXLGRURIDQQRWLFLDVGH
FDOLGDGTXHOHLQWHUHVHQ7RGRHVWRD\XGDUiD
LQFUHPHQWDUWXSRSXODULGDG\JHQHUDULQWHUpVGH
UHWRUQRHQWXVFOLHQWHV

$OJXQDVYHQWDMDVGHSDUWLFLSDUHQUHGHVVRFLDOHVVRQ
$GTXLULULGHDV\GHWHFWDUWHQGHQFLDVGHPHUFDGR
0HMRUDUSURGXFWRVTXH\DVHWLHQHQ
0HMRUDUHOVHUYLFLRDOFOLHQWHIRPHQWDQGROD
FRPXQLFDFLyQ
2EWHQHULQIRUPDFLyQVREUHHOQLYHOGHSUHVHQFLD
TXHWLHQHWXPDUFDHQHOPHUFDGR
9DORUDFLyQLQWHUQD\H[WHUQDGHWXLPDJHQ
FRPHUFLDO
&RQRFHUDWXFRPSHWHQFLD
)RPHQWRGHLGHQWLGDG\SHUWHQHQFLDHQ
FRODERUDGRUHV
5HIHUHQFLDVVREUHFDQGLGDWRVSDUDWXHPSUHVD
$EULUXQFDQDOGHYHQWDV

Interiores.indd 240

5/9/13 6:29 PM

&LHUUH
3XHV\DHVWDPRVSRUFRQFOXLUODOHFFLyQ4Xp
RSLQDV"<DIRUPDVSDUWHGHXQDUHGVRFLDO"$KRUD
TXHFRQRFHVWRGDVODVYHQWDMDVTXHHVWRSXHGHWUDHU
SDUDWXQHJRFLRQRHVSHUHVPiVWLHPSRSDUDKDFHUOR
(QHVWDOHFFLyQDSUHQGLPRVVREUHODVUHGHVVRFLDOHV
FRPRKHUUDPLHQWDSDUDWHQHUSUHVHQFLDHQOtQHD\
GLULJLUXQDFDPSDxDGH0DUNHWLQJ(QODVSUy[LPDV
OHFFLRQHVFRQRFHUHPRVRWUDVPDQHUDVGHKDFHU
0DUNHWLQJ2QOLQHVLJXHFRQQRVRWURV+DVWDSURQWR

Interiores.indd 241

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 10: Redes Sociales
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 10 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Las Redes Sociales son:
________________________________________________________________________
________________________________________________________________________

2. Por qu las redes sociales son una buena herramienta para hacer marketing online?

3. Responde Verdadero (V) o Falso (F):


- Actualmente la opinin social influye en la decisin de compra del consumidor _____
- Las empresas obtienen diferentes ventajas al tener presencia en redes sociales _____

4. Al comercio electrnico llevado a cabo por medio de redes sociales, se le conoce


tambin como: ______________________.

5. A quin debe estar dirigida una campaa de marketing online en redes sociales?

6. Qu es lo que muy probablemente suceder si un grupo de personas a las que no les


interesa tu producto o servicio reciben constantemente propaganda?

7. Recuerdas el caso de xito que presentamos de ventas a travs de Redes Sociales?


Cul fu y cunto dinero consigui a travs de esta estrategia?

Interiores.indd 242

5/9/13 6:29 PM

8. Enlista 4 redes sociales:


a)
b)
c)
d)
9. Cul es la diferencia entre una red social y una comunidad virtual?

10. Mencionamos tres tips que da la Asociacin Mexicana de Internet para Twittear como
profesional. Enlstalos a continuacin:
a)
b)
c)

Interiores.indd 243

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 11
Online Marketing 1
Duracin:

30 min

Objetivo de aprendizaje: Explicar el concepto de online marketing y reconocer el


impacto que tienen las diferentes formas de hacer publicidad
en lnea con el fin de utilizarlas como estrategia.
Subtemas:

El consumidor
Tcnicas de online marketing
Publicidad en lnea
Pasos para disear una estrategia de marketing exitosa

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
- Grfica: actividades online (AMIPCI)

D 3:
- Texto en el fondo

1. El consumidor
D 11:
- Grfica: retos (AMIPCI)

Interiores.indd 244

5/9/13 6:29 PM

2. Tcnicas de marketing
2.1 Network marketing

D 18:
- Texto en el fondo:
http://www.youtube.com/watch?v=rofgMueCOq
o

2.2 Permission marketing


2.3 Marketing de afiliados
2.4 Viral marketing
2.5 Social marketing
3. Publicidad en lnea

D 21:
- Ejemplo de banner y pop-up

3.1 Anuncios en lnea


3.2 Video Ads

D 24:
- Ejemplo ligas de patrocinadores en un
buscador

3.3 Motores de bsqueda


3.4 e-mail marketing
4. Pasos para disear una campaa de
marketing

D 31:
- Texto en el fondo: importancia de Google, 2.
Palabras clave
D 32:
3. Genera contenido, 4. S generoso, 5. Redes
sociales, 6. Obtn su informacin, 7.
Permanece en contacto
D 33:
- 8. Mide el avance, 9. Paciencia y tenacidad

Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 245

D 34:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ2QOLQH0DUNHWLQJ(O
FRQVXPLGRU\SXEOLFLGDGHQOtQHD

,QIRUPDFLyQ*HQHUDO
+RODELHQYHQLGRDODOHFFLyQ<DTXHKHPRV
KDEODGRVREUHFyPRDSURYHFKDUODVUHGHVVRFLDOHV
FRPRSDUWHGHWXHVWUDWHJLDSXEOLFLWDULDFRQWLQXDUHPRV
FRQHOYDVWRWHPDTXHFRQVWLWX\HHORQOLQHPDUNHWLQJ
(O WHPD JHQHUDO SDUD HVWD VHVLyQ VHUi 2QOLQH
0DUNHWLQJ(OFRQVXPLGRU\SXEOLFLGDGHQOtQHD
<GHVDUUROODUHPRVORV6XEWHPDV
(OFRQVXPLGRU
7pFQLFDVGHRQOLQHPDUNHWLQJ
3XEOLFLGDGHQOtQHD
3DVRVSDUDGLVHxDUXQDFDPSDxDH[LWRVD

Interiores.indd 246

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(OREMHWLYRGHDSUHQGL]DMHHVSHUDGRHVTXHDOILQDOGHOD
VHVLyQSXHGDVH[SOLFDUHOFRQFHSWRGHRQOLQHPDUNHWLQJ
\ UHFRQRFHU HO LPSDFWR TXH WLHQHQ ODV GLYHUVDV IRUPDV
GH KDFHU SXEOLFLGDG HQ OtQHD FRQ HO ILQ GH XWLOL]DUODV
FRPRHVWUDWHJLD
&RPR \D KHPRV YLVWR HO ,QWHUQHW KD UHYROXFLRQDGR OD
PDQHUD GH KDFHU QHJRFLR FDPELDQGR D ODV GLIHUHQWHV
LQGXVWULDVLQWHUQD\H[WHUQDPHQWH
8QD GH ODV iUHDV TXH PiV KD VLGR LPSDFWDGD SRU OD
OOHJDGD\HOFUHFLPLHQWRGHO,QWHUQHWHV0DUNHWLQJ

,QWURGXFFLyQ
$GHPiV GH FUHDU QXHYRV FDQDOHV GH
FRPXQLFDFLyQ HO ,QWHUQHW WDPELpQ WLHQH OD
FDSDFLGDG GH UHFROHFWDU UHFROHFWDU HQ VHJXQGRV
LQIRUPDFLyQUHOHYDQWHVREUHODVFDUDFWHUtVWLFDVORV
JXVWRV \ ODV SUHIHUHQFLDV GHO FRQVXPLGRU XQD
KHUUDPLHQWDPX\SRGHURVDSDUDORVLQWHUHVDGRVHQ
HOWHPDGHPDUNHWLQJ
$QWHV GH HPSH]DU D YHQGHU HQ OtQHD SUHJ~QWDWH
TXLpQHVHVWiQHQOtQHD"FyPRVHFRPSRUWDQ
HVWDVSHUVRQDVDOTXHUHUFRPSUDUHQOtQHD"

Interiores.indd 247

5/9/13 6:29 PM

(OFRQVXPLGRU
(O FRQRFHU HO SHUILO GH ORV XVXDULRV GH ,QWHUQHW HV
LQGLVSHQVDEOH SDUD WHQHU p[LWR HQ HFRPPHUFH
$GHPiVFRQRFHUORVSHUPLWLUiDWXQHJRFLRHQIRFDU
VXVFDPSDxDVGHPDUNHWLQJDOS~EOLFRLQGLFDGR
(Q0p[LFRHOQ~PHURGHXVXDULRVGH,QWHUQHWVLJXH
FUHFLHQGR DxR FRQ DxR (Q  OOHJDPRV D 
PLOORQHVGHLQWHUQDXWDV

(OFRQVXPLGRU
(QJHQHUDOXQQ~PHURVLPLODUGHKRPEUHV\PXMHUHV
VH HQFXHQWUDQ HQ OtQHD /D PD\RUtD GH ORV XVXDULRV
HVWiQHQWUHORV\DxRVGHHGDGUHSUHVHQWDQGR
HOGHODSREODFLyQTXHXWLOL]D,QWHUQHWVHJXLGRV
FRQMyYHQHVHQWUH\DxRVFRQHO
$Vt FRPR DXPHQWD HO Q~PHUR GH LQWHUQDXWDV
WDPELpQKDDXPHQWDGRHOWLHPSRTXHpVWRVSDVDQHQ
OtQHD (Q  PHQFLRQDURQ SDVDU  KRUDV \ 
PLQXWRV DO GtD FRQHFWDGRV  PLQXWRV PiV TXH


Interiores.indd 248

5/9/13 6:29 PM

(OFRQVXPLGRU
4XpKDFHQHVWRVXVXDULRVDOHVWDUHQOtQHD"
9HDPRV ODV SULQFLSDOHV DFWLYLGDGHV TXH UHDOL]DQ
RQOLQH

(OFRQVXPLGRU
5HVDOWDQGR TXH FRPSUDV HQ OtQHD UHSUHVHQWD HO 
GHODVDFWLYLGDGHVRQOLQH\TXHHOGHORVXVXDULRV
GH,QWHUQHWKDQFRPSUDGRDOJ~QSURGXFWRRVHUYLFLRHQ
OtQHD HV LPSRUWDQWH FRQRFHU ODV SULQFLSDOHV UD]RQHV
SRU ODV TXH HOLJHQ HVWH PHGLR SDUD UHDOL]DU VXV
FRPSUDV(QWUHHOODVVHHQFXHQWUDQTXHHVXQVHUYLFLR
GLVSRQLEOH ODV  KRUDV HV IiFLO FRPSDUDU SUHFLRV \
KD\ RIHUWDV GH HQYtR JUDWLV 3LHQVD4Xp
LPSOLFDFLRQHV WLHQHQ HVWDV PRWLYDFLRQHV SDUD WX
HVWUDWHJLDSXEOLFLWDULDRQOLQH"

Interiores.indd 249

5/9/13 6:29 PM

(OFRQVXPLGRU
&RPRPHQFLRQDPRVHQODOHFFLyQHOHFRPPHUFH
HQ 0p[LFR KD GHMDGR GH VHU XQ PHUFDGR GH QLFKR
6LQ HPEDUJR VH SXHGHQ UHVDOWDU ORV SULQFLSDOHV
SURGXFWRV \ VHUYLFLRV TXH ORV PH[LFDQRV EXVFDQ \
FRPSUDQ HQ OtQHD %ROHWRV GH DYLyQ R FDPLyQ
5HVHUYDFLRQHV GH KRWHO 0~VLFD SHOtFXODV %ROHWRV
GH HVSHFWiFXORV /LEURV UHYLVWDV \ &RPSXWDGRUDV
&RQIRUPHKDLGRDXPHQWDQGRODRIHUWD\ODGHPDQGD
ORV VHJPHQWRV IDYRUHFLGRV SRU HO HFRPPHUFH KDQ
LGRDXPHQWDQGR

(OFRQVXPLGRU
$SHVDUGHTXHFDGDYH]PiVSHUVRQDVVHXQHQD
ORV FRQVXPLGRUHV HQ OtQHD D~Q H[LVWHQ DOJXQDV
UHVHUYDV DO SDUWLFLSDU HQ HVWH PHUFDGR 9HDPRV
DOJXQDVGHODVUD]RQHVSRUODVFXDOHVXVXDULRVQR
UHDOL]DQVXFRPSUDHQOtQHD

Interiores.indd 250

5/9/13 6:29 PM

(OFRQVXPLGRU
(O FRQRFHU \ DWHQGHU HVWDV SUHRFXSDFLRQHV GHO
FRQVXPLGRUD\XGDUiDKDFHUXQODGRHVWDVEDUUHUDV
$O FRPSUDU HQ OtQHD HO FRQVXPLGRU TXLHUH RIHUWDV
FRQYHQLHQFLD \ HQWUHJD UiSLGD $ OD YH] WLHQHQ TXH
FRQILDU HQ HO FRPHUFLDQWH DQWHV GH KDFHU OD FRPSUD
3DUDHVWRGHEHVHQIRFDUWHHQHVWDEOHFHUUHODFLRQHVGH
FRQILDQ]D FRQ WXV FOLHQWHV VLHQGR KRQHVWR MXVWR \
HQWUHJDQGRSURGXFWRVGHFDOLGDG

(OFRQVXPLGRU
8QD IRUPD VHQFLOOD GH JHQHUDU HVWD FRQILDQ]D HV
SHUPLWLU D FRPSUDGRUHV HYDOXDU WXV SURGXFWRV \
WHQHU HVWD LQIRUPDFLyQ DELHUWD SDUD FOLHQWHV
LQWHUHVDGRVHQWXVSURGXFWRV
7DPELpQ HV LPSRUWDQWH RIUHFHU LQIRUPDFLyQ GH
FRQWDFWR\VHUPX\FODURVREUHHOXVRTXHGDUiVD
ORVGDWRVSHUVRQDOHVTXHUHFROHFWHV

Interiores.indd 251

5/9/13 6:29 PM

7pFQLFDVGHPDUNHWLQJ
8QD YH] TXH WLHQHV LGHD TXLpQHV VRQ WXV FOLHQWHV
SRWHQFLDOHV SRGUiV VHOHFFLRQDU ODV HVWUDWHJLDV GH
PDUNHWLQJ PiV DGHFXDGDV SDUD HVWDEOHFHU UHODFLRQHV
FRQ pVWRV FRQVXPLGRUHV \ PRWLYDUORV D DGTXLULU WXV
SURGXFWRVRVHUYLFLRV
$ FRQWLQXDFLyQ KDEODUHPRV VREUH DOJXQDV HVWUDWHJLDV
FRQFUHWDV GH PDUNHWLQJ HQ OtQHD TXH FRPR YHUiV
WLHQHQ WDQWR VLPLOLWXGHV FRPR GLIHUHQFLDV FRQ HO
PDUNHWLQJ WUDGLFLRQDO \ VRQ XQD EXHQD WpFQLFD SDUD
REWHQHUWUiILFRHQWXVLWLRZHE\UHDOL]DUYHQWDV

1HWZRUNPDUNHWLQJ
'HELGR DO VLQ ILQ GH VLWLRV \ SiJLQDV ZHE TXH
RIUHFHQ HVSDFLR SXEOLFLWDULR VH FUHDURQ ODV UHGHV
GH SXEOLFLGDG LQWHUPHGLDULRV TXH VH HQFDUJDQ GH
YHQGHUHVSDFLRVSXEOLFLWDULRVHQOtQHDDHPSUHVDV
TXHEXVFDQOOHJDUDORVLQWHUQDXWDV
(VWDVUHGHVWLHQHQXQDOLVWDGHVLWLRVSDUWLFLSDQWHV
TXH TXLHUHQ PRVWUDU DQXQFLRV \ REWHQHU XQD
UHWULEXFLyQSRUHVWHHVSDFLR

Interiores.indd 252

5/9/13 6:29 PM

1HWZRUNPDUNHWLQJ
J
/DV UHGHV SXEOLFLWDULDV QR VROR HQFXHQWUDQ D TXLpQ
YHQGHU HO HVSDFLR VLQR WDPELpQ VH HQFDUJDQ GH
UHXQLU OD LQIRUPDFLyQ GH ORV XVXDULRV \ FyPR VH
FRPSRUWDQ HQ ORV GLIHUHQWHV VLWLRV TXH IRUPDQ SDUWH
GH OD UHG SDUD GHFLGLU EDViQGRVH HQ HVWD
LQIRUPDFLyQ TXp DQXQFLRV GHVSOHJDU DO FLEHUQDXWD
3RUHMHPSORVXSRQJDPRVTXHGHVSHJDUFRPJRRJOH
\ \DKRR IRUPDQ SDUWH GH XQD UHG GH SXEOLFLGDG 7~
HQWUDVDGHVSHJDUFRP\EXVFDVXQYXHORD&DQF~Q
'HVSXpV HQ JRRJOH KDFHV XQD E~VTXHGD VREUH
UHVWDXUDQWHV HQ HVWD PLVPD FLXGDG $O HQWUDU D
\DKRRFRP SRGUtDQ DSDUHFHU DQXQFLRV GH WUDMHV GH
EDxR

1HWZRUNPDUNHWLQJ
0iVDOOiGHHVWDVUHGHVVHFUHDURQORVDGH[FKDQJHV
R EROVDV SXEOLFLWDULDV TXH DJUXSDQ YDULDV UHGHV
SXEOLFLWDULDV \ HQ ORV TXH ORV DQXQFLDQWHV SXMDQ SRU
HVSDFLRV SXEOLFLWDULRV EDVDGRV HQ FULWHULRV GH
PDUNHWLQJ 8Q HMHPSOR UHFRQRFLGR HV *RRJOH
'RXEOH&OLFN$G([FKDQJH
3HUPLVVLRQ PDUNHWLQJ R PDUNHWLQJ GH SHUPLVR VH
UHILHUH D OD HVWUDWHJLD GH REWHQHU HO SHUPLVR GHO
FRQVXPLGRU DQWHV GH HQYLDUOH LQIRUPDFLyQ
SURPRFLRQDO

Interiores.indd 253

5/9/13 6:29 PM

3HUPLVVLRQPDUNHWLQJ
(VWDWHRUtDGHVDUUROODGDSRU6HWK*RGLQVRVWLHQH
TXH DO REWHQHU HO SHUPLVR GLUHFWR GHO FRQVXPLGRU
OD HPSUHVD SXHGH HVWDEOHFHU XQD UHODFLyQ FRQ HO
FOLHQWHPiVIiFLOPHQWH
&XDQGR XQ FRQVXPLGRU GHFLGH UHFLELU PHQVDMHV
SURPRFLRQDOHV VH OH OODPD RSWLQJ LQ PLHQWUDV
TXHFXDQGRGHFLGHQRTXHUHUUHFLELUORVVHOHOODPD
RSWRXW(OGDUODRSFLyQGHRSWLQXRSWRXWHV
XQD SDUWH LPSRUWDQWH GHO HPDLO PDUNHWLQJ TXH
YHUHPRVPiVDGHODQWH

0DUNHWLQJGHDILOLDGRV
2WUD WpFQLFD UHFRQRFLGD GH PDUNHWLQJ RQOLQH HV HO
PDUNHWLQJ GH DILOLDGRV \ IXQFLRQD GH PDQHUD
VLPLODUDODVUHIHUHQFLDVGDGDVHQHOPXQGRRIIOLQH
(QHOHVTXHPDYLUWXDOXQVLWLRZHESDJDDRWURVLWLR
XQD FRPLVLyQ SRU QXHYRV FOLHQWHV TXH UHILHUH DO
VLWLR
(ODILOLDGRDJUHJDHQVXVLWLRXQDOLJDTXHOOHYDDOD
SiJLQD \ VH RIUHFH XQD FRPLVLyQ EDVDGD HQ ODV
YHQWDVJHQHUDGDVQXHYRVUHJLVWURVXQDFXRWDILMD
RXQDFRPELQDFLyQGHpVWDV

Interiores.indd 254

5/9/13 6:29 PM

0DUNHWLQJGHDILOLDGRV
eVWD WpFQLFD IXQFLRQD PHMRU FXDQGR H[LVWH XQD
UHODFLyQ FRPSOHPHQWDULD HQWUH ORV SURGXFWRV \
VHUYLFLRVRIUHFLGRVHQDPERVVLWLRV*URXSRQHVXQ
HMHPSOR GH XQ VLWLR TXH RIUHFH XQ SURJUDPD GH
DILOLDGRV D WUDYpV GH XQD UHFRQRFLGD UHG GH
DILOLDGRV&RPPLVVLRQ-XQFWLRQ
2WUD WpFQLFD TXH KD VXUJLGR JUDFLDV DO GHVDUUROOR
GHO :HE  HV HO PDUNHWLQJ YLUDO (VWDV
FDPSDxDVWDPELpQIXQFLRQDQEDMRHOHVTXHPDGH
UHIHUHQFLDV SHUR VRQ ORV PLVPRV FRQVXPLGRUHV
TXLHQHVVHHQFDUJDQGHKDFHUODVUHIHUHQFLDV

8Q HMHPSOR GH HVWR VRQ ODV SURPRFLRQHV HQ ODV TXH
HOFOLHQWHGDGHDOWDHOQRPEUH\FRUUHRHOHFWUyQLFRGH
XQ DPLJR \ FXDQGR HO DPLJR UHIHULGR UHDOL]D VX
SULPHUDFRPSUDUHFLEHXQFXSyQGHGHVFXHQWR+DV
HVWDGRHQHVDVLWXDFLyQ"
2WURHMHPSORVRQODVFDPSDxDVSXEOLFLWDULDVODQ]DGDV
HQ<RXWXEHTXHFRQSRFDLQYHUVLyQ\PXFKRLQJHQLR
ORJUDQPLOORQHVGHYLVLWDVFRPRORIXHODFDPSDxDGH
%OHQGWHF :LOO LW EOHQG" HQ HO TXH XWLOL]DEDQ XQD GH
VXV OLFXDGRUDV SDUD OLFXDU DSDUDWRV HOHFWUyQLFRV
FRGLFLDGRVFRPRHOLSKRQH
1R OR YLVWH" 3XHGHV YHUOR HQ OD SiJLQD ZHE TXH
HVWiDSDUHFLHQGRHQHOIRQGRGHSDQWDOOD
KWWSZZZ\RXWXEHFRPZDWFK"Y URIJ0XH&2TR

Interiores.indd 255

5/9/13 6:29 PM

6RFLDOPDUNHWLQJ
<DKDEODPRVHQODOHFFLyQDQWHULRUVREUHFyPRODV
UHGHV VRFLDOHV SXHGHQ XWLOL]DUVH HQ WX FDPSDxD
GHPDUNHWLQJ
(O XWLOL]DU VRFLDO PDUNHWLQJ HV RWUD GH ODV WpFQLFDV
TXH KD LQWURGXFLGR HO ,QWHUQHW DO DPELHQWH
SXEOLFLWDULR\HVXQDGHODVHVWUDWHJLDVFRQPD\RU
FUHFLPLHQWR HQ ORV ~OWLPRV DxRV FRQ HO  GHO
PHUFDGRGHRQOLQHPDUNHWLQJHQ(VWDGRV8QLGRV

6RFLDOPDUNHWLQJ
2WUD WpFQLFD GH PDUNHWLQJ LQWURGXFLGD SRU ODV
QXHYDV 7,&V HV HO PDUNHWLQJ PyYLO \ YHUHPRV
HVWHWHPDFRQPD\RUGHWDOOHHQODOHFFLyQ
$KRUDYHDPRVDOJXQDVIRUPDVFRQFUHWDVGHKDFHU
SXEOLFLGDGHQOtQHD
&XiO FUHHV TXH HV OD PHMRU PDQHUD GH DWUDHU
SRVLEOHVFOLHQWHVDWXVLWLRZHE\ORJUDUTXHKDJDQ
FRPSUD"&XiOHVVRQODVQXHYDVRSRUWXQLGDGHV
GHSXEOLFLGDGLQWURGXFLGDVSRUHO,QWHUQHW"

Interiores.indd 256

5/9/13 6:29 PM

3XEOLFLGDGHQOtQHD
8QD EXHQD FDPSDxD SXEOLFLWDULD GHEH WHQHU GRV
REMHWLYRV
D3RVLFLRQDUXQDPDUFD
E,QFUHPHQWDUODVYHQWDV
$ FRQWLQXDFLyQ KDEODUHPRV VREUH KHUUDPLHQWDV SDUD
ORJUDUXQDFDPSDxDSXEOLFLWDULDH[LWRVDHQWUHODVTXH
VHHQFXHQWUDQDQXQFLRVHQOtQHDHPDLOPDUNHWLQJ\
VHJPHQWDFLyQ
SRU
FRPSRUWDPLHQWR

$QXQFLRVHQOtQHD
/D SXEOLFLGDG R DQXQFLRV HQ OtQHD VH UHILHUH D
FXDOTXLHU PHQVDMH SDJDGR HQ XQ VLWLR :HE X RWUR
PHGLRLQWHUDFWLYR
)RUPDWRV WUDGLFLRQDOHV GH SXEOLFLGDG HQ OtQHD
VRQ HO EDQQHU \ HO SRSXS (O EDQQHU HV PX\
VLPLODU D XQ DQXQFLR LPSUHVR XQ HVSDFLR
UHFWDQJXODU HQ OD SDUWH VXSHULRU R LQIHULRU GH OD
SiJLQD FRQ OD YHQWDMD TXH DO KDFHU FOLFN HQ pO
OOHYDDODSiJLQDZHEGHODQXQFLDQWH

Interiores.indd 257

5/9/13 6:29 PM

$QXQFLRVHQOtQHD
(VWRV EDQQHUV SXHGHQ FRQWHQHU YLGHRV
DQLPDFLRQHVRWH[WRVLPSOH3RUVXSDUWHORVSRS
XSV VRQ EDQQHUV R ERWRQHV TXH DSDUHFHQ HQ OD
SDQWDOODVLQTXHHOXVXDULRORVVROLFLWH(QJHQHUDO
ORVSRSXSVKDQVLGRHYDOXDGRVSRUXVXDULRVFRPR
PROHVWRV \ DOJXQRV QDYHJDGRUHV KDQ LQVWDODGR
RSFLRQHVTXHSHUPLWHQDORVXVXDULRVEORTXHDUORV

9LGHR$GV
8QD GH ODV IRUPDV GH SXEOLFLGDG HQ OtQHD FRQ
PD\RU FUHFLPLHQWR VRQ ORV YLGHRV SXEOLFLWDULRV
6LPLODUHV D ORV DQXQFLRV GH WHOHYLVLyQ DSDUHFHQ
FRPR SDUWH GH XQD SiJLQD (Q (VWDGRV 8QLGRV HO
JDVWRHQHVWDIRUPDGHSXEOLFLGDGDVFHQGLyD
PLOPLOORQHVGHGyODUHV\FHUFDGHPLOORQHVGH
XVXDULRV YLHURQ YLGHRV HQ OtQHD GXUDQWH -XOLR GHO
 VXPDQGR XQ SURPHGLR GH  KRUDV GH
YLGHR DO PHV \ VLHQGR <RXWXEH HO VLWLR GH YLGHRV
PiVSRSXODU
&yPR FUHHV TXH VH SXHGD DSURYHFKDU HVWD
KHUUDPLHQWDSDUDKDFHUSXEOLFLGDG"

Interiores.indd 258

5/9/13 6:29 PM

9LGHR$GV
8QD RSFLyQ HV FUHDU WX SURSLR VLWLR GH YLGHRV SDUD
SURPRFLRQDUWXVSURGXFWRVRDEULUXQFDQDOHQ<RXWXEH
H[FOXVLYRSDUDWXPDUFD
8QD GH ODV HVWUDWHJLDV GH SXEOLFLGDG FRQ PD\RU p[LWR
KD VLGR LQWURGXFLU DQXQFLRV HQ ORV PRWRUHV GH
E~VTXHGD &RPR PHQFLRQDPRV DO LQLFLR GH HVWD
OHFFLyQ OD PD\RUtD GH ORV FLEHUQDXWDV VH FRQHFWDQ D
,QWHUQHW SDUD KDFHU XQD E~VTXHGD \ ORV DQXQFLRV TXH
DSDUHFHUiQ HVWDUiQ UHODFLRQDGRV FRQ OR TXH HVWi
EXVFDQGRHOXVXDULR(VWHWLSRGHSXEOLFLGDGVHSXHGH
GLYLGLU HQ WUHV FDWHJRUtDV SDJDU SRU LQFOXVLyQ
SXEOLFLGDGSRUSDODEUDVFODYH\SXEOLFLGDGSRUFRQWH[WR
RUHGHV9HDPRVFDGDXQD

0RWRUHVGHE~VTXHGD
3DJDUSRULQFOXVLyQ+DVQRWDGRTXHDOKDFHUXQD
E~VTXHGDDSDUHFHQDQXQFLRVGHSDWURFLQDGRUHVHQ
ODSiJLQDGHUHVXOWDGRV"
&RPR \D KHPRV PHQFLRQDGR ORV PRWRUHV GH
E~VTXHGD WLHQHQ XQ DOJRULWPR TXH GHWHUPLQD OD
LQFOXVLyQ \ UDQNLQJ GH ODV SiJLQDV HQ VXV UHVXOWDGRV
GH E~VTXHGD /D PD\RUtD GH HOORV RIUHFHQ OLJDV GH
SDWURFLQDGRUHV R OD RSFLyQ GH VHU LQFOXLGR HQ ORV
UHVXOWDGRV GH E~VTXHGD SRU XQD FXRWD %XVFDGRUHV
FRPR *RRJOH LQFOX\HQ XQD VHFFLyQ GH OLJDV GH
SDWURFLQDGRUHV HQ OD SDUWH VXSHULRU GH OD OLVWD GH
UHVXOWDGRV

Interiores.indd 259

5/9/13 6:29 PM

0RWRUHVGHE~VTXHGD
3DODEUDV&ODYH
2WUD RSFLyQ SDUD FRPSUDU HVSDFLR SXEOLFLWDULR HQ
PRWRUHVGHE~VTXHGDHVXWLOL]DUORVSURJUDPDVGH
SDODEUDV FODYH (Q HVWRV ORV FRPHUFLDQWHV SXMDQ
SRU DSDUHFHU FRPR DQXQFLDQWH FXDQGR XQ SRVLEOH
FOLHQWH KDFH XQD E~VTXHGD GH XQD SDODEUD
GHWHUPLQDGD (O DQXQFLR DSDUHFHUi HQ OD SiJLQD
GH UHVXOWDGRV GH E~VTXHGD (MHPSORV GH HVWRV
SURJUDPDV VRQ *RRJOH $G:RUGV <DKRR
V
6SRQVRUHG6HDUFK\0LFURVRIW
VDG&HQWHU

0RWRUHVGHE~VTXHGD
3XEOLFLGDGSRUFRQWH[WRVRUHGHV
8QD WHUFHUD HVWUDWHJLD XWLOL]DQGR ORV PRWRUHV GH
E~VTXHGD VRQ ODV UHGHV GH SXEOLFLGDG XWLOL]DQGR
SDODEUDV FODYH <D KDEtDPRV KDEODGR VREUH FyPR
IXQFLRQDQ HVWDV UHGHV PRVWUDQGR DO XVXDULR
DQXQFLRV UHODFLRQDGRV D VXV E~VTXHGDV 3RU HVWR
D HVWD HVWUDWHJLD WDPELpQ VH OH FRQRFH FRPR
SXEOLFLGDG SRU FRQWH[WR HO PRWRU GH E~VTXHGD
VH DVHJXUD D WUDYpV GHO DQiOLVLV GH SDODEUDV FODYH
TXH VRODPHQWH DSDUH]FDQ DQXQFLRV UHOHYDQWHV \
DSURSLDGRVDORVLQWHUHVHVGHOLQWHUQDXWD

Interiores.indd 260

5/9/13 6:29 PM

0RWRUHVGHE~VTXHGD
$O XQLU D ORV DQXQFLDQWHV \ HVSDFLRV SXEOLFLWDULRV
HQ XQD UHG HO DQXQFLR DSDUHFHUi GHQWUR GH OD
SiJLQD ZHE TXH RIUHFLy HVSDFLR SXEOLFLWDULR \ QR
HQ OD SiJLQD GH UHVXOWDGRV GH E~VTXHGD *RRJOH
OODPD D HVWH VHUYLFLR $G6HQVH PLHQWUDV TXH HO
SURJUDPD GH <DKRR OOHYD HO QRPEUH GH &RQWHQW
0DWFK

0RWRUHVGHE~VTXHGD
(OXWLOL]DUFXDOTXLHUDGHODVHVWUDWHJLDVGHPDUNHWLQJ
TXH RIUHFHQ ORV PRWRUHV GH E~VTXHGD WH SHUPLWH
DSDUHFHUFRPRXQDRSFLyQSDUDSHUVRQDVTXHHVWiQ
EXVFDQGR HVR TXH W~ RIUHFHV HQ HO PRPHQWR
SUHFLVR 8WLOL]DQGR EiVLFDPHQWH VyOR ODV SDODEUDV
FODYH HO EXVFDGRU GHWHUPLQD ORV DQXQFLRV TXH
RIUHFHQHVRTXHHOFRQVXPLGRUHVWiEXVFDQGR
3LHQVD FXiQWR HVWDUtDV GLVSXHVWR D SDJDU SRU
OOHJDU DO FOLHQWH EXVFDQGR WX SURGXFWR R
VHUYLFLR" 4Xp PRVWUDUtDV SDUD OODPDU VX
DWHQFLyQ"

Interiores.indd 261

5/9/13 6:29 PM

HPDLOPDUNHWLQJ
2WUD HVWUDWHJLD SXEOLFLWDULD HQ OtQHD FRP~Q HV HO
HPDLO PDUNHWLQJ TXH FRPR VX QRPEUH OR LQGLFD
FRQVLVWHHQHQYLDUFRUUHRVHOHFWUyQLFRVDFOLHQWHVR
FOLHQWHV SRWHQFLDOHV FRQ LQIRUPDFLyQ RIHUWDV \
QRYHGDGHV
(VWD RSFLyQ SXHGH UHVXOWDU DWUDFWLYD SRUTXH HV
UHODWLYDPHQWH EDUDWR HQYLDU FRUUHRV DVt VH
PDQGHQRPLOORQHV

HPDLOPDUNHWLQJ
/R TXH JHQHUD XQ JDVWR HV HO REWHQHU OD OLVWD GH
FRUUHRV GH SRVLEOHV FOLHQWHV TXH SXHGHQ LU GH
HQWUH  FHQWDYRV D  SHVRV SRU QRPEUH
GHSHQGLHQGR GH TXp WDQ GHOLPLWDGR HVWp HO SHUILO
GHORVXVXDULRVHQODOLVWD
&DEH UHVDOWDU TXH HVWXGLRV KDQ FRPSUREDGR TXH
ODVFDPSDxDVGHHPDLOPDUNHWLQJVRQPXFKRPiV
HILFLHQWHV FXDQGR OD OLVWD HV GHVDUUROODGD
LQWHUQDPHQWH\QRFRPSUDGDDWHUFHURV

Interiores.indd 262

5/9/13 6:29 PM

HPDLOPDUNHWLQJ
'HQWUR GH HVWH PLVPR WHPD ODV FDPSDxDV GH
PDUNHWLQJ UHVXOWDQ PXFKR PiV HIHFWLYDV FXDQGR
TXLHQ UHFLEH HO FRUUHR SXEOLFLWDULR RSWy SRU
SHUWHQHFHUDODOLVWDGHFRUUHRVGHOQHJRFLR
$ OD PLVPD YH] VRQ PHMRU HVWUDWHJLD SDUD
PDQWHQHU FRQWDFWR FRQ FOLHQWHV HVWDEOHFLGRV TXH
SDUDREWHQHUQXHYRVFOLHQWHV

HPDLOPDUNHWLQJ
/DJUDQFDQWLGDGGH6SDPHQYLDGRGLDULDPHQWHKD
REVWDFXOL]DGR HO FUHFLPLHQWR GHO HPDLO PDUNHWLQJ
8VXDULRV WLHQHQ WHPRU D GDU FOLFN D XQD OLJD TXH
SURYHQJD GH XQ VSDPPHU \ VL QR UHFRQRFHQ DO
HPLVRU GHO PHQVDMH SUREDEOHPHQWH ERUUDUiQ HO
FRUUHR HOHFWUyQLFR VLQ DEULUOR 3RU HVWR HV
LPSRUWDQWH UHGDFWDU DGHFXDGDPHQWH HO DVXQWR
GHOFRUUHR
&RPR VH PHQFLRQy DQWHULRUPHQWH HV LPSRUWDQWH
LQFOXLU HQ ORV FRUUHRV TXH HQYtHV D WX OLVWD GH
FOLHQWHVODVLQVWUXFFLRQHVSDUDERUUDUVXFRUUHRGH
ODOLVWDHQFDVRTXHQRGHVHHUHFLELUWXVFRUUHRV

Interiores.indd 263

5/9/13 6:29 PM

HPDLOPDUNHWLQJ
(Q FXDQWR DO FRQWHQLGR GHO FRUUHR HV
UHFRPHQGDEOH HQ RFDVLRQHV LQFOXLU YLGHRV
LQWHUDFWLYRVOLJDVDWXVFXHQWDVHQUHGHVVRFLDOHV\
SURPRFLRQHV R FXSRQHV SDUD PRWLYDUORV D DEULU
FRUUHRVFRQVHFXHQWHV(QODOHFFLyQKDEODUHPRV
VREUH ODV HVWUDWHJLDV GH PDUNHWLQJ PyYLO SHUR HO
DGHFXDU HO FRQWHQLGR GHO FRUUHR SDUD VHU
FRPSDWLEOH FRQ GLVSRVLWLYRV PyYLOHV HV
LQGLVSHQVDEOH
7H SUHJXQWDUiV FyPR GLVHxR XQD FDPSDxD GH
PDUNHWLQJHQOtQHD"

3DVRVSDUDGLVHxDUXQDFDPSDxD
GHPDUNHWLQJ
$FRQWLQXDFLyQDOJXQDVUHFRPHQGDFLRQHVGH3HWHU
5DVWHOORIXQGDGRUGH,QERXQG0DUNHW/LQNDJHQFLD
HVSHFLDOL]DGDHQD\XGDUD3\PHV%%\%&WHQHU
p[LWRHQ,QWHUQHW
 /D LPSRUWDQFLD GH *RRJOH HQIRFD WXV
HVIXHU]RVSRUDSDUHFHUHQORVSULPHURVOXJDUHVGH
ORV UHVXOWDGRV GH E~VTXHGD GH HVWH PRWRU \D TXH
HOGHWRGDVODVE~VTXHGDVVRQDWUDYpVGHpO
GHDKtSDVDD<DKRR\%LQJ

Interiores.indd 264

5/9/13 6:29 PM

3DVRVSDUDGLVHxDUXQDFDPSDxD
GHPDUNHWLQJ
 3DODEUDV FODYH HOLJH SDODEUDV TXH VHDQ
UHOHYDQWHV SDUD WX QHJRFLR SHUR TXH WDPELpQ WH
SRVLFLRQHQHQORVSULPHURVOXJDUHVIiFLOPHQWH
*HQHUDFRQWHQLGRSRVLEOHVFOLHQWHVFRPSUDUiQVL
WH YHQ FRPR XQ OtGHU HQ HO VHJPHQWR SRVLFLyQDWH
FRPRXQRFUHDQGRFRQWHQLGRLQIRUPDWLYR\~WLO4XHWX
VLWLR VHD XQR GRQGH FRQVXPLGRUHV HQFXHQWUHQ
UHVSXHVWDV
6pJHQHURVRORVFRQVXPLGRUHVWDPELpQLUiQDWLVL
SURSRUFLRQDV LQIRUPDFLyQ \ KHUUDPLHQWDV ~WLOHV \
JUDWXLWDV

3DVRVSDUDGLVHxDUXQDFDPSDxD
GHPDUNHWLQJ
 5HGHV VRFLDOHV $QDOL]D HQ TXp  UHGHV VH
HQFXHQWUDQ WXV FOLHQWHV SRWHQFLDOHV \ HQIyFDWH HQ
HOODV
 2EWpQ VX LQIRUPDFLyQ RIUHFH DOJ~Q VHUYLFLR
JUDWXLWR SDUD TXH FRQVXPLGRUHV HVWpQ GLVSXHVWRV D
SURSRUFLRQDUWHVXLQIRUPDFLyQGHFRQWDFWRODVYHQWDV
YHQGUiQGHVSXpV
 3HUPDQHFH HQ FRQWDFWR XQD YH] TXH WH GDQ VX
LQIRUPDFLyQ HQYtD XQ FRUUHR GDQGR JUDFLDV \
RIUHFLHQGR DOJ~Q FXSyQ PDQWHQWH HQ FRQWDFWR FRQ
ORVFRQVXPLGRUHV

Interiores.indd 265

5/9/13 6:29 PM

3DVRVSDUDGLVHxDUXQDFDPSDxD
GHPDUNHWLQJ
 0LGH HO DYDQFH 1R WHQJDV PLHGR D IDVHV GH
SUXHED \ HUURU FRQ ODV KHUUDPLHQWDV GLVSRQLEOHV
SDUDDQDOL]DUODLQIRUPDFLyQSRGUiVGHWHUPLQDUTXp
IXQFLRQD\TXpQR\SHUIHFFLRQDUWXHVWUDWHJLD
3DFLHQFLD\WHQDFLGDG3LHQVDHQHVWUDWHJLDVD
ODUJR SOD]R VLQ HVSHUDU XQ JLUR GH  JUDGRV
LQPHGLDWR
1R ROYLGHV OR LPSRUWDQWH TXH HV FRQRFHU D WXV
FOLHQWHV\KDFHUWRGRHQWRUQRDHOORV

&LHUUH
7RPDUHQFXHQWDHVWDV~OWLPDVUHFRPHQGDFLRQHVWH
SHUPLWLUi HQIRFDU WX FDPSDxD GH RQOLQH PDUNHWLQJ \
DSURYHFKDUODVERQGDGHVGHO,QWHUQHWSDUDGLULJLUWHD
WXVFOLHQWHV\DXPHQWDUWXVYHQWDV
5HFXHUGDTXHHVLPSRUWDQWHFRQRFHUDWXVFOLHQWHV
\ SHQVDU TXp KDFHQ FXDQGR HVWiQ HQ OtQHD SDUD
VDEHUODPHMRUPDQHUDGHOOHJDUDHOORV\VHOHFFLRQDU
ODV WpFQLFDV GH PDUNHWLQJ \ RSFLRQHV GH SXEOLFLGDG
HQ OtQHD GLVSRQLEOHV GH DFXHUGR D HVWR \ D ORV
REMHWLYRVGHWXHPSUHVD
<D HVWDPRV FRQFOX\HQGR OD SUy[LPD OHFFLyQ
FRQWLQXDUHPRV FRQ HVWH DPSOLR WHPD TXH HV HO
PDUNHWLQJRQOLQH+DVWDODVLJXLHQWHVHVLyQ

Interiores.indd 266

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 11: Online Marketing
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 11 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Cmo definiras el Online Marketing?

2. Qu ventajas se derivan de la posibilidad de recolectar informacin relevante de los


consumidores?

3. Una vez que tengas claro quienes son tus ___________________ podrs acertar con
tus estrategias de Marketing Online.

4. Define Red Publicitaria en menos de un prrafo.


________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
5. En qu consisten?:
- Permission marketing:
- Email marketing:

6. Una buena campaa de publicidad en lnea debe de tener dos objetivos:


a) Posicionar la __________
b) Incrementar las __________
7. Selecciona la opcin correcta. Son mtodos de publicidad en lnea antiguos:
a) Banners y Pop- ups
b) QR Codes y APPs
c) Mails y banners

Interiores.indd 267

5/9/13 6:29 PM

8. Cmo se puede aprovechar los motores de bsqueda para hacer publicidad?

9. En esta leccin se dieron 9 tips o consejos para crear una campaa exitosa de
marketing digital . Menciona al menos 4:
a)
b)
c)
d)

10.
Mira este ejemplo de una campaa publicitaria en video lanzada por Youtube:
http://www.youtube.com/watch?v=rofgMueCOqo

Interiores.indd 268

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 12
Online Marketing 2
Duracin:

30 min

Objetivo de aprendizaje: Al finalizar esta sesin, los alumnos sern capaces de explicar el
concepto de online marketing y reconocer el impacto que tienen
las diferentes formas de hacer publicidad en lnea con el fin de
utilizarlas como estrategia.
Subtemas:

Requisitos:

Registros
Archivos de Rastreo
Perfiles
Sistemas CRM
Mtricas

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a internet
Haber completado la leccin previa

Agenda:
Contenido:
Introduccin
- Bienvenida
- Recapitualcin de la leccin previa
- Informacin general: tema, subtemas y
objetivo de aprendizaje

Interiores.indd 269

Notas de Produccin:
D 2:
- Tema, subtemas y objetivo en texto de fondo
D 3:
-Texto de fondo; Cmo saber si la inversin en e-

5/9/13 6:29 PM

- Introduccin al tema

marketing est siendo efectiva?

Desarrollo
1.Registros

Diapositiva 5:
- Texto de fondo: web analytics
D 7:
- Texto:
1 Despus de la pgina de inicio, hacia dnde se
dirigen los consumidores?
2 Cules son los intereses de los diferentes
grupos que visitan el sitio?
3 Cmo podemos simplificar el uso del sitio para
que las personas encuentren lo que buscan?
4 De dnde provienen nuestros visitantes?
5 Cmo
podemos
personalizar
nuestros
mensajes y oferta a usuarios?

2. Archivos de Rastreo

D 8:
- Archivos de rastreo: Cookies, beacons, flash
cookies y apps
D 10:
- "Perfiles"
D 11:
-Texto de fondo:
Data Mining
1. Descripcin
2. Prediccin

3. Perfiles
3.1 Data Mining

Interiores.indd 270

D 12- 13:
Texto de fondo de pantalla:
1. La deteccin de Anomalas
2. Asociacin de aprendizaje
3. Deteccin de Cluster
4. Clasificacin

5/9/13 6:29 PM

5. Regresin

4. Sistemas CRM

D 16:
- CRM: Customer Relationship Management

5. Mtricas

D 17:
- Texto: Clicks Trough Rate (CTR)
D 18:
- duracin
- visitantes nico
D 19:
- tasa de adquisicin
- tasa de conversin
- tasa de conversin del carrito de compras

Cierre
- Conclusin
- Pregunta de reflexin
- Mencin de la leccin que le precede.
- Ejercicios de Prctica

Interiores.indd 271

D 21:
- Texto de Fondo Qu estrategia utilizars para
medir el impacto de tu campaa de marketing
digital?

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ2QOLQH0DUNHWLQJ  

,QWURGXFFLyQ
+ROD GH QXHYR 6HJXLPRV FRQ HO WHPD GH 2QOLQH
0DUNHWLQJ/DOHFFLyQDQWHULRUFRQRFLPRVODVGLIHUHQWHV
IRUPDV GH KDFHU PDUNHWLQJ R SXEOLFLGDG HQ OtQHD (Q
HVWD OHFFLyQ DSUHQGHUHPRV D PHGLU HO LPSDFWR TXH
WLHQHQWXVHVWUDWHJLDVGHPDUNHWLQJ\FRQRFHUHPRVODV
PDQHUDVTXHH[LVWHQSDUDUHFDEDULQIRUPDFLyQ
(QWRQFHVHOWHPDJHQHUDOGHHVWDVHVLyQVHUi2QOLQH
0DUNHWLQJ
7HFQRORJtD
GH
PDUNHWLQJ
<
GHVDUUROODUHPRVORVVXEWHPDV
5HJLVWURV$UFKLYRVGH5DVWUHR3HUILOHV
6LVWHPDV&500pWULFDV

Interiores.indd 272

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O 2EMHWLYR GH DSUHQGL]DMH SDUD HVWD VHVLyQ UHWRPD HO
REMHWLYR GH OD OHFFLyQ SUHYLD ([SOLFDU HO FRQFHSWR GH
RQOLQHPDUNHWLQJ\UHFRQRFHUHOLPSDFWRTXHWLHQHQODV
GLIHUHQWHV IRUPDV GH KDFHU SXEOLFLGDG HQ OtQHD FRQ HO
ILQGHXWLOL]DUODVFRPRHVWUDWHJLD
6HJXUR TXH WRGRV VH SUHJXQWDQ &yPR VDEHU VL OD
LQYHUVLyQHQHPDUNHWLQJHVWiVLHQGRHIHFWLYD"
&RPRKDVSRGLGRREVHUYDUHO,QWHUQHWKDLPSDFWDGRHO
PDUNHWLQJ HQRUPHPHQWH 3ULPHUR FRPR PHGLR GH
FRPXQLFDFLyQKDDPSOLDGRODSREODFLyQTXHSXHGHVHU
DOFDQ]DGD IiFLOPHQWH VLQ LPSRUWDU GyQGH VH
HQFXHQWUHQ

,QWURGXFFLyQ
6HJXQGR KD HQULTXHFLGR OD LQIRUPDFLyQ TXH SXHGH
SUHVHQWDUVHFRPELQDQGRWH[WRFRQJUiILFRVYLGHRV\
DXGLR
(O WHUFHU SXQWR HV SUHFLVDPHQWH DO TXH QRV
UHIHUtDPRV HQ XQ LQLFLR ODV WHFQRORJtDV GH ,QWHUQHW
SHUPLWHQ REWHQHU LQIRUPDFLyQ SUHFLVD \ GHWDOODGD
VREUH ORV FRQVXPLGRUHV PLHQWUDV QDYHJDQ \ KDFHQ
WUDQVDFFLRQHVHQHOPHUFDGRYLUWXDO

Interiores.indd 273

5/9/13 6:29 PM

5HJLVWURV
(OPDUNHWLQJGLJLWDOSHUPLWHPHGLUFRQPD\RUSUHFLVLyQ
FyPRVHFRPSRUWDXQFRQVXPLGRUHQOtQHD\FRQHVWR
ORVUHVXOWDGRVTXHVHREWLHQHQGHODSXEOLFLGDGRQOLQH
\D TXH OD DQDOtWLFD ZHE ZHE DQDO\WLFV  GLIXQGH ORV
LQGLFDGRUHV \ UHVXOWDGRV GH PDQHUD UiSLGD \
DXWRPiWLFD
(ODQiOLVLVGHHVWDVHVWDGtVWLFDVWHSHUPLWLUiHYDOXDUWX
FDPSDxD GH PDUNHWLQJ RQOLQH 3RU HOOR HV LPSRUWDQWH
REVHUYDUHOFRPSRUWDPLHQWRGHOQ~PHURGHYHFHVHQ
HO TXH HO QRPEUH GH QXHVWUD PDUFD HV EXVFDGR HQ OD
UHG

5HJLVWURV
8QDSULPHUDIXHQWHGHLQIRUPDFLyQVRQORVUHJLVWURV
TXHPDQWLHQHQWRGRVORVVHUYLGRUHV:HEHQORVTXH
VHDOPDFHQDODDFWLYLGDGHQXQVLWLR:HE
(VWD LQIRUPDFLyQ VH YXHOYH D~Q PiV ~WLO FXDQGR VH
FRPELQD FRQ RWUDV IRUPDV GH UHFRSLODU LQIRUPDFLyQ
IRUPXODULRV GH UHJLVWUR \ EDVHV GH GDWRV GHO FDUULWR
GH FRPSUDV /RV IRUPXODULRV GH UHJLVWUR UH~QHQ
LQIRUPDFLyQ SHUVRQDO FRPR QRPEUH GLUHFFLyQ
WHOpIRQRFRUUHRHWF0LHQWUDVTXHODVEDVHVGHGDWRV
GHO FDUULWR GH FRPSUDV FDSWXUDQ ORV SURGXFWRV
VHOHFFLRQDGRVFRPSUDVHLQIRUPDFLyQGHSDJR

Interiores.indd 274

5/9/13 6:29 PM

/D PD\RU SDUWH GH ODV FDSDFLGDGHV GH PDUNHWLQJ


QXHYDVVHEDVDQHQHVWDVKHUUDPLHQWDVGHUHJLVWUR
(VWDV KHUUDPLHQWDV GH UHJLVWUR SXHGHQ SURYHHU
LQIRUPDFLyQFRPR
 'HVSXpV GH OD SiJLQD GH LQLFLR KDFLD GyQGH VH
GLULJHQORVFRQVXPLGRUHV"
 &XiOHVVRQORVLQWHUHVHVGHORVGLIHUHQWHVJUXSRV
TXHYLVLWDQHOVLWLR"
 &yPR SRGHPRV VLPSOLILFDU HO XVR GHO VLWLR SDUD
TXHODVSHUVRQDVHQFXHQWUHQORTXHEXVFDQ"
 'HGyQGHSURYLHQHQQXHVWURVYLVLWDQWHV"
 &yPRSRGHPRVSHUVRQDOL]DUQXHVWURVPHQVDMHV\
RIHUWDDXVXDULRV"

$UFKLYRVGHUDVWUHR
(V PX\ LPSRUWDQWH UHFRSLODU OD LQIRUPDFLyQ
QHFHVDULD
VREUH
WXV
YLVLWDQWHV
\
VX
FRPSRUWDPLHQWR3HURWDPELpQHVQHFHVDULRGHILQLU
GH DQWHPDQR TXp LQIRUPDFLyQ VH TXLHUH REWHQHU \
FyPR VH YD D XWLOL]DU SDUD QR VDWXUDUVH GH
LQIRUPDFLyQLQQHFHVDULD
9HDPRV DOJXQDV GH ODV KHUUDPLHQWDV WHFQROyJLFDV
TXHSXHGHQD\XGDUWH

Interiores.indd 275

5/9/13 6:29 PM

$UFKLYRVGHUDVWUHR
8QD SULPHUD KHUUDPLHQWD VRQ ORV DUFKLYRV GH
UDVWUHR FRRNLHV EHDFRQV )ODVK FRRNLHV \ DSSV
(VWRV DUFKLYRV VLJXHQ D ORV XVXDULRV SRU WRGD OD
:HE UHJLVWUDQGR ODV YLVLWDV TXH KDFHQ D RWURV
VLWLRV/DVFRRNLHVVRQDUFKLYRVTXHVHLQVWDODQHQ
HO GLVFR GXUR GHO XVXDULR FXDQGR YLVLWD XQ VLWLR
(VWR SHUPLWH DO VLWLR LGHQWLILFDU D ORV XVXDULRV
FXDQGRUHJUHVDQDpO
&RQRFtDV\DDOJXQDGHHVWDVKHUUDPLHQWDV"

$UFKLYRVGHUDVWUHR
3UREDEOHPHQWH KDV QRWDGR TXH FXDQGR UHJUHVDV D
XQ VLWLR HQ HO TXH WH KDEtDV GDGR GH DOWD FRPR
XVXDULRWXQRPEUH\DDSDUHFHHQODSiJLQDDXQTXH
KDEtDVFHUUDGRHOQDYHJDGRU
/DVFRRNLHVWDPELpQSHUPLWHQDORVVLWLRVFDUJDUPiV
UiSLGDPHQWH DO JXDUGDU SDUWH GH VX LQIRUPDFLyQ HQ
WX GLVFR GXUR /DV FRRNLHV RIUHFHQ XQD PDQHUD IiFLO
GH LGHQWLILFDU D ORV FRQVXPLGRUHV ORV FDPLQRV TXH
WRPDQ DO HQWUDU DO VLWLR FXiQWDV YLVLWDV WLHQH HO VLWLR
HWF 6LQ HPEDUJR ORV QDYHJDGRUHV SHUPLWHQ D ORV
XVXDULRV ERUUDU ODV FRRNLHV OR TXH KDFH OD
LQIRUPDFLyQREWHQLGDLPSUHFLVD


Interiores.indd 276

5/9/13 6:29 PM

$UFKLYRVGHUDVWUHR
3DUD HVWR VH FUHDURQ ODV )ODVK FRRNLHV TXH QR
H[SLUDQ\UHDSDUHFHQDXQTXHVHDQERUUDGDV
2WUR WLSR GH KHUUDPLHQWDV WHFQROyJLFDV HQ OtQHD
KDQ SHUPLWLGR GHVDUUROODU SHUILOHV VREUH ORV
XVXDULRVLGHQWLILFDQGRFRQSUHFLVLyQTXLpQHVVRQ\
TXpEXVFDQ
3DUD SRGHU DQDOL]DU OD LQIRUPDFLyQ UHFRSLODGD SRU
UHJLVWURV HQ VHUYLGRUHV IRUPXODULRV \ DUFKLYRV GH
UDVWUHR VH QHFHVLWDQ EDVHV GH GDWRV FDSDFHV GH
UHXQLU\DGPLQLVWUDUHVWDLQIRUPDFLyQ

 H HV
3HUILOHV
/DVEDVHVGHGDWRVVRQDSOLFDFLRQHVGHVRIWZDUHVTXH
SHUPLWHQ JXDUGDU \ VLVWHPDWL]DU OD LQIRUPDFLyQ
UHFRSLODGD/DVEDVHVGHGDWRVUHODFLRQDOHVSUHVHQWDQ
OD LQIRUPDFLyQ HQ WDEODV HQ GRV GLPHQVLRQHV TXH
SHUPLWHQ YHU \ DQDOL]DU OD LQIRUPDFLyQ GHVGH GLVWLQWDV
SHUVSHFWLYDVUiSLGDPHQWH
(O DQiOLVLV GH OD LQIRUPDFLyQ D SDUWLU GH FLHUWRV GDWRV
WRPD GRV IRUPDV SULQFLSDOHV GHVFULSFLyQ \ SUHGLFFLyQ
/D PLQHUtD GH GDWRV GDWD PLQLQJ  VH XWLOL]D SDUD
VLPSOLILFDU \ UHVXPLU LQIRUPDFLyQ GH XQD PDQHUD TXH
SRGDPRV FRPSUHQGHU \ DQDOL]DU SHUPLWH LQIHULU FRVDV
VREUH FDVRV HVSHFtILFRV EDViQGRVH HQ ORV SDWURQHV
REVHUYDEOHV

Interiores.indd 277

5/9/13 6:29 PM

'DWD0LQLQJ
/D PLQHUtD GH GDWRV SXHGH RWRUJDU DO YHQGHGRU HQ
OtQHD XQ SRGHU LQPHQVR LQIHUHQFLDO VREUH OD
HVWUDWHJLDVSXEOLFLWDULDTXHHVWiXWLOL]DQGR\DTXHORV
DOJRULWPRV SXHGHQ FODVLILFDU FRUUHFWDPHQWH ORV
UHVXOWDGRVSRUFDWHJRUtDV/DPLQHUtDGHGDWRVSXHGH
KDFHU GLIHUHQWHV WLSRV GH DQiOLVLV 9HDPRV HQ TXp
FRQVLVWHFDGDXQRGHHOORV
/D GHWHFFLyQ GH DQRPDOtDV FXDQGR VH XVDQ ODV
HVWDGtVWLFDVSDUDGHWHUPLQDUVLDOJRHVQRWDEOHPHQWH
GLIHUHQWHGHXQSDWUyQ\HVXWLOL]DGDSRULQVWLWXFLRQHV
ILQDQFLHUDV SDUD LGHQWLILFDU SHUILOHV IUDXGXOHQWRV \
FDQFHODUWUDQVDFFLRQHV

'DWD0LQLQJ
$VRFLDFLyQGHDSUHQGL]DMHHVHOWLSRGHPLQHUtDGH
GDWRV TXH PDQHMD HO VLVWHPD GH UHFRPHQGDFLRQHV
GH$PD]RQR*RRJOHHVWHWLSRGHKDOOD]JRVVRQGH
XVRIUHFXHQWHSDUDODRULHQWDFLyQ\RIHUWDVDOWDUJHW
FRUUHFWR
'HWHFFLyQGH&OXVWHUHVXQWLSRGHUHFRQRFLPLHQWR
GH SDWURQHV TXH HV ~WLO SDUD GLIHUHQFLDU GLVWLQWRV
JUXSRV R FDWHJRUtDV GHQWUR GH XQ FRQMXQWR GH
GDWRV
&RQ OD PLQHUtD GH GDWRV HV SRVLEOH GHMDU TXH ORV
DOJRULWPRVGHWHFWHQWRGRVORVGLIHUHQWHVVXEJUXSRV
GHQWUR GH XQ FRQMXQWR GH GDWRV TXH GLILHUHQ HQWUH
Vt

Interiores.indd 278

5/9/13 6:29 PM

'DWD0LQLQJ
&ODVLILFDFLyQ VH SXHGH XWLOL]DU SDUD FODVLILFDU
QXHYRVFDVRVHQFDWHJRUtDV\DH[LVWHQWHV\DTXH
ORV DOJRULWPRV SXHGHQ GHWHFWDU GLIHUHQFLDV HQWUH
ORV HOHPHQWRV GH FDGD JUXSR \ DSOLFDU FLHUWDV
UHJODVDORVQXHYRVSUREOHPDVGHFODVLILFDFLyQ
 5HJUHVLyQ  VH SXHGH XWLOL]DU SDUD FRQVWUXLU
PRGHORVSUHGLFWLYRVEDVDGRVHQPXFKDVYDULDEOHV

'DWD0LQLQJ
3RUHMHPSOR)DFHERRNVHLQWHUHVDHQIDFWRUHVFRPR
OD LQIRUPDFLyQ SHUVRQDO FRPSDUWLGD HO Q~PHUR GH
IRWRV HWLTXHWDGDV VROLFLWXGHV GH DPLVWDG
FRPHQWDULRV HQWUH RWURV \D TXH HVWRV UHVXOWDGRV
SXHGHQVHUXWLOL]DGRVSDUDJXLDUHOGLVHxR\DOHQWDU
DPiVGHORVFRPSRUWDPLHQWRVTXHFRQGXFHQDXQD
PD\RUSDUWLFLSDFLyQ
'HVSXpV GH OD YHQWD VH YXHOYH LPSUHVFLQGLEOH
JXDUGDUODLQIRUPDFLyQGHQXHVWURVFOLHQWHVDVtFRPR
PDQWHQHU HO FRQWDFWR FRQ HOORV +R\ HVWR HV XVXDO
SHURSRUPXFKRWLHPSRQRIXHWDUHDVHQFLOOD

Interiores.indd 279

5/9/13 6:29 PM

'DWD0LQLQJ
/D XWLOL]DFLyQ GH PHGLRV VRFLDOHV KD SHUPLWLGR
DJUXSDU D ORV FOLHQWHV HQ GLIHUHQWHV FDWHJRUtDV \
GDUOHV VHJXLPLHQWR XQD YH] TXH VH HVWDEOHFH HO
FRQWDFWRFRQHOXVXDULR
&UHDQGR FXHQWDV HQ )DFHERRN KDQ HVWDEOHFLGR
FDQDOHV GH FRPXQLFDFLyQ GLUHFWD \ D VX YH] KDQ
FUHDGR UHODFLRQHV GH FRQWLQXLGDG FRQ HOORV
SXGLHQGR VHUYLU FRPR XQ FDQDO GH VHUYLFLR SRVW
YHQWD\DFWXDOL]DFLyQPX\HIHFWLYR

6LVWHPDV&50
2WUD WHFQRORJtD GH PDUNHWLQJ TXH VH KD
GHVDUUROODGRJUDFLDVDO,QWHUQHWVRQORVVLVWHPDVGH
DGPLQLVWUDFLyQ GH UHODFLyQ FRQ FOLHQWHV R VLVWHPDV
&50SRUVXVVLJODVHQLQJOpV
(VWRV VLVWHPDV FRQVLVWHQ GH XQ UHSRVLWRULR GH
FOLHQWHVFRQLQIRUPDFLyQGHWRGRVORVFRQWDFWRVTXH
WLHQH HO FOLHQWH FRQ OD HPSUHVD GH PDQHUD TXH VH
JHQHUD XQ SHUILO GHO FOLHQWH TXH SXHGH VHU XWLOL]DGR
FXDQGRVHYXHOYHDWHQHUFRQWDFWRFRQpO

Interiores.indd 280

5/9/13 6:29 PM

6LVWHPDV&50
(OUHJLVWURQRVRORFRQWLHQHORVFRQWDFWRVKHFKRVHQ
OtQHD WDPELpQ LQFOX\H OODPDGDV D FDOO FHQWHUV
YLVLWDV ItVLFDV D WLHQGDV NLRVFRV R GLVSRVLWLYRV
PyYLOHV HQ JHQHUDO WRGRV ORV SRVLEOHV SXQWRV HQ
TXHHOFOLHQWHSXHGHLQWHUDFWXDUFRQODHPSUHVD
/DLQIRUPDFLyQHVWiGLVSRQLEOHSDUDWRGRDTXHOTXH
WHQJDRSXHGDOOHJDUDWHQHUFRQWDFWRFRQHOFOLHQWH
$OJXQRV SURYHHGRUHV GH HVWH VLVWHPD VRQ 6$3
2UDFOH\.DQD

0pWULFDV
([LVWHQYDULDVIRUPDVGHPHGLUTXpWDQHIHFWLYRHV
XQVLWLRHQFRQVHJXLUYLVLWDV3RUHMHPSORHOVRFLDO
PDUNHWLQJ SXHGH PHGLUVH FRQ HO Q~PHUR GH
VXVFULSFLRQHV YLVLWDV R VHJXLGRUHV TXH WLHQH XQ
EORJRXQSHUILOGHXQDUHGVRFLDO
(Q FXDQWR D ODV HVWUDWHJLDV GH PDUNHWLQJ VH
SXHGHQPHGLUODVLPSUHVLRQHVRQ~PHURGHYHFHV
XQDQXQFLRHVSXEOLFDGR

Interiores.indd 281

5/9/13 6:29 PM

0pWULFDV
3RU RWUR ODGR ORV &75 &OLFNV WKURXJK UDWH  VRQ
XQ LQGLFDGRU GH OD HIHFWLYLGDG GH XQD FDPSDxD GH
HPDUNHWLQJ(VWDPpWULFDVHEDVDHQHOQ~PHURGH
YHFHV TXH XQ FLEHUQDXWD KD KHFKR FOLFN HQ WX
DQXQFLR 3RU HMHPSOR VL WX WLHQHV XQ DQXQFLR HQ
*RRJOH $GZRUGV  WX VXVFULSFLyQ WH SHPLWLUi VDEHU
FXiQWRVLQWHUHVDGRVHQHODQXQFLRKDQGDGRFOLFN

0pWULFDV
2WUD PpWULFD HV FRQRFLGD FRPR GXUDFLyQ \ VH UHILHUH
DOWLHPSRSURPHGLRTXHORVYLVLWDQWHVSHUPDQHFHQHQ
HO VLWLR :HE (VWR HV XQ GDWR UHOHYDQWH \D TXH HQWUH
PiVWLHPSRGXUHODYLVLWDPiVDOWDHVODSUREDELOLGDG
TXHVHUHDOLFHXQDFRPSUD
/D PpWULFD PiV XWLOL]DGD SDUD GHWHUPLQDU OD
SRSXODULGDG GH XQ VLWLR VRQ ORV YLVLWDQWHV ~QLFRV \
FXHQWDHOQ~PHURGHXVXDULRVTXHKDQDFFHGLGRDXQ
VLWLRZHEHQXQSHULRGRGHWHUPLQDGR

Interiores.indd 282

5/9/13 6:29 PM

0pWULFDV
([LVWHQ RWUDV PpWULFDV TXH TXHUUiV FRQVLGHUDU SDUD
GHWHUPLQDU HO p[LWR GH WXV HVWUDWHJLDV GH PDUNHWLQJ \
GHWXVLWLRSDUDSRGHUHYDOXDUHOUHWRUQRDODLQYHUVLyQ
'HILQDPRVDOJXQDV
WDVDGHDGTXLVLFLyQSRUFHQWDMHGHXVXDULRVTXHVH
UHJLVWUDQRYLVLWDQSiJLQDVPRVWUDQGRLQWHUpV
 WDVD GH FRQYHUVLyQ SRUFHQWDMH GH YLVLWDV TXH VH
FRQYLHUWHQHQYHQWDV
 WDVD GH FRQYHUVLyQ GHO FDUULWR GH FRPSUDV PLGH
OD SURSRUFLyQ GH SHGLGRV KHFKRV D FDUULWRV GH
FRPSUDV

0pWULFDV
([LVWHQ PpWULFDV TXH SHUPLWHQ HYDOXDU OD HILFLHQFLD
GH FDPSDxDV GH HPDLO PDUNHWLQJ (QWUH HOODV VH
HQFXHQWUDODWDVDGHDSHUWXUDTXHPLGHHOSRUFHQWDMH
GHFOLHQWHVTXHDEULHURQHOPHQVDMH7DPELpQH[LVWH
HO &OLFNWKURXJK UDWH SDUD HPDLO TXH VH UHILHUH DO
SRUFHQWDMH GH XVXDULRV TXH GLHURQ FOLFN DO PHQVDMH
SDUDDFFHGHUDODRIHUWD3RU~OWLPRHOERXQFHEDFN
LQGLFD HO SRUFHQWDMH GH FRUUHRV TXH QR SXGLHURQ VHU
HQWUHJDGRVRUHERWDURQ

Interiores.indd 283

5/9/13 6:29 PM

&LHUUH
<DHVWDPRVSRUFRQFOXLUODOHFFLyQDQWHVSRGHPRV
FRQFOXLU TXH ODV QXHYDV WHFQRORJtDV \ HVWUDWHJLDV
SDUD KDFHU FDPSDxDV GH PDUNHWLQJ GLJLWDO WH
IDFLOLWDUiQDWLHPSUHVDULRHOFRQRFHUDWXVFOLHQWHV
GDUOHVVHJXLPLHQWR\VDEHU
4Xp WDQ HIHFWLYD HVWi UHVXOWDQGR VHU WX
SUHVHQFLDHQOtQHD"

&LHUUH
/D PLQHUtD GH GDWRV WH SHUPLWLUi PDQLSXODU WX
HVWUDWHJLD VHJ~Q VHD QHFHVDULR XQD YH] TXH
FRQR]FDVORVGDWRV\Q~PHURVGHWXLQWHUpV
$KRUDSLHQVDHQODHVWUDWHJLDTXHXWLOL]DUiVWXSDUD
PHGLU HO LPSDFWR GH WX FDPSDxD \ FRPHQWD HQ HO
IRUR
1RVYHPRVHQODSUy[LPDOHFFLyQ

Interiores.indd 284

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 12: Online Marketing
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 12 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. El marketing digital, permite medir ____________ con mayor precisin cmo se
comporta un consumidor en lnea.

2. Qu son los web analytics y para qu sirven?

3. Qu tipo de informacin proveen las herramientas de registro?

4. Escribe dos tipos de herramientas de rastreo:


a)
b)
5. Qu es y para que se utiliza la minera de datos?

6. La tecnologa tambin ha permitido establecer y prolongar el contacto con el cliente. Un


ejemplo son los sistemas CRM. En qu consiste?

7. Qu empresas son proveedores de este sistema?

8. Cmo funcionan los sistemas CRT (Click through rate)?

Interiores.indd 285

5/9/13 6:29 PM

9. Menciona algunos tipos de mtricas que fueron mencionados en la leccin:

10. Qu aspectos te gustara medir de tu publicidad?

Interiores.indd 286

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 13
Online Marketing 3
Duracin:

30 min

Objetivo de aprendizaje: Explicar el concepto de online marketing y reconocer el


impacto que tienen las diferentes formas de hacer publicidad
en lnea con el fin de utilizarlas como estrategia.
Subtemas:

Mobile Marketing
Nuevas tendencias
Recomendaciones prcticas

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
- Imgenes de telfonos celulares

D 3:
- Texto en el fondo

1. Mobile Marketing
D 11:
- Grfica: Dispositivos utilizados (AMIPCI)

Interiores.indd 287

5/9/13 6:29 PM

2. Nuevas tendencias

D 13:
- Imagen cdigo QR

2.1 Apps
2.2 Cdigos QR

3. Recomendaciones prcticas

D 15:
- Texto en el fondo: sitio web compatible, Apps
basadas en ubicacin
D 16:
- Texto en el fondo: tu propia App, cdigos QR
D 17:
- Texto en el fondo: Contacto a un click, Compartir
con un click, Cupones GPS
D 18:
- Texto en el fondo: Herramientas novedosas,
Carrito de compras

Cierre
- Resumen de la leccin
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 288

D 34:
- Pasar las preguntas de reflexin en el fondo de
la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ2QOLQH0DUNHWLQJ 

,QIRUPDFLyQ*HQHUDO
+RODELHQYHQLGRDODWHUFHUD\~OWLPDOHFFLyQVREUH
RQOLQHPDUNHWLQJ
$KRUDTXH\DWLHQHVXQDPHMRULGHDVREUHFyPRHO
,QWHUQHWKDUHYROXFLRQDGRODIRUPDGHSURPRFLRQDU
WXV SURGXFWRV KDEODUHPRV VREUH PRELOH
PDUNHWLQJHQIRFiQGRQRVHQFyPRDSURYHFKDUORV
GLVSRVLWLYRVPyYLOHVSDUDSURPRYHUWXPDUFD

Interiores.indd 289

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(OWHPDJHQHUDOSDUDHVWDVHVLyQHV2QOLQHPDUNHWLQJ
<GHVDUUROODUHPRVORVVXEWHPDV
0RELOH0DUNHWLQJ
1XHYDVWHQGHQFLDV
5HFRPHQGDFLRQHVSUiFWLFDV
8QDYH]PDVHOREMHWLYRGHDSUHQGL]DMHVHUi([SOLFDU
HO FRQFHSWR GH RQOLQH PDUNHWLQJ \ UHFRQRFHU HO
LPSDFWR TXH WLHQHQ ODV GLIHUHQWHV IRUPDV GH KDFHU
SXEOLFLGDG HQ OtQHD FRQ HO ILQ GH XWLOL]DUODV FRPR
HVWUDWHJLD

0RELOHPDUNHWLQJ
&RPR KHPRV PHQFLRQDGR D OR ODUJR GHO FXUVR HO
FUHFLPLHQWRTXHKDQWHQLGRORVGLVSRVLWLYRVPyYLOHVHQ
ORV~OWLPRVDxRVHVVRUSUHQGHQWH$ILQDOHVGHHO
Q~PHUR GH OtQHDV PyYLOHV OOHJDED D ORV  PLOORQHV
FDVLDOFDQ]DQGRDOWRWDOGHODSREODFLyQ
6H HVWLPD TXH GH pVWRV HO  VHDQ VPDUWSKRQHV
FRQDFFHVRD,QWHUQHW*RRJOHUHSRUWDTXHHQ0p[LFR
DOUHGHGRU GHO  GH ODV E~VTXHGDV HQ VX PRWRU GH
E~VTXHGDSURYLHQHQGHWHOpIRQRVPyYLOHV(OGH
ORV XVXDULRV GH ,QWHUQHW XWLOL]DQ VX VPDUWSKRQH SDUD
FRQHFWDUVH

Interiores.indd 290

5/9/13 6:29 PM

0RELOHPDUNHWLQJ
$GHPiV D OD OLVWD GH GLVSRVLWLYRV PyYLOHV
SRGHPRVDJUHJDUWHOpIRQRVFHOXODUHVDORVTXHQR
VH OH LQVWDODQ DSOLFDFLRQHV GLVSRVLWLYRV FRPR HO
L3RG WRXFK \ ODV WDEOHWDV HOHFWUyQLFDV
$XPHQWDQGR HO SRUFHQWDMH GH XVXDULRV TXH
XWLOL]DQ DOJ~Q WLSR GH GLVSRVLWLYR PyYLO SDUD HVWDU
HQOtQHD

0RELOHPDUNHWLQJ
5HYLVDQGR HVWRV Q~PHURV  ORV PHUFDGyORJRV QR
SXHGHQ LJQRUDU HO YDORU GH LQWHJUDU HVWRV PHGLRV D
ODV HVWUDWHJLDV GH PDUNHWLQJ /D PLUDGD DKRUD HVWi
SXHVWDHQXWLOL]DUORVGLVSRVLWLYRVPyYLOHVFRPRSDUWH
LQGLVSHQVDEOHGHODVFDPSDxDVSXEOLFLWDULDV
$KRUD SURIXQGLFHPRV HQ ORV GLIHUHQWHV WLSRV GH
PDUNHWLQJ PyYLO ODV HVWUDWHJLDV TXH VH KDQ HVWDGR
XWLOL]DQGR KDVWD DKRUD \ ODV QXHYDV WHQGHQFLDV TXH
LQGXGDEOHPHQWHFUHFHUiQUiSLGDPHQWH

Interiores.indd 291

5/9/13 6:29 PM

0RELOHPDUNHWLQJ
(QWUH ODV IRUPDV WUDGLFLRQDOHV GH KDFHU
PDUNHWLQJPyYLOVHHQFXHQWUDQORVPHQVDMHV606
DQXQFLRV HQ SiJLQDV ZHE R DSSV DQXQFLRV HQ
EXVFDGRUHV \ YLGHRV /RV PHQVDMHV 606
QRUPDOPHQWH LPSOLFDQ HQYLDU D FRQVXPLGRUHV
FXSRQHV X RIHUWDV WHPSRUDOHV \ WHFQRORJtD PiV
VRILVWLFDGD SHUPLWH HQYLDU PHQVDMHV D
FRQVXPLGRUHV TXH VH HQFXHQWUDQ ItVLFDPHQWH
FHUFDGHOORFDO

0RELOHPDUNHWLQJ
7DQWR ORV DQXQFLRV HQ SiJLQDV ZHE DSSV R
MXHJRV FRPR DQXQFLRV HQ EXVFDGRUHV IXQFLRQDQ
DO LJXDO TXH HQ ORV GLVSRVLWLYRV ILMRV \ VH SXHGHQ
SURJUDPDU SDUD EDVDUVH HQ OD XELFDFLyQ GHO
XVXDULR
/RV YLGHRV WDPELpQ KDQ VLGR XQ IRUPDWR GH
SXEOLFLGDG PyYLO TXH KD FUHFLGR UiSLGDPHQWH
DSURYHFKDQGR OD WHFQRORJtD GH ORV QXHYRV
GLVSRVLWLYRV+DVYLVWRDOJ~QYLGHRSXEOLFLWDULR
TXH KD\D FDSWDGR WX $7(1&,1 GHVGH XQ
VPDUWSKRQH"

Interiores.indd 292

5/9/13 6:29 PM

0RELOHPDUNHWLQJ
(QWUH ORV SURYHHGRUHV PiV JUDQGHV GH SXEOLFLGDG
PyYLO VH HQFXHQWUDQ ODV SODWDIRUPDV L$G GH $SSOH
\ $G0RE GH *RRJOH $SSOH WH RIUHFH HQ VX
SODWDIRUPD TXH WX DQXQFLR OOHJXH D XQD DXGLHQFLD
TXHKDLQVWDODGRPiVGHPLOPLOORQHVGHDSSV
FRPSUDGR PiV GH  PLOORQHV GH GLVSRVLWLYRV
L26SDVDHQSURPHGLRPLQXWRVDOGtDXWLOL]DQGR
DSSV \ VH LQYROXFUD FRQ DQXQFLRV GH L$G GXUDQWH
VHJXQGRVSURPHGLRSRUYLVLWD

0RELOHPDUNHWLQJ
$GHPiV WH RIUHFH GLULJLU WX SXEOLFLGDG DO JUXSR TXH
SXHGDWHQHULQWHUpVHQWXSURGXFWR
$OLJXDOTXH$SSOH*RRJOHWHRIUHFHFRQHFWDUWHFRQ
VX JUDQ Q~PHUR GH XVXDULRV DO SRQHU SXEOLFLGDG HQ
VXVPiVGH$SSV
&XDQGR HPSH]DURQ D VXUJLU ORV WHOpIRQRV
LQWHOLJHQWHV \ VH PXOWLSOLFy VX XVR ODV HPSUHVDV
WXYLHURQ OD WDUHD GH DGHFXDU VXV SiJLQDV ZHE \
KDFHUODVFRPSDWLEOHVFRQHVWRVGLVSRVLWLYRV

Interiores.indd 293

5/9/13 6:29 PM

1XHYDVWHQGHQFLDV
(QJHQHUDOHVWRLPSOLFDEDJUiILFRVPiVVHQFLOORV
TXHQRWDUGDUDQHQFDUJDUTXHODGHVFDUJDQR
UHVXOWDUDFRVWRVDSDUDHOXVXDULR\TXHIXHUDQIiFLO
GHXVDU\QDYHJDU
$KRUDHOHQIRTXHHVWiHQGHVDUUROODU$SSV\
DSURYHFKDUpVWDVSDUDSURSRUFLRQDULQIRUPDFLyQ
GLIHUHQWHDWUDYpVGHXQDQXHYDIRUPDGHFRQVXPR
9HDPRVFyPRODVQXHYDVWHQGHQFLDVHQ$SSV\
&yGLJRV45VHLQWHJUDQDODVHVWUDWHJLDVGH
PiUNHWLQJGHXQDPDUFD

$SSV
/DV$SOLFDFLRQHVPyYLOHVR$SSVSXHGHQVHUXQD
H[FHOHQWHRSFLyQSDUDFRQHFWDUWHFRQWXVFOLHQWHV
(Q OD OHFFLyQ  KDEODUHPRV VREUH FyPR
LQFOXVLYH SXHGHQ VHU XQ FDQDO GH YHQWDV (Q
FXDQWR VX XVR SXEOLFLWDULR ODV DSSV SXHGHQ VHU
XQDH[FHOHQWHRSFLyQSDUDRIUHFHUSURPRFLRQHVHQ
WLHPSRUHDO\DWUDHUFOLHQWHVDWUDYpVGHSXEOLFLGDG
ORFDO
$OJXQDV PDUFDV LQFOXVLYH KDQ GHVDUUROODGR $SSV
HQ IRUPD GH MXHJR SDUD DWUDHU OD DWHQFLyQ GH
FRQVXPLGRUHV

Interiores.indd 294

5/9/13 6:29 PM

$SSV
8Q HMHPSOR UHFRQRFLGR GH XQD $SS FUHDGD FRQ ILQHV
SXEOLFLWDULRV IXH OD $SS FUHDGD SRU /DQG 5RYHU SDUD HO
ODQ]DPLHQWRGHVXFURVVRYHU(YRTXH(VWD$SSEXVFDED
DWUDHUXQQXHYRPHUFDGRGHSRVLEOHVFOLHQWHV\DSURYHFKy
ODVIXQFLRQHVGHORVVPDUWSKRQHV\WDEOHWVSDUDFUHDUXQD
$SS ODQGURYHU LQWHUDFWLYD HQ OD TXH HO XVXDULR FRQILJXUDU
YLUWXDOPHQWH XQD (YRTXH FDPELDQGR FRORU LQWHULRUHV
OODQWDVHWF8QDYH]TXHFRQVWUXtDQVXFRFKHLGHDOSRGtDQ
JXDUGDUXQDIRWRGHpO$GHPiVWHQtDODIXQFLyQGHSRQHU
DO XVXDULR GHQWUR GHO FURVVRYHU \ GDU XQD YLVWD GH 
JUDGRVGHOLQWHULRUGHOFRFKHDOPDQLSXODUHOGLVSRVLWLYR/D
DSOLFDFLyQ ORJUy PDQWHQHU OD DWHQFLyQ GH ORV XVXDULRV SRU
PiVWLHPSRTXHFXDOTXLHURWURDQXQFLR

$SSV
$O LJXDO TXH /DQG 5RYHU PXFKDV PDUFDV
DXWRPRWULFHV RIUHFHQ $SSV TXH SHUPLWHQ YHU
GLIHUHQWHV PRGHORV FRPSDUDUORV R DJHQGDU XQD
SUXHEDGHPDQHMRHQODDJHQFLDPiVFHUFDQD
&RPRPHQFLRQDPRVDQWHVXQDGHODVIRUWDOH]DVGHO
PDUNHWLQJ D WUDYpV GH GLVSRVLWLYRV PyYLOHV HV VDEHU
GyQGH VH HQFXHQWUD HO SRVLEOH FOLHQWH \ HQYLDU
SXEOLFLGDG FXSRQHV \ RIHUWDV WHPSRUDOHV EDVDGDV
HQODFHUFDQtDItVLFDGHOFRQVXPLGRU

Interiores.indd 295

5/9/13 6:29 PM

$SSV
8QHMHPSORGHXQD$SSTXHRIUHFHHVWRVVHUYLFLRV
DQHJRFLRVItVLFRVHV)RXUVTXDUH
(VWD DSS JUDWXLWD SHUPLWH D QHJRFLRV FUHDU XQD
SiJLQD \ RIUHFHU SURPRFLRQHV D TXLHQHV VH
HQFXHQWUHQFHUFD
(QRWURVSDtVHV*URXSRQ\*RRJOH2IIHUVWDPELpQ
KDQLQFRUSRUDGRHVWHPRGHOR

&yGLJRV45
2WUD WHFQRORJtD LQFRUSRUDGD D ORV VPDUWSKRQHV
VRQ ORV FyGLJRV 45 $SURYHFKDQGR OD FiPDUD
LQWHJUDGD D ORV WHOpIRQRV ORV FyGLJRV 45 VRQ
VLPLODUHVDORVFyGLJRVGHEDUUD\VLUYHQFRPRXQD
OLJDDXQDGLUHFFLyQZHE
+DVHVFXFKDGRVREUHHVWRVFyGLJRV"
6HJXUDPHQWH KDV YLVWR HVWRV FyGLJRV HQ VLWLRV
ZHE FRUUHRV HOHFWUyQLFRV DQXQFLRV HQ UHYLVWDV
SyVWHUV SDTXHWHV H LQFOXVLYH HQ WDUMHWDV GH
SUHVHQWDFLyQ

Interiores.indd 296

5/9/13 6:29 PM

&XDQGR DOJXLHQ HVFDQHD XQ FyGLJR FRQ VX WHOpIRQR


PyYLO QRUPDOPHQWH HV OOHYDGR D XQD SiJLQD ZHE HQ
GRQGH DSDUHFH XQ PHQVDMH HVSHFtILFR R XQD
SURPRFLyQ&RPRHVWUDWHJLDGHPDUNHWLQJORVFyGLJRV
45 SXHGHQ VHU XQD PDQHUD GH RIUHFHU GHVFXHQWRV R
FXSRQHV UHJLVWUDU D FOLHQWHV HQ WX OLVWD GH FRUUHRV R
LQFOXVLYH OOHYDUORV D GDUOH /LNH D WX SiJLQD GH
)DFHERRN 2WUD YHQWDMD GH HVWRV FyGLJRV HV TXH
SHUPLWHQFDOFXODUHOWUiILFRTXHVHGHULYDGHHOORVSRU
ORTXHVHSXHGHFRQWDELOL]DUHOUHWRUQRGHODLQYHUVLyQ
$OJXQRVVLWLRVJUDWXLWRVTXHSHUPLWHQFUHDUFyGLJRV45
\FRQWDELOL]DUVXXVRVRQ6FDQ/LIH\L&DQG\

5HFRPHQGDFLRQHVSUiFWLFDV
6HJXUDPHQWH WH HVWDUiV SUHJXQWDQGR FyPR
LQFRUSRUDU ODV YHQWDMDV GHO PDUNHWLQJ PyYLO D
PL HVWUDWHJLD SXEOLFLWDULD" 9HDPRV DOJXQDV
UHFRPHQGDFLRQHV
 'HVDUUROOD XQ VLWLR ZHE FRPSDWLEOH FRQ
GLVSRVLWLYRV PyYLOHV HVWR SXHGH UHVXOWDU
FRPSOLFDGR DO WHQHU TXH GLVHxDU SDUD ODV
GLIHUHQWHVSODWDIRUPDVSHURYDOHODSHQD

Interiores.indd 297

5/9/13 6:29 PM

5HFRPHQGDFLRQHVSUiFWLFDV
 8WLOL]D $SSV EDVDGDV HQ XELFDFLyQ GHO XVXDULR
FDGD YH] VRQ PiV ORV FRQVXPLGRUHV TXH XWLOL]DQ
DSSVJUDWXLWDVSDUDORFDOL]DUFRPHUFLRVORFDOHV
 &UHD WX SURSLD $SS PyYLO SHUR QR ROYLGHV
FRQVLGHUDUORVKiELWRVGHWXVFRQVXPLGRUHVDQWHVGH
KDFHUOR
8WLOL]DFyGLJRV45
 3XEOLFD FRQWHQLGR PyYLO VL HQYtDV FRUUHRV
HOHFWUyQLFRV DVHJXUD TXH VHDQ FRPSDWLEOHV FRQ ORV
GLVSRVLWLYRVPyYLOHV

5HFRPHQGDFLRQHVSUiFWLFDV
3HURTXpHOHPHQWRVGHEHWHQHUWX$SSPyYLO"
&RPR HVWUDWHJLD SXEOLFLWDULD WX $SS PyYLO GHEH
WHQHUODVVLJXLHQWHVFDUDFWHUtVWLFDV
&RQWDFWRDXQFOLFNDJUHJDXQERWyQDWUDYpV
GHO FXDO HO XVXDULR SXHGD OODPDUWH ORFDOL]DUWH HQ
XQPDSDRHQYLDUWHXQFRUUHR
 &RPSDUWLU FRQ XQ FOLFN LQFOX\H XQ ERWyQ D
WUDYpV GHO FXDO WX FOLHQWH SXHGD FRPSDUWLU HO $SS
FRQVXVDPLVWDGHVDWUDYpVGHODVUHGHVVRFLDOHV

Interiores.indd 298

5/9/13 6:29 PM

5HFRPHQGDFLRQHVSUiFWLFDV
 &XSRQHV *36 &XDQGR HO FOLHQWH YLVLWD WX
HVWDEOHFLPLHQWRUHFLEHFXSRQHVDWUDYpVGHWX$SS
+HUUDPLHQWDVQRYHGRVDVFRPRXQDFDOFXODGRUD
GHSURSLQDVVLHUHVXQUHVWDXUDQWH
 &DUULWR GH FRPSUDV IDFLOLWD HO SURFHVR GH
FRPSUDLQFOX\HODRSFLyQGHFRPSUDUDWUDYpVGHWX
$SS
(OGHVDUUROODUXQD$SSSXHGHLUGHVGHXQRVFXDQWRV
PLOHVGHSHVRVKDVWDPiVGHPLO7RGRGHSHQGH
GH OD FRPSOHMLGDG GH HVWD 'HWHUPLQD FRQ SUHFLVLyQ
WXV REMHWLYRV GH QHJRFLR \ GHFLGH VL HV D WUDYpV GH
ORV GLVSRVLWLYRV PyYLOHV FRPR PHMRU SXHGHV
SURPRFLRQDUHVRTXHRIUHFHV

&LHUUH
<DHVWDPRVSRUFRQFOXLU
3LHQVD 4Xp HVWUDWHJLDV GHO PRELOH PDUNHWLQJ
SLHQVDVLQFRUSRUDUDWXSODQSXEOLFLWDULR"
 9XHOYH D SHQVDU HQ WXV FOLHQWHV SRWHQFLDOHV
TXLpQHV VRQ" SRU TXp PHGLR VH HVWiQ
FRQHFWDQGRD,QWHUQHW"

Interiores.indd 299

5/9/13 6:29 PM

&LHUUH
6L OD UHVSXHVWD HV XQ GLVSRVLWLYR PyYLO FRQVLGHUD
DORFDUXQDSDUWHGHWXSUHVXSXHVWRGHPDUNHWLQJD
FDPSDxDVSDUDPyYLOHV
5HFXHUGD HYDOXDU ODV GLIHUHQWHV RSFLRQHV FRPR
PHQVDMHV606DQXQFLRVHQSiJLQDVZHEYLGHRV
DSSV \ FyGLJRV 45 SDUD IRUPDU XQD HVWUDWHJLD
H[LWRVD
/D SUy[LPD FiSVXOD LQLFLDUHPRV FRQ HO WHPD GH
0HGLRVGH3DJR+DVWD3URQWR

Interiores.indd 300

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 13: Online Marketing
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 13 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Escribe Verdadero (V) o Falso (F) segn corresponda:
- En la lista de dispositivos mviles estn las tabletas, ipods y telfonos inteligentes ___
- Alrededor del 10% de las bsquedas en el motor de Google provienen de celulares ___
2. Qu tipos de marketing mvil se mencionaron en la leccin?

3. Piensa en algn video publicitario que hayas visto desde un smartphone.

4. Menciona dos grandes proveedores de publicidad mvil:


a)
b)
5. Cules son estrategias viejas del marketing mvil? Cules son las nuevas
tendencias?

6. Cul es la diferencia entre un sitio web y un APP del sitio web?


7. Cmo funcionan los cdigos QR?

8. En la leccin se dieron diferentes recomendaciones para incorporar publicidad mvil a tu


negocio. Por favor escribe 3 de estas recomendaciones.
a)
b)
c)

Interiores.indd 301

5/9/13 6:29 PM

9. A continuacin, los elementos que debe contener tu APPA mvil. Define cada uno de
ellos.
- Contacto a un click
- Compartir con un click
- Cupones GPS
- Herramientas Novedosas
- Carrito de Compras
10. Piensa de nuevo quin es tu mercado y en funcin a esto reflexiona sobre qu
herramientas del marketing mvil podran serte de utilidad.

Interiores.indd 302

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 14
Medios de Pago
Duracin:

30 min

Objetivo de aprendizaje: Identificar los distintos medios de pago para e-commerce y


delinear cmo incorporarlas a una tienda virtual.
Subtemas:

Formas de pago
Contracargos

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:
Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
-Texto: Mtodos Offline/ Mtodos Online

1.Formas de pago
- Mtodos offline: Contra reembolso,
transferencia bancaria y domiciliacin bancaria
- Mtodos online: Tarjetas de crdito,
intermediarios de pago (PayPal, SafetyPay,
etc)
- Medios de prepago
- Cmo incorporar estos mtodos a mi

Interiores.indd 303

Notas de Produccin:

D 2:
- Texto en el fondo

D 5:
-Texto para cada mtodo de pago e imgenes:
representativas en el fondo
D 7:
- Imgenes: Tarjetas de crdito

5/9/13 6:29 PM

negocio?

D 8:
- Hacer un diagrama del mtodo de pago con
tarjeta/ banco
D 9:
- Imgenes de pantalla de pasarelas de pago
bancarias
D 10:
- Pregunta en el fondo: Cmo incorporar este
medio de pago a tu tienda virtual?
D 12- 19:
- Imgenes del logotipo de las empresas
intermediarias de pago
D 20:
- Texto de fondo: Medios de Prepago
D 21:
- Pregunta en el fondo: Sabes lo que es un
contracargo?

2. Contracargos
- Motivos de contracargos
- Cmo enfrentar un contracargo?
- Cmo prevenir contracargos?

D 22:
-Replicar un cartoon de este proceso
(Contracargos)
D 25:
- Imgenes aleatorias de documentos
mencionados

3. Entrevista Safety Pay y Mercado Pago

D 27:
- Logotipo de estas empresas mientras dura la
entrevista

Cierre
- Agradecimiento por la entrevista
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

D 34:
- Pasar las preguntas de reflexin en el fondo de
la pantalla para que comenten en el foro

Interiores.indd 304

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ0HGLRVGH3DJR

,QIRUPDFLyQ*HQHUDO
7HPD0HGLRVGH3DJR
6XEWHPDV
)RUPDVGH3DJR
&RQWUDFDUJRV
2EMHWLYR(VSHFtILFR,GHQWLILFDUODVGLVWLQWDVIRUPDVGH
SDJR\GHILQLUTXpHVXQFRQWUDFDUJR
/DOHFFLyQDQWHULRUKDEOiEDPRVVREUHFyPRFUHDU
SUHVHQFLDHQOtQHD8QDYH]TXHKDVKHFKRHVWRTXHUUiV
GHILQLUODPHWRGRORJtDGHSDJRSDUDSRGHULQLFLDUD
YHQGHUGHVGHWXWLHQGDYLUWXDO

Interiores.indd 305

5/9/13 6:29 PM

)RUPDVGH3DJR
/RV PHGLRV GH SDJR GLJLWDOHV RIUHFHQ OD SRVLELOLGDG GH
OOHYDU D FDER WUDQVDFFLRQHV HOHFWUyQLFDV VLQ OD QHFHVLGDG
GHPDQHMDUGLQHURHQHIHFWLYR
/DV IRUPDV GH SDJR PiV SRSXODUHV TXH RIUHFHQ ODV
WLHQGDV YLUWXDOHV VH SXHGHQ DJUXSDU HQ GRV FDWHJRUtDV
JHQHUDOHV
0pWRGRV2IIOLQHVRQDTXHOORVHQORVTXHHOSDJRVH
HIHFW~DGHVSXpVGHKDEHUUHDOL]DGRODFRPSUD
0pWRGRV2QOLQH6RQDTXHOORVHQORVTXHHOSDJRVH
UHDOL]DDOPRPHQWRGHODFRPSUDPHGLDQWHFRQH[LyQ
GLUHFWD
9DPRVDGDUHMHPSORGHFDGDXQRGHHOORV

)RUPDVGH3DJR
(QWUHORV0pWRGRVRIIOLQHGHSDJRHVWi

&RQWUDUHHPEROVRPpWRGRHQHOTXHHOSDJRVHUHDOL]D
HQ HO PRPHQWR HQ HO TXH HO SURGXFWR HV HQWUHJDGR DO
XVXDULR  HV GHFLU VH SDJD DO WUDQVSRUWLVWD R D OD
SHUVRQD TXH HQWUHJD OD PHUFDQFtD (VWH PpWRGR VH
FRQVLGHUDPX\VHJXUR

7UDQVIHUHQFLD EDQFDULD FRQVLVWH HQ TXH HO


FRPHUFLDQWH IDFLOLWD DO XVXDULR XQD FXHQWD EDQFDULD
GRQGH GHEHUi DSOLFDU HO SDJR FRUUHVSRQGLHQWH SDUD
FRQILUPDUVXSHGLGR\GHHVWDPDQHUDFRQWLQXDUFRQHO
SURFHVRGHFRPSUD

Interiores.indd 306

5/9/13 6:29 PM

)RUPDVGH3DJR
'RPLFLOLDFLyQEDQFDULDPpWRGRHQHOTXHHOFOLHQWH
IDFLOLWD D VX SURYHHGRU XQ Q~PHUR GH FXHQWD
EDQFDULD LPSDUD TXH pVWH OH KDJD XQ FREUR ILMR
SHULyGLFDPHQWH (VWH PpWRGR HV XWLOL]DGR
JHQHUDOPHQWH SRU RUJDQL]DFLRQHV TXH TXLHUHQ
DJLOL]DUVXVSDJRVPHGLDQWHODSURJUDPDFLyQGHORV
PLVPRV
$OJXQRV EHQHILFLRV TXH WLHQH HVWH PpWRGR VRQ OD
VLPSOLILFDFLyQ GH SURFHVRV OD RSWLPL]DFLyQ GH
FREUDQ]DVPHMRUVHUYLFLRDOFOLHQWH\PD\RUFRQWUROHQ
ODVILQDQ]DV

)RUPDVGH3DJR
$KRUD KDEOHPRV GH ORV 0pWRGRV RQOLQH GH SDJR
(QWUHORVPiVSRSXODUHVHVWi

7DUMHWDGHFUpGLWRVLVWHPDGHSDJRHOHFWUyQLFRPiV
FRP~QDQLYHOLQWHUQDFLRQDOKR\HQGtD&RQVLVWHHQ
TXHXQDYH]TXHHOFOLHQWHVHOHFFLRQDODPHUFDQFtD
GHODWLHQGDYLUWXDOSURFHGHDUHDOL]DUHOSDJR
GHVGHHOVLWLRGHOFRPHUFLRHQOtQHDHQWRQFHVVHOH
FRQHFWDDXQVHUYLGRUGHODHQWLGDGEDQFDULD
VHOHFFLRQDGDHQGRQGHVHOHVROLFLWDUiTXH
SURSRUFLRQHORVGDWRVGHVXWDUMHWD\DVtHOEDQFR
FRPSUXHEDODYDOLGH]GHODPLVPD\VHJDUDQWL]DQ
ORVIRQGRVSDUDHOSDJR

Interiores.indd 307

5/9/13 6:29 PM

)RUPDVGH3DJR
8QDYH]DXWRUL]DGDODWUDQVDFFLyQODWHUPLQDOGHO
SXQWRGHYHQWDYLUWXDO 739 LQIRUPDDOFRPSUDGRU\DO
FRPHUFLRVREUHHOUHVXOWDGRGHODWUDQVDFFLyQ\
GHYXHOYHHOFRQWURODOVLWLRGHODWLHQGDYLUWXDOSDUDTXH
FRQILUPHHOSHGLGR\VHDERQHHOLPSRUWHJHQHUDGRD
ODFXHQWDGHOYHQGHGRUKDELWXDOPHQWHHOFOLHQWHUHFLEH
ODFRQILUPDFLyQHQVXFRUUHRHOHFWUyQLFR
([LVWHQGRVWLSRVGH739V WHUPLQDOGHSXQWRVGH
YHQWD FRQORVTXHHOFRPHUFLRYLUWXDOSXHGHUHDOL]DUHO
FREURFRQWDUMHWDGHFUpGLWR

)RUPDVGH3DJR
(OSULPHUIRUPDWRGH739HVHOWUDGLFLRQDOTXHFRQVWD
GHSODWDIRUPDVSURSRUFLRQDGDVSRUHQWLGDGHV
EDQFDULDVSDUDTXHVHDQLQFRUSRUDGDVHQHOSURFHVR
GHSDJR\HOVHJXQGRIRUPDWRHVHO'VHFXUHTXH
FRQVLVWHHQXQVLVWHPDGHDXWHQWLFDFLyQGHWDUMHWDV
9,6$\0DVWHU&DUGORJRVTXHSHUPLWHUHDOL]DU
FRPSUDVHQOtQHDGHPDQHUDVHJXUDHQFXDOTXLHUDGH
ORVFRPHUFLRVSDUWLFLSDQWHV
0iVDGHODQWHVHUHWRPDUiHVWHVLVWHPDGHSDJR
VHJXURHQODOHFFLyQGHVHJXULGDG\SURWHFFLyQGH
GDWRV

Interiores.indd 308

5/9/13 6:29 PM

)RUPDVGH3DJR
3HUR&yPRLQFRUSRUDUHVWHPHGLRGHSDJRDWX
WLHQGDYLUWXDO"6HFHOHEUDXQFRQWUDWRFRQHOEDQFRGH
LQWHUpV\VHOOHYDDFDERXQSURFHGLPLHQWRSDUD
SURJUDPDUODSDVDUHODGHSDJR\FRPHQ]DUDXWLOL]DUOD
/RVSUHFLRVYDUtDQ\SXHGHQLQFOXLUXQDWDULIDGH$OWD
VRORXQDYH] XQDWDULIDPHQVXDO\WDULIDVSRU
WUDQVDFFLRQHV
/RVEDQFRVHVWDEOHFHQFLHUWRVUHTXLVLWRVSDUDDGTXLULU
GLFKDV739V
$XQTXHHVWRVUHTXLVLWRVSXHGHQYDULDUHQWUHODV
GLIHUHQWHVHQWLGDGHVEDQFDULDVJHQHUDOPHQWHVHVROLFLWD

)RUPDVGH3DJR
/OHQDUODVROLFLWXGVHJ~QHOIRUPDWRGHOEDQFR
)LUPDUHOFRQWUDWRGHDILOLDFLyQ
&RQVLJQDU$FWD&RQVWLWXWLYD\~OWLPDPRGLILFDFLyQFRQ
SRGHUQRWDULDOGHOILUPDQWH
&pGXODILVFDO
&RPSUREDQWHGHGRPLFLOLR
&RSLDGHLGHQWLILFDFLyQRILFLDOYLJHQWHODSHUVRQDTXHILUPH
HOFRQWUDWRGHDILOLDFLyQ GXHxRRDSRGHUDGROHJDO
&RQWDUFRQXQDFXHQWDGHFKHTXHV
&RQWDUFRQXQDOtQHDWHOHIyQLFDDQiORJD VyORSDUD739
ILMD
7HQHUFRQWDFWRHOpFWULFRFRQFRUULHQWHUHJXODGDGH
YROWV
(QWUHRWURVSRVLEOHVUHTXLVLWRV

Interiores.indd 309

5/9/13 6:29 PM

)RUPDVGH3DJR
2WURPpWRGRGHSDJRRQOLQHHVHO
3DJRDWUDYpVGHXQLQWHUPHGLDULRHVXQVLVWHPDGH
SDJRTXHRIUHFHDORVFOLHQWHVXQDIRUPDVHJXUDGH
SDJDUHQLQWHUQHWVLQQHFHVLGDGGHHQYLDUGDWRV
ILQDQFLHURVDOFRPHUFLRHVWRSHUPLWHDSHTXHxRV
FRPHUFLDQWHVDFHSWDUSDJRVVLQQHFHVLGDGGHXWLOL]DU
XQEDQFRRSURFHVDGRUSDUDYDOLGDUODWUDQVDFFLyQ(VWH
WLSRGHSDJRFREUDXQDFRPLVLyQDOFRPHUFLRSHURQRDO
FRQVXPLGRUILQDO$FRQWLQXDFLyQUHYLVDUHPRVDOJXQRV
PHGLRVSDUDKDFHUHVWHWLSRGHSDJR

)RUPDVGH3DJR
3D\3DO(VXQVLVWHPDGHSDJRHQHOTXHHOXVXDULR
DEUHXQDFXHQWD\SURSRUFLRQDVXLQIRUPDFLyQEDQFDULD
D3D\3DOSDUDTXHHQFRPSUDVIXWXUDVHOFOLHQWHXWLOL]D
VXFRUUHRHOHFWUyQLFRGH3D\3DOSDUDSDJDUHQOtQHD
VLHPSUHTXHH[LVWDHVWDRSFLyQGHSDJR
'HHVWDPDQHUDORVFRPHUFLRVUHFLEHQHOSDJRSRU
PHGLRGH3D\3DOVLQYHUHQQLQJ~QPRPHQWROD
LQIRUPDFLyQILQDQFLHUDGHOFRQVXPLGRU
6LXVWHGGHFLGHXWLOL]DU3D\3DOFRPRPHGLRGHSDJR
VLPSOHPHQWHGHEHUHJLVWUDUVHHQHOVLWLR\HOHJLUGH
RSFLRQHVSDUDFRPHQ]DUDUHFLELUSDJRV

Interiores.indd 310

5/9/13 6:29 PM

)RUPDVGH3DJR
6HSXHGHHOHJLUHQWUH
D 5HFLELUSDJRVHQHOVLWLRZHE
% 5HFLELUSDJRVYtDFRUUHRHOHFWUyQLFR
3DUDDFHSWDUSDJRVGHVGHHOVLWLRZHEVHGHEHUi
FUHDUXQtFRQRRERWyQSDUDHIHFWXDUHOSDJR 3D\3DO
OROOHYDUiGHODPDQRHQHOSURFHVR \DWUDYpVGHHVWH
ERWyQGHFRPSUD3D\3DOUHFLELUiODLQIRUPDFLyQ\
YDOLGDORVGDWRVILQDQFLHURVGHOFRPSUDGRUSDUD
FRQFOXLUODRSHUDFLyQ

)RUPDVGH3DJR
(QFDPELRVLQRVHFXHQWDFRQXQVLWLRZHE3D\3DOGD
ODRSFLyQGHSDJRYtDFRUUHRHOHFWUyQLFR(OFRPHUFLDQWH
SXHGHFUHDUUHFLERVSHUVRQDOL]DGRVDWUDYpVGHVX
FXHQWD3D\3DO\HQYLDUORVDOFOLHQWHSRUFRUUHR
HOHFWUyQLFRDOUHFLELUORHOFOLHQWHGDUiFOLFNHQHOERWyQ
SDJDU\VHJXLUiHOSURFHVRXQDYH]HIHFWXDGDOD
RSHUDFLyQ3D\3DOOHHQYLDUiXQFRUUHRGHFRQILUPDFLyQ
3DUDDPERVPpWRGRV3D\3DOFREUDXQDFRPLVLyQGHO
DORVFRPHUFLDQWHVDXQTXHSXHGHGLVPLQXLUDO
VHJ~QHOPRQWRGHFRPSUD3DUDFRPHQ]DUDXWLOL]DUDU
3D\3DOVRORGHEHGHUHJLVWUDUVHHQHOVLWLRZZZ
SD\SDOFRPP[\VHJXLUODVLQGLFDFLRQHV

Interiores.indd 311

5/9/13 6:29 PM

3D\86LVWHPDGHSDJRHQHOTXHHOFRPHUFLRHIHFW~D
ODVWUDQVDFFLRQHVSRUPHGLRGHODSDVDUHODGHSDJRVGH
3D\8&yPRIXQFLRQD"(OFOLHQWHVHOHFFLRQDSURGXFWRV
GHVGHODWLHQGDYLUWXDOGHOFRPHUFLRGHVSXpVHOLJHOD
RSFLyQGHSDJDU\HVGLUHFFLRQDGRDODSDVDUHODGH
SDJRVGH3D\8ODFXDODFHSWDGLIHUHQWHVPpWRGRV\D
VHDHIHFWLYRWDUMHWDVGHFUpGLWR\WUDQVIHUHQFLDV
EDQFDULDV8QDYH]TXH3D\8YDOLGDODLQIRUPDFLyQFRQ
HOEDQFRVHFRQILUPDHOSHGLGRSRUPHGLRGHXQFRUUHR
HOHFWUyQLFRWDQWRDOYHQGHGRUFRPRDOFOLHQWH\HOGLQHUR
HVDERQDGRHQVXFXHQWDYLUWXDOGH3D\8\HQHO
PRPHQWRTXHORGHVHHWUDQVIHULUHVHGLQHURDVXFXHQWD
EDQFDULD3DUDFRPHQ]DUDXVDUHVWHPpWRGRGHSDJRVH
GHEHVXVFULELUHQHOVLWLRP[SD\XFRP

)RUPDVGH3DJR
6DIHW\3D\HVXQVLVWHPDGHSDJRXWLOL]DGRSDUDKDFHU
FRPSUDVHQOtQHDSDJDQGRDWUDYpVGHWXEDQFD
HOHFWUyQLFD&yPRIXQFLRQD"
(OFOLHQWHHOLJHXQRRPiVSURGXFWRVGHVGHODVWLHQGDV
YLUWXDOHVDILOLDGDV
6HOHFFLRQD6DIHW\3D\FRPRPHGLRGHSDJR\FRQVHUYD
HOQ~PHURGHWUDQVDFFLyQ\PRQWRDSDJDU
(OLJHODHQWLGDGEDQFDULD\HVGLUHFFLRQDGRDVXEDQFD
HOHFWUyQLFDSDUDFRQILUPDFLyQGHGDWRV
/DHQWLGDGEDQFDULDYDOLGD\HIHFW~DODWUDQVDFFLyQ
QRWLILFDQGRDOFRPHUFLRSDUDFRQFOXLUFRQODFRPSUD
3DUDLQLFLDUDXWLOL]DUORUHJLVWUDWHHQZZZVDIHW\SD\FRP

Interiores.indd 312

5/9/13 6:29 PM

0HUFDGR3DJRHVRWURVLVWHPDGHSDJRHQOtQHDTXH
SHUPLWHDOFRPHUFLDQWHSURFHVDUSDJRVGHPDQHUD
VHQFLOOD\GHVGHGLIHUHQWHVHVSDFLRVHQODZHE(Q
TXpFRQVLVWH"(QTXHHOFOLHQWHHOLJHHOSURGXFWR
GHVHDGRGHVGHODWLHQGDYLUWXDOGHVGHSXEOLFLGDGHQ
VXFRUUHRRGHVGHXQDUHGVRFLDOHQODTXHVH
DQXQFLHQORVSURGXFWRV&yPRVHKDFH"6HGDFOLFN
VREUHHOERWyQGHSDJR\0HUFDGR3DJRVHHQFDUJDGH
HIHFWXDUODWUDQVDFFLyQDGPLWLHQGRGLIHUHQWHVPHGLRV
WDUMHWDVGHSyVLWRVWUDQVIHUHQFLDVEDQFDULDV2;;2
HQWUHRWURV0HUFDGR3DJRYDOLGDHOSDJR\WUDQVILHUH
HOGLQHURDODFXHQWDGHOYHQGHGRU3DUDFRPHQ]DUD
XWLOL]DUHVWHPpWRGR\FRQRFHUORVEHQHILFLRVTXHWLHQH
LQJUHVDDZZZPHUFDGRSDJRFRPPSPH[LFR

)RUPDVGH3DJR
'LQHUR0DLOHVRWURVLVWHPDGHSDJRSDUDFRPHUFLRHQ
OtQHDTXHDGPLWHGLIHUHQWHVPHGLRVWDUMHWDVPHGLRVGH
SDJRHQHIHFWLYRRWUDQVIHUHQFLDEDQFDULD\ORVIRQGRVVH
DFUHGLWDQHQODFXHQWD'LQHUR0DLOGHOYHQGHGRU\VHOH
QRWLILFD5HYLVpPRVORSDVRDSDVR
 (OFOLHQWHSDJDDWUDYpVGH'LQHUR0DLOHOLJLHQGRXQ
PpWRGRGHSDJR
 /RVIRQGRVVHDFUHGLWDQHQWXFXHQWD'LQHUR0DLO\HUHV
QRWLILFDGR
 5HWLUDVORVIRQGRVDWUDYpVGHWUDQVIHUHQFLDEDQFDULD
3DUDLQLFLDUDXWLOL]DUHVWHPHGLRUHJLVWUDWHHQP[
GLQHURPDLOFRP

Interiores.indd 313

5/9/13 6:29 PM

)RUPDVGH3DJR
3RU~OWLPRRWUDIRUPDGHSDJDUSURGXFWRVRVHUYLFLRVHQ
OtQHD HV XWLOL]DQGR 0HGLRV GH SUHSDJR 0pWRGR GH SDJR
HQHOTXHHOFOLHQWHFRPSUDXQDWDUMHWDSUHSDJDGDSRUXQD
FDQWLGDG GHWHUPLQDGD HQ XQ SXQWR GH YHQWD \ SURFHGH D
UHDOL]DU HO SDJR HQ OtQHD FRQ HO FyGLJR GH OD WDUMHWD
SUHSDJDGD 8Q HMHPSOR GH HVWH PHGLR HV 3D\6DIH FDUG
TXH FRQVLVWH HQ FDPELDU GLQHUR HQ HIHFWLYR SRU
SD\VDIHFDUG HQ XQR GH ORV SXQWRV GH YHQWD UHFLELU
SD\VDIHFDUGHQIRUPDGHFyGLJR3,1GHGtJLWRVSRUXQ
YDORU GHWHUPLQDGR \ ILQDOPHQWH SDJDU FRQ HVWH 3,1 HQ
FXDOTXLHUDGHORVFRPHUFLRVHQOtQHDSDUWLFLSDQWHV

)RUPDVGH3DJR
&RPR VH SXHGH YHU H[LVWHQ GLIHUHQWHV JUXSRV
LQYROXFUDGRV HQ ODV GLYHUVDV IRUPDV GH SDJR (QWUH
HOORV HVWiQ ORV FRQVXPLGRUHV HO FRPHUFLDQWH \ ORV
LQWHUPHGLDULRVILQDQFLHURV$OHOHJLUODVIRUPDVGHSDJR
GLVSRQLEOHV HQ HO VLWLR ZHE VHUi QHFHVDULR FRQVLGHUDU
ODV QHFHVLGDGHV GH HVWRV JUXSRV \ RIUHFHU XQD
YDULHGDG GH IRUPDV GH SDJR VLQ GHVFXLGDU OD
VHJXULGDGGHOVLWLR
+DEODQGR GH VHJXULGDG 6DEHV OR TXH HV XQ
FRQWUDFDUJR"

Interiores.indd 314

5/9/13 6:29 PM

&RQWUDFDUJRV
8QFRQWUDFDUJRHVXQDIRUPDGHSURWHFFLyQGHOFOLHQWH
SURYLVWRSRUODVHQWLGDGHVEDQFDULDVTXHSHUPLWHDORV
WDUMHWDKDELHQWHVSUHVHQWDUXQDTXHMDHQFXDQWRD
WUDQVDFFLRQHVIUDXGXOHQWDVRQRUHFRQRFLGDVHQVX
HVWDGRGHFXHQWD8QDYH]TXHHOWDUMHWDKDELHQWH
SUHVHQWDXQDTXHMDHOEDQFRHPLVRUKDFHXQD
LQYHVWLJDFLyQGHODPLVPD\HQHOFDVRTXHVH
FRPSUXHEHTXHODWUDQVDFFLyQHVHQUHDOLGDG
IUDXGXOHQWDHOEDQFRUHHPEROVDUiUHHPEROVRHOYDORU
RULJLQDODOWDUMHWDKDELHQWHTXLHQSRUOH\WLHQHGRVDxRV
SDUDSUHVHQWDUXQDGLVSXWD

&RQWUDFDUJRV
(QWRQFHV VL HO PHUFDQWH QR GHPXHVWUD TXH OD
WUDQVDFFLyQ HV OHJtWLPD HO EDQFR WRPDUi HO YDORU
HQWHUR GH OD WUDQVDFFLyQ GH VX FXHQWD MXQWR FRQ XQ
FREUR DGLFLRQDO R PXOWD FX\R PRQWR GHSHQGH GHO
EDQFR TXH SDWURFLQD OD FXHQWD 3RU OR FRQWUDULR VL VH
SUXHEDTXHODTXHMDGHOWDUMHWDKDELHQWHHVIDOVDQRVH
VROLFLWDUiQLQJ~QUHHPEROVRGHOPHUFDQWH

Interiores.indd 315

5/9/13 6:29 PM

&RQWUDFDUJRV
8QFRQWUDFDUJRSXHGHSUHVHQWDUVHSRU

 7UDQVDFFLRQHVIUDXGXOHQWDVTXHVXFHGHQFXDQGR
XQDWDUMHWDHVXWLOL]DGDVLQDXWRUL]DFLyQGHO
SURSLHWDULR
 &UpGLWRQRSURFHVDGRORTXHVLJQLILFDTXHHO
FRQVXPLGRUGHYROYLyODPHUFDQFtDSRUDOJ~QGHIHFWR
SHURQRUHFLELyVXGLQHURGHYXHOWDDUWtFXORVQR
UHFLELGRVSUREOHPDVWpFQLFRVFRQODWUDQVDFFLyQ3RU
HMHPSORFXDQGRVHUHDOL]DXQFDUJRGREOHRHO
UHVXOWDGRGHODWUDQVDFFLyQHVGHFOLQDGRSHURVLVH
KDFHHOFREURHQWUHJDWDUGtDHVWDIDHQWUHRWUDV

&RQWUDFDUJRV
(V SRVLEOH HQIUHQWDU XQ FRQWUDFDUJR SDUD OR FXDO HO
FRPHUFLR GHEH SUHVHQWDU HO FRPSUREDQWH GH
DFHSWDFLyQ GH FDUJR GHELGDPHQWH OOHQDGR \ ILUPDGR
SRUHOFOLHQWHFRSLDGHODFUHGHQFLDOGHO,)(FRSLDGH
OD WDUMHWD GH FUpGLWR FRPSUREDQWH GH PHQVDMHUtD DO
GRPLFLOLR GHO WDUMHWDKDELHQWH TXH WHQJD FRQILUPDFLyQ
GH UHFLELGD OD PHUFDQFtD SRU XQ DXWRUL]DGR R SRU HO
WDUMHWDKDELHQWH \ FXDOTXLHU GRFXPHQWR R SUXHED TXH
SXHGD VHU FRQVLGHUDGD FRPR HYLGHQFLD D IDYRU GHO
YHQGHGRU

Interiores.indd 316

5/9/13 6:29 PM

&RQWUDFDUJRV
$GLFLRQDOPHQWHH[LVWHQDOJXQDVDFFLRQHVTXHSXHGHQ
WRPDUVHSDUDSUHYHQLUFRQWUDFDUJRV(VLPSRUWDQWH
SUHYHQLUWUDQVDFFLRQHVIUDXGXOHQWDV\DFHSWDUFRPSUDV
QRDXWRUL]DGDVSDUDHOORVHSXHGHUHFXUULUDVHUYLFLRVGH
VHJXULGDGGHHQWLGDGHVEDQFDULDV\RWURVPHGLRVGH
SDJR\VHVXJLHUHGHWHFWDUVLXQSHGLGRVHKDFH
UHSHWLGDPHQWH\FRQGLUHFFLRQHVGHIDFWXUDFLyQ
GLIHUHQWHV3RURWURODGRSDUDHYLWDUUHFKD]RGH
PHUFDQFtD\FRQWUDFDUJRVHGHEHSURSRUFLRQDUDUWtFXORV
HQEXHQDVFRQGLFLRQHV\DWHQGHUDORVFOLHQWHV
PDQWHQLHQGRVLHPSUHFRPXQLFDFLyQFRQHOORVSDUDHYLWDU
TXHODTXHMDOOHJXHDODLQVWLWXFLyQEDQFDULD

&LHUUH
<DHVWDPRVSRUFRQFOXLUODOHFFLyQ
$KRUDTXH\DFRQRFHQORVGLIHUHQWHVPpWRGRVTXHVH
XWLOL]DQSDUDKDFHUSDJRVHQOtQHDFRPHQWHQHQHO
IRUR
&XiOHVPpWRGRVXWLOL]DQRXWLOL]DUiQSDUDVX
QHJRFLRYLUWXDO"
6HJXLUHPRVKDEODQGRVREUHPHGLRVGHSDJRHQOD
SUy[LPDOHFFLyQ+DVWDSURQWR

Interiores.indd 317

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 14: Medios de Pago
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 14 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Los medios de pago revisados en esta leccin pueden agruparse en dos categoras:
Mtodos online y Mtodos Offline.Escribe (ON) entre parntesis si el medio de pago en
un mtodo online, y (OFF) si es offline.
- Contra Rembolso ( )
- Tarjeta de Crdito/Dbito ( )
- Domiciliacin bancaria ( )
- Intermediario (Pay Pal, Safety Pay, etc) (
- Transferencia Bancaria ( )

2. Generalmente quin opta por utilizar el mtodo de Domiciliacin Bancaria?

3. Qu quiere decir TPV y cules son los dos tipos que existen?

4. Menciona algunos de los requisitos que piden las instituciones bancarias para incorporar
el medio de pago con tarjeta de crdito en tu sitio web.
5. En qu consiste el pago a travs de un intermediario?

6. Menciona algunas empresas que ofrecen el servicio de intermediarios de pago.

Interiores.indd 318

5/9/13 6:29 PM

7. Cmo funciona el medio de pre-pago?

8. Selecciona la respuesta correcta. Un contracargo es:


a) Una forma de proteccin del cliente provisto por las entidades bancarias, que permite
a los tarjetahabientes presentar una queja en cuanto a transacciones fraudulentas o no
reconocidas en su estado de cuenta.
b) Una forma de proteccin del comerciante provisto por las entidades bancarias, que
permite a los negocios ampararse en caso de pago tardo o transacciones fraudulentas.

9. Cmo se puede confrontar un contracargo? Cmo se puede prevenir?

10. Piensa en qu medios de pago incorporars a tu sitio web de comercio electrnico.

Interiores.indd 319

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 15
Seguridad 1:
Firma electrnica y Certificados digitales
Duracin:

30 min

Objetivo de aprendizaje: Definir qu es la firma electrnica y el certificado digital y


obtener ambas.
Subtemas:

Firma electrnica
Certificados digitales
Firma y certificados digitales para mi tienda en lnea

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 4:
- Firma Electrnica
- Definicin firma electrnica
- Poner la pregunta de fondo de pantalla:
Entonces qu diferencia hay entre la firma
autgrafa y la electrnica?

1. Firma Electrnica
- Definicin Firma autgrafa
- Definicin Firma electrnica
- Diferencia entre la Firma electrnica simple y la
firma electrnica avanzada
- El SAT

Interiores.indd 320

D 2:
- Texto en el fondo

5/9/13 6:29 PM

- Caractersticas de la FIEL
-Cmo obtener la FIEL?

D 5:
-Definicin firma: la firma es como un sello que
identifica y distingue a un individuo de los
dems
D 8:
- Escribir: Firma electrnica simple y Firma
electrnica avanzada en el fondo
D 9:
- Escribir FIEL: Firma Electrnica Avanzada
D 10:
- Texto de fondo: "Public Key Infrastructure=
Llave de infraestructura pblica"
D 11:
- Demostracin en pantalla (Ejemplo de video:
http://www.youtube.com/watch?v=HaI2CgeOilo
)

2. Certificado Digital
- Definicin y propsito de un Certificado Digital
- Cmo tramitar un certificado de sello digital?

D 14:
-Ttulo: Certificado Digital
D 16:
- Logotipo SAT
D 17:
- Pregunta de fondo: Cmo tramitar un
Certificado de Sello Digital?

3. Firma y certificado digital para mi tienda en


lnea

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 321

D 21:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ6HJXULGDG 

,QWURGXFFLyQ
+ROD ELHQYHQLGRV GH QXHYR DO FXUVR EiVLFR GH
FRPHUFLRHOHFWUyQLFR
(QHVWDOHFFLyQDERUGDUHPRVHOLPSRUWDQWHWHPDGHOD
VHJXULGDGGLJLWDO
8QR GH ODV EDUUHUDV PiV UHFXUUHQWHV SDUD XVDU
VHUYLFLRV RQOLQH HV OD IDOWD GH VHJXULGDG GHO PHGLR
WDQWR SDUD SURWHJHU ODV WUDQVIHUHQFLDV GH GDWRV FRPR
SDUDDVHJXUDUODLGHQWLGDGGHOXVXDULR

Interiores.indd 322

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
3RUHOORHQHVWDVHVLyQGHVDUUROODUHPRVORV6XEWHPDV
 )LUPDHOHFWUyQLFD
 &HUWLILFDGRV'LJLWDOHV
 )LUPD\&HUWLILFDGR'LJLWDOHQPLWLHQGDHQOtQHD

<HOREMHWLYRGHDSUHQGL]DMHHVSHUDGRDOWHUPLQDUOD
OHFFLyQHVTXHSXHGDVGHILQLUTXpHVODILUPD
HOHFWUyQLFD\HOFHUWLILFDGRGLJLWDOSDUDSRGHUREWHQHU
DPEDV

)LUPD(OHFWUyQLFD
/D ILUPD HOHFWUyQLFD GD UHVSXHVWD D QHFHVLGDGHV TXH
VXUJHQ GHO KHFKR GH TXH ODV WUDQVDFFLRQHV RQOLQH
FRPHUFLDOHVVHOOHYHQDFDERHQHOHQWRUQRHOHFWUyQLFR
\D TXH HVWR VXSRQH WHQHU TXH VXSOLU OD IDOWD GH
SUHVHQFLD ItVLFD HQWUH ODV SDUWHV \ SRU WDQWR GRWDU GH
VHJXULGDG MXUtGLFD D ODV PLVPDV D WUDYpV GH OD
WHFQRORJtD
3LHQVD FyPR GHVFULELUtDV OD GLIHUHQFLD HQWUH OD ILUPD
DXWyJUDID\ODHOHFWUyQLFD

Interiores.indd 323

5/9/13 6:29 PM

)LUPD(OHFWUyQLFD
/D ILUPD VHJ~Q HO 'LFFLRQDULR GH OD 5HDO  $FDGHPLD
HV HO 1RPEUH \ DSHOOLGR R WtWXOR TXH XQD SHUVRQD
HVFULEH GH VX SURSLD PDQR HQ XQ GRFXPHQWR SDUD
GDUOH DXWHQWLFLGDG R SDUD H[SUHVDU TXH DSUXHED VX
FRQWHQLGR
/D ILUPD UHSUHVHQWD XQ VLJQR SHUVRQDO GLVWLQWLYR TXH
SHUPLWHLQIRUPDUDFHUFDGHODLGHQWLGDGGHODXWRUGHXQ
GRFXPHQWR\PDQLIHVWDUVXDFXHUGRVREUHHOFRQWHQLGR
GHO DFWR (V GHFLU OD ILUPD HV FRPR XQ VHOOR TXH
LGHQWLILFD\GLVWLQJXHDXQLQGLYLGXRGHORVGHPiV

)LUPD(OHFWUyQLFD
/D ILUPD DXWyJUDID \ OD ILUPD HOHFWUyQLFD SRVHHQ
HTXLYDOHQFLD IXQFLRQDO OR TXH VLJQLILFD TXH VRQ
FRPSOHWDPHQWH GLIHUHQWHV SHUR ODV GRV VRQ
SHUIHFWDPHQWH YiOLGDV \ IXQFLRQDOPHQWH HTXLYDOHQWHV
HV GHFLU TXH WRGDV ODV FDUDFWHUtVWLFDV GH OD ILUPD
DXWyJUDID VH FRQVHUYDQ HQ OD ILUPD HOHFWUyQLFD
VLPSOHPHQWH OD ILUPD HOHFWUyQLFD HV XQ FRQMXQWR GH
FDUDFWHUHVDOIDQXPpULFRV
6DEHVFRPRVHYHXQDILUPDHOHFWUyQLFD"

Interiores.indd 324

5/9/13 6:29 PM

/DILUPDHVODIRUPDHQTXHSRGHPRVJDUDQWL]DUTXHODV
SDUWHV TXH VH REOLJDQ HQ OD UHODFLyQ MXUtGLFD R FRQWUDWR
VRQUHDOPHQWHTXLHQHVGLFHQVHU
(VWDDWULEXFLyQMXUtGLFDTXHVHSUHWHQGHIRUPDOL]DUHQXQ
PHQVDMHGHGDWRVHVFRQRFLGDFRPR)LUPDHOHFWUyQLFD
ODFXDOSXHGHVHU6LPSOHR$YDQ]DGD
/D )LUPD (OHFWUyQLFD 6LPSOH VRQ GDWRV HQ IRUPD
HOHFWUyQLFDFRQVLJQDGRVHQXQPHQVDMHTXHSXHGDQVHU
XWLOL]DGRVSDUDLGHQWLILFDUDOILUPDQWH
< OD )LUPD (OHFWUyQLFD $YDQ]DGD VH GLIHUHQFtD GH OD
VLPSOHSRUTXHFXHQWDFRQXQFHUWLILFDGRGLJLWDOTXHYDOLGD
OD DXWHQWLFLGDG GHO HPLVRU \ SHUPLWH GHWHFWDU FXDOTXLHU
PRGLILFDFLyQ XOWHULRU DO FRQWHQLGR GHO PLVPR \ JDUDQWL]DU
ODLGHQWLGDGGHOWLWXODU

)LUPD(OHFWUyQLFD
0iVDGHODQWHHQHVWDOHFFLyQKDEODUHPRVGHOFHUWLILFDGR
GLJLWDO
(O 6DW 6HUYLFLR GH $GPLQLVWUDFLyQ 7ULEXWDULD HQ 0p[LFR 
GHILQH OD )LUPD (OHFWUyQLFD $YDQ]DGD R  )LHO FRPR XQ
FRQMXQWR GH GDWRV DGMXQWRV HQ XQ PHQVDMH HOHFWUyQLFR
FX\RSURSyVLWRHVLGHQWLILFDUDOHPLVRUGHOPHQVDMHFRPR
DXWRU OHJtWLPR GH pVWH WDO \ FRPR VL VH WUDWDUD GH XQD
ILUPDDXWyJUDID
3RU VXV FDUDFWHUtVWLFDV OD )LHO EULQGD VHJXULGDG D ODV
WUDQVDFFLRQHV HOHFWUyQLFDV GH ORV FRQWULEX\HQWHV \D TXH
FRQVXXVRVHYHULILFDUTXHHODXWRUGHOPHQVDMHQRKD\D
VLGRPRGLILFDGR

Interiores.indd 325

5/9/13 6:29 PM

)LUPD(OHFWUyQLFD
(O GLVHxR GH OD )LHO VH EDVD HQ HVWiQGDUHV
LQWHUQDFLRQDOHVGH3.,SRUVXVVLJODVHQLQJOpV3XEOLF
.H\ ,QIUDVWUXFWXUH HQ GRQGH VH XWLOL]DQ GRV FODYHV R
OODYHVSDUDHOHQYtRGHPHQVDMHV

 /DOODYHRFODYHSULYDGDTXHVRODPHQWHFRQRFHHO
WLWXODUGHOD)LHO\VLUYHSDUDFLIUDUGDWRV
 < OD OODYH R FODYH S~EOLFD GLVSRQLEOH HQ ,QWHUQHW
SDUD FRQVXOWD GH WRGRV ORV XVXDULRV GH VHUYLFLRV
HOHFWUyQLFRVFRQODTXHVHGHVFLIUDQGDWRV

&yPRSXHGHREWHQHUOD),(/"
 ,QJUHVH DO VLWLR  ZZZVDWJREP[ \ GHVFDUJXH HO
SURJUDPD6ROFHGL
 ,QVWiOHOR \ VHOHFFLRQH 5HTXHULPLHQWR GH )LHO FDSWXUH
OD LQIRUPDFLyQ VROLFLWDGD \ JHQHUH VX DUFKLYR FRQ
H[WHQVLyQ UHT\VXOODYHSULYDGD
 /OHQDHLPSULPHSRUDPERVODGRV HQXQDVRODKRMD OD
6ROLFLWXGGHFHUWLILFDGRGH)LUPD(OHFWUyQLFD$YDQ]DGD
 3URJUDPD XQD FLWD HQ HO 0yGXOR GHO 6$7 GH VX
SUHIHUHQFLD \ DFXGH FRQ HO DUFKLYR TXH JHQHUy VX
VROLFLWXG \ OD GRFXPHQWDFLyQ TXH VH PHQFLRQD HQ HO
DSDUWDGRGH5HTXLVLWRVSDUDHIHFWXDUHOWUiPLWH

Interiores.indd 326

5/9/13 6:29 PM

)LUPD(OHFWUyQLFD
 'XUDQWH HO SURFHVR SDUD OD REWHQFLyQ GH OD )LHO VH
UHFDEDQ ORV VLJXLHQWHV GDWRV GH LGHQWLGDG FRQ OD ILQDOLGDG
GHJDUDQWL]DUHOYtQFXORHQWUHXQFHUWLILFDGR\VXWLWXODU
)RWRJUDItDGHIUHQWH
&DSWXUDGHO,ULV
+XHOODVGDFWLODUHV
)LUPDDXWyJUDID\
'RFXPHQWRVUHTXHULGRVVHJ~QVHDHOFDVR SHUVRQD
ItVLFDRPRUDO 
(VWH SURFHVR WDPELpQ SXHGH UHDOL]DUOR D WUDYpV GH VX
FRQWDGRU

)LUPD(OHFWUyQLFD
$OILQDOL]DUHOWUiPLWHVHJHQHUDXQFHUWLILFDGRGLJLWDO
H[WHQVLyQ &(5  TXH SXHGH GHVFDUJDUVH GH (QWUHJD
GH FHUWLILFDGRV R VL SUHVHQWy VX DUFKLYR GH
UHTXHULPLHQWR HQ XQ GLVSRVLWLYR 86% SXHGH VROLFLWDU
XQDFRSLDGHOFHUWLILFDGRHQHVHPRPHQWR 6LSUHVHQWy
HVWH DUFKLYR HQ &' WHQGUi TXH GHVFDUJDU HO
FHUWLILFDGRGHVGH,QWHUQHW 

Interiores.indd 327

5/9/13 6:29 PM

&HUWLILFDGRV'LJLWDOHV
0X\ ELHQ SXHV DKRUD KDEODUHPRV VREUH ORV
FHUWLILFDGRVGLJLWDOHV
$O LJXDO TXH OD ILUPD GLJLWDO ORV FHUWLILFDGRV GLJLWDOHV
EXVFDQ VROXFLRQDU HO SUREOHPD GH OD LGHQWLGDG GLJLWDO
(Q UHDOLGDG SDUD TXH XQD ILUPD GLJLWDO \ 3., VHDQ
HIHFWLYDV VH QHFHVLWD DVHJXUDU TXH OD OODYH SDUD
GHFRGLILFDU HO PHQVDMH UHDOPHQWH SHUWHQH]FD D OD
SHUVRQDGHTXLHQGLFHVHU

&HUWLILFDGRV'LJLWDOHV
(O FHUWLILFDGR GLJLWDO HV XQ GRFXPHQWR GLJLWDO HPLWLGR
SRU XQD LQVWLWXFLyQ GH FRQILDQ]D FRQRFLGD FRPR
DXWRULGDGFHUWLILFDGRUDHOFXDOFRQWLHQHHOQRPEUHGHO
VXMHWR R HPSUHVD XQD OODYH S~EOLFD XQ Q~PHUR GH
VHULH GH FHUWLILFDGR GLJLWDO XQD IHFKD GH FDGXFLGDG
XQD IHFKD GH HPLVLyQ OD ILUPD GLJLWDO GH OD DXWRULGDG
FHUWLILFDGRUD\RWURVGDWRVLQIRUPDFLyQGHLGHQWLGDG

Interiores.indd 328

5/9/13 6:29 PM

&HUWLILFDGR'LJLWDO
3DUD TXH XQ FHUWLILFDGR GLJLWDO WHQJD YDOLGH] OHJDO OD
DXWRULGDGGHFHUWLILFDFLyQGHEHGHHVWDUDFUHGLWDGDSRU
OD HQWLGDG S~EOLFD GH FHUWLILFDFLyQ GHO SDtV
FRUUHVSRQGLHQWH(Q0p[LFRHVHOORJR6$7(QHOVLWLR
GHO6$7VHSXHGHFRQVXOWDUODOLVWDGHDXWRULGDGHVGH
FHUWLILFDFLyQ
/RV FHUWLILFDGRV GLJLWDOHV VH XWLOL]DQ SDUD YHULILFDU OD
DXWHQWLFLGDG GH XQ VLWLR :HE OD DXWHQWLFLGDG H
LQWHJULGDG GH XQ SURJUDPD GH FRPSXWDFLyQ R YHULILFDU
HO PRPHQWR HQ TXH IXH ILUPDGR R HQYLDGR XQ
GRFXPHQWRGLJLWDO

&HUWLILFDGRV'LJLWDOHV
&yPRWUDPLWDUXQ&HUWLILFDGRGH6HOOR'LJLWDO"
 ,QJUHVDU HQ KWWSZZZVDWJREP[ D OD 2ILFLQD
9LUWXDO\FDSWXUDUWX),(/YLJHQWH
 ,QJUHVDUD&RPSUREDQWHV)LVFDOHV'LJLWDOHV
 'HVFDUJD VL HV TXH D~Q QR VH FXHQWD FRQ HO
SURJUDPD 6ROFHGL 6ROLFLWXG GH &HUWLILFDGRV
'LJLWDOHV  TXH OH SHUPLWLUi JHQHUDU ORV
UHTXHULPLHQWRVGHGLFKRFHUWLILFDGR ODFODYHROODYH
SULYDGD GH VHOOR GLJLWDO FRQWUDVHxD GH FODYH \
FRQWUDVHxDGHUHYRFDFLyQ 

Interiores.indd 329

5/9/13 6:29 PM

&HUWLILFDGRV'LJLWDOHV
 ,QJUHVD D &HUWL6$7 :HE 2ILFLQD 9LUWXDO \ HQYtD WX
VROLFLWXGGHFHUWLILFDGRGLJLWDO
 5HFLEH WX Q~PHUR GH RSHUDFLyQ \ HQ XQ GtD
DSUR[LPDGDPHQWH WHQGUi UHVSXHVWD LQJUHVDQGR
QXHYDPHQWHD&HUWL6$7:HE
7X VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR GHEHUi WHQHU
LQFRUSRUDGR XQ FHUWLILFDGR GLJLWDO SDUD TXH ORV
QDYHJDGRUHV LQGLTXHQ D ORV XVXDULRV TXH HVWiQ
QDYHJDQGRHQXQVLWLRVHJXUR

)LUPD\&HUWLILFDGR'LJLWDOSDUDPL
7LHQGDHQOtQHD
8Q HMHPSOR GH XQ FHUWLILFDGR SDUD VLWLRV ZHE HV OD
WHFQRORJtD 66/ VHFXUH VRFNHWV OHYHO   HVWH WHPD OR
YHUHPRVHQODOHFFLyQ[SHURSRUORSURQWRHVQHFHVDULR
DFODUDU TXH  HVWRV FHUWLILFDGRV WDPELpQ VRQ HPLWLGRV SRU
XQD DXWRULGDG FHUWLILFDGRUD \ HV pVWD TXLHQ WH GDUi ODV
LQGLFDFLRQHVVREUHFyPRLQVWDODUODHQWXVHUYLGRUZHE
/RV QDYHJDGRUHV DYLVDQ D WXV XVXDULRV TXH WLHQHV XQ
FHUWLILFDGRGLJLWDOFRQILDEOHPRVWUDQGRXQVHJXURFHUUDGR
HQODEDUUDGHGLUHFFLRQHV(QFDVRTXHHOQDYHJDGRUQR
UHFRQR]FD WX FHUWLILFDGR SUREDEOHPHQWH GH XQ DYLVR DO
XVXDULR LQGLFiQGROH TXH QR HV XQ VLWLR UHFRQRFLGR FRPR
VHJXUR

Interiores.indd 330

5/9/13 6:29 PM

&LHUUH
<DHVWDPRVSRUFRQFOXLUODOHFFLyQSHURVHJXLUHPRVFRQ
HOWHPDGHVHJXULGDGSDUDWUDQVDFFLRQHVHOHFWUyQLFDVHQ
QXHVWUDVLJXLHQWHFiSVXOD
&RPR WDUHD GH HVWD OHFFLyQ \ SDUD SRGHU WRPDU OD
VLJXLHQWH HVFULEH HQ HO IRUR &XiO HV OD GLIHUHQFLD
HQWUH )LUPD HOHFWUyQLFD VLPSOH \ ILUPD HOHFWUyQLFD
DYDQ]DGD"
+DVWDSURQWR

Interiores.indd 331

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin # 15: Seguridad
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 15 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Una de las barreras ms fuertes del comercio electrnico es la falta de seguridad que
perciben los clientes. Por qu es tan importante brindar seguridad a los consumidores?

2. Para qu sirve la firma electrnica?

3. Escribe dos caractersticas de cada una:


FIRMA AUTGRAFA
-

FIRMA ELECTRNICA
-

4. La firma electrnica puede ser simple o avanzada. Qu diferencia existe entre ambas?

5. Qu institucin brinda el Servicio de Administracin Tributaria en Mxico?

6. Mira este video tutorial del SAT para la adquisicin de tu FIEL:


http://www.youtube.com/watch?v=HaI2CgeOilo

7. Qu son los certificados digitales?

8. Mira este video tutorial del SAT en youtube para la obtencin de los Certificados
Digitales: http://www.youtube.com/watch?v=c6c1VQtVaJs&list=PLBB048E7F24A25CCF

Interiores.indd 332

5/9/13 6:29 PM

9. Elige Cmo se muestra a los clientes si tienes un certificado digital confiable?


a. A travs de un aviso

b. A travs de una imagen de candado

c. Por mail

10. Cmo se aplica la firma electrnica y certificado digital en tu negocio?

Interiores.indd 333

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 16
Seguridad 2:
Contrataciones y Comprobantes
Duracin:

30 min

Objetivo de aprendizaje: Identificar los elementos de una contratacin electrnica y un


comprobante fiscal digital.
Subtemas:

Contrataciones electrnicas
Comprobantes fiscales digitales

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:
Introduccin
- Bienvenida a la leccin y presentacin del instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

Notas de Produccin:
D 1:
- Texto en el fondo
D 2:
- Texto en el fondo

Desarrollo
1. Contrataciones electrnicas
- Caractersticas del contrato electrnico
- Consentimiento
- Jurisdiccin competente y ley applicable
- Trminos y condiciones en tu sitio web

Interiores.indd 334

5/9/13 6:29 PM

2. Comprobantes fiscales digitales


- Definicin y tipos
- Requisitos de expedicin
- Solicitar folios

D 13:
- Logotipo SAT

3. Entrevista

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 335

D 21:
- Pasar las preguntas de reflexin en el
fondo de la pantalla para que comenten en
el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ6HJXULGDG  
&RQWUDWDFLRQHVHOHFWUyQLFDV\
FRPSUREDQWHVILVFDOHVHOHFWUyQLFRV

,QIRUPDFLyQ*HQHUDO
+ROD ELHQYHQLGR RWUD YH] DO FXUVR GH FRPHUFLR
HOHFWUyQLFR &RPR PHQFLRQDPRV HQ OD OHFFLyQ DQWHULRU
HQHVWDOHFFLyQFRQWLQXDUHPRVFRQHOWHPDGHVHJXULGDG
HQ OtQHD \ YHUHPRV FyPR VH LQFRUSRUDQ OD ILUPD
HOHFWUyQLFD\ORVFHUWLILFDGRVGLJLWDOHVDRWURVGRFXPHQWRV
HOHFWUyQLFRV
(O 7HPD JHQHUDO FRQWLQXDUi VLHQGR 6HJXULGDG 3HUR
DKRUDGHVDUUROODUHPRVORV6XEWHPDV
&RQWUDWDFLRQHVHOHFWUyQLFDV
&RPSUREDQWHVILVFDOHVGLJLWDOHV
(O2EMHWLYRGHDSUHQGL]DMHHVSHUDGRVTXHDOILQDOGHHVWD
VHVLyQVHDVFDSi]GH,GHQWLILFDUORVHOHPHQWRVGHXQD
FRQWUDWDFLyQHOHFWUyQLFD\XQFRPSUREDQWHILVFDOGLJLWDO

Interiores.indd 336

5/9/13 6:29 PM

&RQWUDWDFLRQHVHOHFWUyQLFDV
(O FRPSUHQGHU OR TXH HV XQD ILUPD GLJLWDO \ FyPR
REWHQHUOD HV LQGLVSHQVDEOH SDUD XWLOL]DU FRQWUDWRV
HOHFWUyQLFRV\DTXHHVHVWDODTXHGDVHJXULGDGDORV
GRFXPHQWRV GLJLWDOHV (Q FXDOTXLHU FRQWH[WR XQD
FRQWUDWDFLyQ HV HO SURFHGLPLHQWR TXH VH VLJXH SDUD
TXHGRVRPiVSHUVRQDVVHSRQJDQGHDFXHUGRVREUH
ORV GHUHFKRV \ REOLJDFLRQHV TXH FDGD XQD GH HOODV
DGTXLHUH \ WRGR HOOR VH SODVPD HQ HO FRQWUDWR $
GLIHUHQFLD GH XQ FRQWUDWR WUDGLFLRQDO HQ XQ FRQWUDWR
HOHFWUyQLFR ODV RSHUDFLRQHV VH UHDOL]DQ D WUDYpV GH
PHGLRVHOHFWUyQLFRVHOOXJDUGRQGHVHHQFXHQWUHQODV
SDUWHVFHOHEUiQGRORHVKDVWDFLHUWRSXQWRLUUHOHYDQWH

&RQWUDWDFLRQHVHOHFWUyQLFDV
QR TXHGD UHJLVWUR HQ SDSHO \ VH UHGXFHQ ORV WLHPSRV
SDUDKDFHUODVWUDQVDFFLRQHVHIHFWLYDV'HSHQGLHQGRGHO
WLSR GH ELHQHV ORV FRQWUDWRV HOHFWUyQLFRV SXHGHQ VHU
GLUHFWRV HQ ORV FXDOHV HO FXPSOLPLHQWR GH OD REOLJDFLyQ
FRQWUDFWXDOVHKDFHDWUDYpVGH,QWHUQHW RLQGLUHFWRV HQ
ORVFXDOHVODSUHVWDFLyQHVXQELHQPDWHULDORXQVHUYLFLR
TXH GHEH HIHFWXDUVH RIIOLQH  (Q FLHUWD IRUPD ORV
FRQWUDWRV HOHFWUyQLFRV KDQ VXUJLGR PiV DOOi GH OD
H[LVWHQFLD R QR GH XQD OHJLVODFLyQ DO UHVSHFWR
DOFDQ]DQGR LPSRUWDQWHV QLYHOHV D HVFDOD PXQGLDO
(VWDPRV DQWH XQD QXHYD IRUPD GH FRPHUFLR SHUR DO
LJXDO TXH HO FRPHUFLR WUDGLFLRQDO QR GHMD GH UHTXHULU HO
FRQWUDWRFRPRLQVWUXPHQWRMXUtGLFREiVLFR

Interiores.indd 337

5/9/13 6:29 PM

&RQWUDWDFLRQHVHOHFWUyQLFDV
'H PDQHUD JHQHUDO XQ FRQWUDWR HOHFWUyQLFR HV
VLPSOHPHQWH XQ FRQWUDWR TXH VH UHDOL]D XWLOL]DQGR
PHGLRVHOHFWUyQLFRVDWUDYpVGHODUHG6LQHPEDUJRDO
QR TXHGDU ODV ILUPDV DXWyJUDIDV GH ODV SDUWHV
SODVPDGDV HQ SDSHO KD VLGR QHFHVDULR GHVDUUROODU
RWURVPHGLRVSDUDFRQILUPDUVXYDOLGH]$OHVWDUDQWH
OD QHFHVLGDG GH JHVWLRQDU XQ FRQWUDWR GH FRPSUD
YHQWD FRODERUDFLyQ R DFXHUGR HQWUH HPSUHVDV R
SURIHVLRQDOHVDWUDYpVGH,QWHUQHWODILUPDGLJLWDOGDOD
PLVPD YDOLGH] OHJDO TXH ORV FRQWUDWRV ILUPDGRV
ItVLFDPHQWH

(Q0p[LFRVHXWLOL]DOD/H\0RGHORGHOD&RPLVLyQGHODV
1DFLRQHV8QLGDVSDUDHO'HUHFKR0HUFDQWLO,QWHUQDFLRQDO
GHVDUUROODGDHQ\TXHSURSRUFLRQDORVFULWHULRVSDUD
GHWHUPLQDUHOYDORUMXUtGLFRGHORVPHQVDMHVHOHFWUyQLFRV
$FRQWLQXDFLyQSUHVHQWDPRVDOJXQDVGHHVWRVFULWHULRV
 &RQVHQWLPLHQWR &RPR WRGR FRQWUDWR HO HOHFWUyQLFR
WRPD IRUPD D SDUWLU GHO FRQVHQWLPLHQWR (O FRQWUDWR
HOHFWUyQLFR TXHGD SHUIHFFLRQDGR HQ HO PRPHQWR TXH OD
DFHSWDFLyQ LQJUHVD DO VLVWHPD LQIRUPiWLFR GHO RIHUHQWH
DXQTXH HVWH QR WHQJD FRQRFLPLHQWR GH OD DFHSWDFLyQ
3RUHMHPSORXQDYH]TXHVHUHFLEHHOFRUUHRHOHFWUyQLFR
FRQ OD DFHSWDFLyQ LQGHSHQGLHQWHPHQWH GH VL HO RIHUHQWH
KDUHYLVDGRRQRVXFRUUHR $GHPiVVHHVWDEOHFHTXHHO
RIHUHQWH GHEH HPLWLU XQ DFXVH GH UHFLER GH OD
DFHSWDFLyQ SDUD GDU VHJXULGDG D ODV WUDQVDFFLRQHV
FRPHUFLDOHV

Interiores.indd 338

5/9/13 6:29 PM

&RQWUDWDFLRQHVHOHFWUyQLFDV
 -XULVGLFFLyQ FRPSHWHQWH \ /H\ DSOLFDEOH 'HELGR D
TXH HO FRQWUDWR HOHFWUyQLFR QR FXHQWD FRQ XQ OXJDU
ItVLFR SDUD OD FHOHEUDFLyQ GHO FRQWUDWR OR TXH VH
FRQRFH FRPR SDFWR GH VXPLVLyQ SXHGH UHVXOWDU
SUREOHPiWLFR D TXp LQVWDQFLD DFXGLU \ FXiO VHUi OD OH\
FRPSHWHQWHHQFDVRTXHVXUMDXQFRQIOLFWR3DUDHVWR
OD/H\0RGHORGHOD&18'0,RIUHFHGRVSRVLELOLGDGHV
 5HFXUULU D OD -XVWLFLD HQ HO (VWDGR HQ TXH WHQJD VX
GRPLFLOLRHOGHPDQGDGR
'HPDQGDUHQORV7ULEXQDOHVGHO(VWDGRHQTXHGHELy
FXPSOLUVHODREOLJDFLyQREMHWRGHODGHPDQGD

&RQWUDWDFLRQHVHOHFWUyQLFDV
'HELGR D TXH DPERV SXHGHQ UHVXOWDU GLItFLO GH
GHWHUPLQDU VH SXHGH LQGLFDU OD VHGH SULQFLSDO GHO
QHJRFLR HO OXJDU GRQGH VH HQFXHQWUD HO UHJLVWUR R HO
OXJDUGRQGHHVWiXELFDGRHOVHUYLGRUDWUDYpVGHOFXDO
VHFHOHEUyHOFRQWUDWR
3RU ~OWLPR HQ FDVR GH ORV FRQWUDWRV FRQ
FRQVXPLGRUHVWRGDODQRUPDWLYDWLHQGHDODSURWHFFLyQ
GHO FRQVXPLGRU \ ORV FRQWUDWRV VH FRQVLGHUDQ
FHOHEUDGRV HQ HO OXJDU GRQGH HVWH WHQJD VX GRPLFLOLR
KDELWXDO

Interiores.indd 339

5/9/13 6:29 PM

(QWXVLWLRZHEGHFRPHUFLRHOHFWUyQLFRGHEHUiVSHGLUD
WXV FOLHQWHV TXH GHVHDQ KDFHU XQD WUDQVDFFLyQ TXH
DFHSWHQ ORV WpUPLQRV \ FRQGLFLRQHV HVWDEOHFLGRV (Q
HVWHFRQWUDWRGHEHUiVGHFODUDUODVUHVSRQVDELOLGDGHVD
ODV TXH WH FRPSURPHWHV \ ODV FRQGLFLRQHV EDMR ODV
FXDOHV HO FRQVXPLGRU FRPSUD WX SURGXFWR R VHUYLFLR
SyOL]DV GH JDUDQWtD VHUYLFLR GH HQWUHJD \ GHYROXFLyQ
HWF  (V FRP~Q TXH ODV HPSUHVDV TXH RIUHFHQ VXV
SURGXFWRVRVHUYLFLRVHQOtQHDSLGDQDVXVFOLHQWHVTXH
GHQ FOLFN HQ XQ ERWyQ DFHSWDQGR ORV WpUPLQRV \
FRQGLFLRQHV GH OD WUDQVDFFLyQ 2WUD RSFLyQ HV
HVWDEOHFHUGHPDQHUDWiFLWDODDFHSWDFLyQFRQHOPHUR
DFFHVR DO VLWLR HO XVXDULR \D HVWi DFHSWDQGR ORV
WpUPLQRVHVWDEOHFLGRV

&RQWUDWDFLRQHVHOHFWUyQLFDV
6L UHTXLHUHV XQ FRQWUDWR IRUPDO DO YHQGHU WX SURGXFWR R
VHUYLFLRRPD\RUFRQWUROVREUHTXLpQHVWiDFHSWDQGRORV
WpUPLQRV \ FRQGLFLRQHV GHO FRQWUDWR SXHGHV LQFOXLU XQ
FRQWUDWR PL[WR HQ HO TXH HOHFWUyQLFDPHQWH HO XVXDULR
GHVFDUJD HO FRQWUDWR OR LPSULPH ILUPD ItVLFDPHQWH \ OR
HQYtD SRU ID[ R FRUUHR SRVWDO (VWR SXHGH VHU XQ SRFR
WHGLRVR SHUR HV XQD RSFLyQ FXDQGR HO FRQVXPLGRU QR
WLHQHXQFHUWLILFDGRGLJLWDO
$KRUD SDVDUHPRV DO WHPD GH ORV FRPSUREDQWHV ILVFDOHV
GLJLWDOHV TXH VL ELHQ SDUHFLHUDQ QR WHQHU XQD UHODFLyQ
GLUHFWD FRQ OD ILUPD GH XQ FRQWUDWR HOHFWUyQLFR \D VRQ
SDUWHLQGLVSHQVDEOHGHFXDOTXLHUWUDQVDFFLyQGHFRPSUD
YHQWDVHDGHFRPHUFLRHOHFWUyQLFRRQR

Interiores.indd 340

5/9/13 6:29 PM

&RPSUREDQWHVILVFDOHVGLJLWDOHV
/RV &RPSUREDQWHV )LVFDOHV 'LJLWDOHV &)'  VRQ XQ
PHFDQLVPR SDUD OD FRPSUREDFLyQ ILVFDO GH LQJUHVRV
HJUHVRV \ SURSLHGDG GH PHUFDQFtDV HQ WUDVODGR SRU
PHGLRV HOHFWUyQLFRV TXH XWLOL]D ODV WHFQRORJtDV GH OD
LQIRUPDFLyQ SDUD OD JHQHUDFLyQ SURFHVDPLHQWR
WUDQVPLVLyQ \ UHVJXDUGR GH ORV GRFXPHQWRV ILVFDOHV GH
PDQHUD  GLJLWDO /RV FRPSUREDQWHV ILVFDOHV GLJLWDOHV
SHUPLWHQ D ODV HPSUHVDV DXWRPDWL]DU ORV SURFHVRV TXH
FRQIRUPDQ OD FDGHQD GH YDORU HYLWDQGR FRVWRV GH
DGPLQLVWUDFLyQ\UHVJXDUGRGHIDFWXUDVLPSUHVDV'HVGHHO
 HO 6$7 SURPRYLy ODV UHIRUPDV QHFHVDULDV SDUD
HVWDEOHFHU HO XVR GH OD )LUPD (OHFWUyQLFD $YDQ]DGD \
KDFHU SRVLEOH OD HPLVLyQ GH FRPSUREDQWHV ILVFDOHV
GLJLWDOHVRIDFWXUDHOHFWUyQLFD

&RPSUREDQWHVILVFDOHVGLJLWDOHV
/RV&)'VRQtQWHJURVDXWpQWLFRVYHULILFDEOHV\~QLFRV\
GLVPLQX\HQORVULHVJRVGHIUDXGH\HYDVLyQILVFDO\DTXH
SHUPLWHQFRPSUREDUODVRSHUDFLRQHVUHDOL]DGDVHQWUHORV
FRQWULEX\HQWHV
(QWUH ORV &)' VH HQFXHQWUD OD IDFWXUD HOHFWUyQLFD OD
QRWDGHFUpGLWRODQRWDGHFDUJRHOUHFLERGHKRQRUDULRV
UHFLERGHDUUHQGDPLHQWR\ODVFDUWDVSRUWH
7X\DH[SLGHVFHUWLILFDGRVGLJLWDOHV"
$ FRQWLQXDFLyQ KDEODUHPRV VREUH ORV SDVRV SDUD FXEULU
ORV UHTXLVLWRV GH H[SHGLFLyQ SDUD GHVSXpV GLVFXWLU OD
RSFLyQ GH KDFHU OD H[SHGLFLyQ SRU PHGLR GH XQ
SURYHHGRUDXWRUL]DGRRSRUPHGLRVSURSLRV

Interiores.indd 341

5/9/13 6:29 PM

&RPSUREDQWHVILVFDOHVGLJLWDOHV
3DUD FXEULU ORV UHTXLVLWRV GH H[SHGLFLyQ VH QHFHVLWDQ
VHJXLU ORV VLJXLHQWHV SDVRV ORV SULPHURV GRV ORV
FXEULPRVHQODOHFFLyQDQWHULRU
 7HQHU D OD PDQR VX ),(/ YLJHQWH X REWHQHUOD HQ OD
VLJXLHQWHGLUHFFLyQ
KWWSZZZVDWJREP[VLWLRBLQWHUQHWHBVDWWXBILUPD
7UDPLWDUXQ&HUWLILFDGRGH6HOOR'LJLWDO
 6ROLFLWDU DO 6$7 XQD VHULH GH IROLRV SDUD OOHYDU HO
FRQWURO GH ORV FRPSUREDQWHV ILVFDOHV GLJLWDOHV TXH
H[SLGD

&RPSUREDQWHVILVFDOHVGLJLWDOHV
3DUDVROLFLWDUIROLRVVHQHFHVLWD
 ,QJUHVDU D OD VHFFLyQ GH &RPSUREDQWHV )LVFDOHV
'LJLWDOHV\OXHJRD$SOLFDFLRQHV
'HVFDUJDUHOVRIWZDUHTXHVHHQFXHQWUDHQ2ILFLQD
9LUWXDO
,QJUHVDUD6,&2),SDUDVROLFLWDUORVIROLRV
&DSWXUDUVX5)&
6HOHFFLRQDUODVHULH\UDQJRGHIROLRV
,QJUHVDUVX)LHO\FODYHSULYDGD

Interiores.indd 342

5/9/13 6:29 PM

&RPSUREDQWHVILVFDOHVGLJLWDOHV
8QD GH ODV SULPHUDV GHFLVLRQHV DO LQWHJUDU
FRPSUREDQWHV ILVFDOHV GLJLWDOHV HV VL VH KDUi SRU
PHGLRVSURSLRVRDWUDYpVGHXQWHUFHUR(OGHODV
HPSUHVDV FRUSRUDWLYDV KDQ RSWDGR SRU XQ VLVWHPD
SDUD KDFHU OD HPLVLyQ GH IRUPD LQWHUQD PLHQWUDV TXH
HO  GH ODV SHUVRQDV ItVLFDV FRQ DFWLYLGDG
HPSUHVDULDO PLFUR \ SHTXHxDV HPSUHVDV KDQ RSWDGR
SRUDFXGLUDXQSURYHHGRUDXWRUL]DGR
(QODSiJLQDGHO6$7VHSXHGHHQFRQWUDUODOLVWDGHORV
SURYHHGRUHV DXWRUL]DGRV 3$&)'  (Q FDVR GH RSWDU
SRU HVWD VROXFLyQ VH GHEHQ FRQVLGHUDU ORV VLJXLHQWHV
SXQWRV

&RPSUREDQWHVILVFDOHVGLJLWDOHV
 6H SXHGHQ FRQWUDWDU ORV VHUYLFLRV GH XQR R PiV
SURYHHGRUHVSHURODVVHULHVGHIROLRV\FHUWLILFDGRVGH
VHOORGLJLWDOGHEHQVHUGLIHUHQWHVSDUDFDGDXQR
/DDGPLQLVWUDFLyQ\HOFRQWUROGHORVFHUWLILFDGRVGH
VHOOR GLJLWDO OD OR SRGUi WHQHU HO FRQWULEX\HQWH R HO
SURYHHGRU
6HGHEHUHDOL]DUXQFRQWUDWR
/DXWLOL]DFLyQGHVHUYLFLRVGHXQ3$&)'QROLEHUDDO
FRQWULEX\HQWHGHVXVREOLJDFLRQHVILVFDOHV

Interiores.indd 343

5/9/13 6:29 PM

(Q FDPELR VL VH GHFLGH HPLWLU ORV &)' GH PDQHUD
LQWHUQDVHGHEHUiDGTXLULUXQDVROXFLyQTXHVHLQWHJUD
D OD SURSLD LQIUDHVWUXFWXUD \ SHUPLWH FXPSOLU FRQ ORV
UHTXLVLWRV GHO 6$7 (VWRV VLVWHPDV GHEHQ UHDOL]DU ODV
VLJXLHQWHVWDUHDV
(PLVLyQGHORVGDWRVIXHQWHGHIDFWXUDFLyQGHOD
HPSUHVDHQIRUPDVLVWHPDWL]DGD
$VLJQDFLyQVHFXHQFLDO\QRUHSHWLGDGHODVVHULHV\
IROLRVILVFDOHV
*HQHUDFLyQGHODFDGHQDRULJLQDO
&iOFXORHLQFOXVLyQGHOVHOORGLJLWDO
5HVJXDUGRGHODIDFWXUDHOHFWUyQLFD ;0/ \
$IHFWDFLyQFRQWDEOH

&RPSUREDQWHVILVFDOHVGLJLWDOHV
$VtHO6$7UHFRQRFHODVVLJXLHQWHVREOLJDFLRQHVSDUDTXLHQHV
KDFHQIDFWXUDFLyQHOHFWUyQLFD &)' SRUPHGLRVSURSLRV
/OHYDUFRQWDELOLGDGHQXQVLVWHPDHOHFWUyQLFR
&RQWDUFRQ)LUPD(OHFWUyQLFD$YDQ]DGD)LHO
+DEHU WUDPLWDGR DO PHQRV XQ &)' &HUWLILFDGR GH 6HOOR
'LJLWDO
6ROLFLWDUSRUORPHQRVVHULHGHIROLRVDO6$7
&XPSOLUFRQHOHVWiQGDUWHFQROyJLFRUHFRQRFLGRSRUHO6$7
8WLOL]DU HO ;6' SDUD OD JHQHUDFLyQ GH )DFWXUDV (OHFWUyQLFDV
&)'  VHJ~Q OR SXEOLFDGR HQ HO LQFLVR % GHO $SDUWDGR , GHO
P%  $QH[R  GH OD 5HVROXFLyQ 0LVFHOiQHD )LVFDO SDUD

*HQHUDFLyQ\HQYtRGHOLQIRUPHPHQVXDO

Interiores.indd 344

5/9/13 6:29 PM

&LHUUH
&RQ HVWR FRQFOXLPRV HVWD OHFFLyQ VREUH FRQWUDWDFLRQHV
HOHFWUyQLFRV \ &RPSUREDQWHV ILVFDOHV GLJLWDOHV (O
PRGHORGHQHJRFLRGHWXHPSUHVDGHWHUPLQDUiHOWLSRGH
FRQWUDWR HOHFWUyQLFR TXH QHFHVLWDV 3UREDEOHPHQWH HQ
WXV QHJRFLDFLRQHV FRQ RWUDV HPSUHVDV WHQGUiV TXH
XWLOL]DU XQ FRQWUDWR IRUPDO LQFRUSRUDQGR FHUWLILFDGRV
GLJLWDOHV \ HQ WXV YHQWDV D FOLHQWHV SRGUiV LQFOXLU XQ
ERWyQSDUDTXHpVWRVDFHSWHQORVWpUPLQRV\FRQGLFLRQHV
GHODWUDQVDFFLyQ3RU~OWLPRUHFXHUGDTXHHO6$7HVHO
RUJDQL]PR HQFDUJDGR GH HPLWLU WXV &RPSUREDQWHV
ILVFDOHVGLJLWDOHVQHFHVDULRVSDUDFRPSUREDUORVLQJUHVRV
\ HJUHVRV GH WX HPSUHVD (Q OD VLJXLHQWH OHFFLyQ
KDEODUHPRV VREUH ORV GHOLWRV LQIRUPiWLFRV \ OR TXH
SXHGHVKDFHUSDUDSUHYHQLUORV

Interiores.indd 345

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin #16: Seguridad
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 16 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Define contratacin.

2. A qu se le considera una contratacin electrnica?

3. En Mxico se utiliza la Ley Modelo de la Comisin de las Naciones Unidas para el


Derecho Mercantil Internacional que proporciona criterios para determinar el valor
jurdico de los mensajes electrnicos. A continuacin presentamos algunos de estos
criterios. Por favor explcalos.
a) Consentimiento:
b) Jurisdiccin competente y ley aplicable:
4. Por qu es importante pedir a tus clientes que acepten los trminos y condiciones de tu
sitio web?

5. Los ______________________ son un mecanismo para la comprobacin fiscal de


ingresos, egresos y propiedad de mercancas en traslado por medios electrnicos, que
utiliza las tecnologas de la informacin para la generacin, procesamiento, transmisin
y resguardo de los documentos fiscales de manera 100% digital.
6. Enlista 4 tipos de CFD:
a)
b)
c)
d)

Interiores.indd 346

5/9/13 6:29 PM

7. Investiga un poco mas a fondo sobre este tema en el sitio oficial del SAT:
http://www.sat.gob.mx/sitio_internet/asistencia_contribuyente/principiantes/comprobante
s_fiscales/

8. Numera por orden las acciones a realizar para solicitar folios:


____ Ingresar su Fiel y clave privada
____ Ingresar a SICOFI para solicitar los folios
____ Ingresar a la seccin de Comprobantes Fiscales Digitales y luego a Aplicaciones
____ Capturar su RFC
____ Seleccionar la serie y rango de folios
____ Descargar el software que se encuentra en Oficina Virtual
9. En la leccin se mencion que hay diferentes maneras de gestionar la emisin de CFD.
El SAT impone ciertas obligaciones para quienes hacen facturacin electrnica (CFD)
por medios propios. Menciona 3:
a)
b)
c)
10. Ingresa al sitio del SAT y revisa la lista de proveedores autorizados (PACFD) para emitir
CFD, en caso que quieras optar por esta opcin.

Interiores.indd 347

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 17
Seguridad 3:
Delitos informticos
Duracin:

30 min

Objetivo de aprendizaje: Analizar las diferentes formas de delitos informticos con el fin
de poner en prctica las medidas de seguridad que le protejan
de acciones fraudulentas.
Subtemas:

Dimensiones de seguridad
Delitos informticos
Estrategias de seguridad

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

D 5:
- Texto en el fondo: Integridad, Irrepudiabilidad

D 2:
- Texto en el fondo

- Consideraciones iniciales
1. Dimensiones de seguridad

Interiores.indd 348

D 6:
- Texto en el fondo: autenticidad,
confidencialidad, privacidad, disponibilidad

5/9/13 6:29 PM

2. Delitos informticos

D 7:
- Diagrama de puntos vulnerables

2.1 Cdigo malicioso


2.2 Phishing y Robo de identidad
2.3 Hacking
2.4 Spoofing y Spam
2.5 Fraude y robo de tarjeta de crdito
2.6 Ataques internos
3. Estrategias de seguridad
- Antivirus
- Sistema operativo
- Cifrado de mensajes
- Firewalls y servidores Proxy
- Sello AMIPCI

D 15:
- Diagrama con puntos vulnerables y medidas
preventivas
D 17:
- Texto en el fondo: Antivirus y logos de McAfee
y Norton
D 18:
- Texto en el fondo: Sistema operativo
D 19:
- Texto en el fondo: Cifrado de mensajes
D 22:
- Texto en el fondo: Secure Sockets Layer - SSL
D 23:
- cono del candado
D 24:
- Texto en el fondo: Firewall y Servidores proxy
- Imagen de firewall
D 28:
- cono sello AMIPCI y direccin web

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 349

D 21:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ6HJXULGDG 

,QIRUPDFLyQ*HQHUDO
+ROD6HJXLPRVFRQHOWHPDGH6HJXULGDG
(QHVWDVHVLyQGHVDUUROODUHPRVORV6XEWHPDV
'LPHQVLRQHVGHVHJXULGDG
'HOLWRV,QIRUPiWLFRV
(VWUDWHJLDVGHVHJXULGDG
(O2EMHWLYRGHDSUHQGL]DMHHVSHUDGRSDUDHVWDOHFFLyQ
HVTXHSXHGDVDQDOL]DUODVGLIHUHQWHVIRUPDVGH
GHOLWRVLQIRUPiWLFRVFRQHOILQGHSRQHUHQSUiFWLFDODV
PHGLGDVGHVHJXULGDGTXHOHSURWHMDQGHDFFLRQHV
IUDXGXOHQWDV

Interiores.indd 350

5/9/13 6:29 PM

,QWURGXFFLyQ
$Vt FRPR HO ,QWHUQHW KD FRQHFWDGR D SHUVRQDV \
DELHUWR HO DFFHVR D PiV \ PHMRUHV SURGXFWRV \
VHUYLFLRVDPHMRUSUHFLRHVLQQHJDEOHTXHWDPELpQKD
DELHUWRQXHYRVFDQDOHVGHOLFWLYRV(OGHOLWRLQIRUPiWLFR
VH GHILQH FRPR WRGD DTXHOOD FRQGXFWD LOtFLWD
VXVFHSWLEOH GH VHU VDQFLRQDGD SRU HO GHUHFKR SHQDO
FRQVLVWHQWH HQ HO XVR LQGHELGR GH FXDOTXLHU PHGLR
LQIRUPiWLFR 'HVJUDFLDGDPHQWH SDUD ORV FULPLQDOHV
VHKDYXHOWRDWUDFWLYRUREDUSRU,QWHUQHWGHELGRDTXH
HO DFWR QR VH FRPHWH GH PDQHUD ItVLFD \ H[LVWH XQ
VHQWLGRGHDQRQLPLGDGDOFRPHWHUOR

,QWURGXFFLyQ
$OLQLFLDUWXVLWLRGHFRPHUFLRHOHFWUyQLFRTXpDVSHFWRV
GHVHJXULGDGWHSUHRFXSDQ" SDXVDSDUDGDUWLHPSRGH
UHIOH[LyQ  7DO YH] TXH DOJXLHQ H[WHUQR SXHGD
PDQLSXODU OD LQIRUPDFLyQ GH WX VLWLR TXH DO QR FRQRFHU
FRQ TXLpQ HVWiV QHJRFLDQGR UHDOLFHQ XQ IUDXGH TXH
DOJXLHQREWHQJDLQIRUPDFLyQSULYDGDVREUHWLWXHPSUHVD
RWXVFOLHQWHV"7RGDVHVWDVSUHRFXSDFLRQHVVRQYiOLGDV
SRU OR TXH D FRQWLQXDFLyQ KDEODUHPRV VREUH ODV
GLPHQVLRQHV GH VHJXULGDG HQ OtQHD ORV GLIHUHQWHV WLSRV
GH GHOLWRV LQIRUPiWLFRV \ TXp VH SXHGH KDFHU SDUD
SURWHJHUWXVLWLRZHE\WXLQIRUPDFLyQSHUVRQDO

Interiores.indd 351

5/9/13 6:29 PM

'LPHQVLRQHVGH6HJXULGDG
([LVWHQVHLVGLPHQVLRQHVRDVSHFWRVGHVHJXULGDGSDUD
HOFRPHUFLRHOHFWUyQLFR\GHEHUiVDWHQGHUDFDGDXQD
GHHOODVSDUDFRQWDUFRQXQDVHJXULGDGFRPSOHWD
 ,QWHJULGDG SRGHU DVHJXUDU TXH OD LQIRUPDFLyQ TXH
VH GHVSOLHJD HQ HO VLWLR ZHE R TXH HV WUDQVPLWLGD R
UHFLELGDHQOtQHDQRKDVLGRDOWHUDGDSRUXQWHUFHURQR
DXWRUL]DGR3RUHMHPSORXQDWUDQVIHUHQFLDEDQFDULDHQ
OtQHDTXHHVUHGLUHFFLRQDGDDRWUDFXHQWD
 ,UUHSXGLDELOLGDG DVHJXUDU TXH ORV SDUWLFLSDQWHV QR
QLHJXHQ VXV DFFLRQHV HQ OtQHD &RPR VHUtD XQ
FRQVXPLGRUTXHQLHJDKDEHUKHFKRXQSHGLGRHQOtQHD

$XWHQWLFLGDGLGHQWLILFDUODLGHQWLGDGGHODSHUVRQD
RHQWLGDGFRQTXLHQVHQHJRFtD
 &RQILGHQFLDOLGDG OD KDELOLGDG GH DVHJXUDU TXH
PHQVDMHV \ GDWD HVWiQ GLVSRQLEOHV VRODPHQWH SDUD
DTXHOORVDXWRUL]DGRVDYHUORV
3ULYDFLGDG&RQWURODUHOXVRGHLQIRUPDFLyQTXHORV
FRQVXPLGRUHVSURYHHQDXQFRPHUFLDQWH
 'LVSRQLELOLGDG SRGHU DVHJXUDU TXH XQ VLWLR GH
FRPHUFLR HOHFWUyQLFR FRQWLQXDUi IXQFLRQDQGR FRPR
GHEH
7RPDQGR HQ FXHQWD HVWDV  GLPHQVLRQHV HQ WX
HVWUDWHJLD GH VHJXULGDG SRGUiV DVHJXUDU TXH ODV
GLIHUHQWHViUHDVGHWXVLWLRHVWDUiQSURWHJLGDV

Interiores.indd 352

5/9/13 6:29 PM

'HOLWRVLQIRUPiWLFRV
/RV GHOLWRV LQIRUPiWLFRV DWDFDQ XQD R PiV GH HVWDV
GLPHQVLRQHV\GHEHUiQVHUDWHQGLGDVSRUODVPHGLGDV
GHVHJXULGDGTXHWRPHV
'HVGH HO SXQWR GH YLVWD WHFQROyJLFR VH SXHGHQ
LGHQWLILFDUSXQWRVYXOQHUDEOHVHOFOLHQWHHOVHUYLGRU
\ OD YtD GH FRPXQLFDFLyQ $ FRQWLQXDFLyQ KDEODUHPRV
GHPDQHUDJHQHUDOVREUHODVDPHQD]DVPiVFRPXQHV
DHVWRVWUHVSXQWRV

&yGLJR0DOLFLRVR
&yGLJR 0DOLFLRVR R PDOZDUH HV XQ WLSR GH LQYDVLyQ
GRQGH VH HQFXHQWUDQ ORV  YLUXV ZRUPV FDEDOORV GH
7UR\D \ ERWV (Q HO SDVDGR ORV FyGLJRV PDOLFLRVRV
HVWDEDQ GLULJLGRV D SDUDOL]DU FRPSXWDGRUDV \ HUDQ
FUHDGRV SRU XQ VROR KDFNHU $KRUD HVWRV DWDTXHV
EXVFDQ UREDU FXHQWDV GH PDLO LQIRUPDFLyQ SHUVRQDO H
LQIRUPDFLyQ ILQDQFLHUD /RV YLUXV VRQ SURJUDPDV FRQ OD
FDSDFLGDG GH UHSOLFDUVH \ OOHJDU D RWURV DUFKLYRV /RV
YLUXV PXFKDV YHFHV HVWiQ FRPELQDGRV FRQ XQ ZRUP
TXH HQ YH] GH LU GH XQ DUFKLYR D RWUR EULQFD GH XQD
FRPSXWDGRUD D RWUD 8Q ZRUP QR WLHQH TXH HVWDU
QHFHVDULDPHQWHDFWLYDGDSDUDUHSOLFDUVH

Interiores.indd 353

5/9/13 6:29 PM

&yGLJR0DOLFLRVR
2WUR WLSR GH PDOZDUH VRQ ORV FDEDOORV GH 7UR\D
TXLHQHV DSDUHQWDQ VHU EHQLJQRV SHUR OXHJR VH
FRPSRUWDQ GH PDQHUD LQHVSHUDGD GDQGR HQWUDGD D
YLUXVRERWV/RVERWVVRQXQWLSRGHFyGLJRPDOLFLRVR
TXH SXHGH LQVWDODUVH HQ WX FRPSXWDGRUD GH IRUPD
HQFXELHUWD DO HVWDU FRQHFWDGR D ,QWHUQHW (O  GHO
VSDP ERWVHVHQWUHJDGRSRUERWVXQDYH]LQVWDODGR
HO ERW UHVSRQGH D FRPDQGRV H[WHUQRV GLULJLGRV SRU HO
DWDFDQWHTXLHQDGTXLHUHFRQWUROGHHOOD

3KLVKLQJ\5RERGHLGHQWLGDG
6LQ UHFXUULU D WHFQRORJtD PX\ VRILVWLFDGD FULPLQDOHV KDQ
ORJUDGR HQJDxDU D XVXDULRV DFXGLHQGR D VX FXULRVLGDG
DYDULFLDHLQJHQXLGDG6HFRQRFHFRPR3KLVKLQJDFXDOTXLHU
LQWHQWR GH REWHQHU LQIRUPDFLyQ FRQILGHQFLDO GH PDQHUD
HQJDxRVD SDUD SURYHFKR ILQDQFLHUR (VWH WLSR GH DWDTXH QR
XWLOL]DFyGLJRPDOLFLRVRPiVELHQHQJDxDDODVSHUVRQDVSDUD
TXH SURSRUFLRQHQ YROXQWDULDPHQWH VX LQIRUPDFLyQ EDQFDULD
8Q HMHPSOR GH FyPR FRQVLJXHQ HVWR HV HQYLDQGR XQ FRUUHR
HOHFWUyQLFRDQRPEUHGHXQDLQVWLWXFLyQILQDQFLHUDUHFRQRFLGD
(Q HO FRUUHR VH LQFOX\H XQD OLJD TXH DSDUHQWH VHU GH OD
LQVWLWXFLyQ \ DO DFFHGHU D HOOD SLGH TXH VH FRQILUPHQ GDWRV
ILQDQFLHURV XVXDULR FRQWUDVHxD HWF  \ HVWRV VRQ UHFLELGRV
SRUHOFULPLQDO

Interiores.indd 354

5/9/13 6:29 PM

+DFNLQJ
2WUDV YHFHV ORV FULPLQDOHV XWLOL]DQ VXV FRQRFLPLHQWRV
WHFQROyJLFRV SDUD DFFHGHU D LQIRUPDFLyQ FRQILGHQFLDO 6H
FRQRFH FRPR KDFNHU D LQGLYLGXRV TXH LQWHQWDQ REWHQHU
DFFHVRQRDXWRUL]DGRDVLVWHPDVFRPSXWDFLRQDOHV(VWROR
ORJUDQ DO HQFRQWUDU ORV SXQWRV GpELOHV GHO VLVWHPD GH
VHJXULGDG(QRFDVLRQHVORVKDFNHUVEXVFDQTXHEUDQWDUR
GHVWUXLU VLWLRV OR TXH VH FRQRFH FRPR FLEHUYDQGDOLVPR
PLHQWUDV TXH HQ RWURV FDVRV OR KDFHQ SDUD UREDU
LQIRUPDFLyQ SHUVRQDO R FRUSRUDWLYD TXH SXHGHQ XWLOL]DU
SDUDXQDJDQDQFLDHFRQyPLFD(PSUHVDVKDQRSWDGRSRU
FRQWUDWDU D SHUVRQDV FRQ HVWRV FRQRFLPLHQWRV SDUD TXH
LQWHQWHQ HQWUDU DO VLVWHPD \ DVt LGHQWLILFDU VXV SXQWRV
GpELOHV

6SRRILQJ\6SDP
(QRFDVLRQHVORVKDFNHUVXWLOL]DQWiFWLFDVSDUDRFXOWDU
VX YHUGDGHUD LGHQWLGDG FRQRFLGDV FRPR VSRRILQJ
(Q RFDVLRQHV ORJUDQ UHGLUHFFLRQDU XQD GLUHFFLyQ ZHE
GHPDQHUDTXHVLQGDUVHFXHQWDHOXVXDULRDFFHGHDO
VLWLR ZHE GHO KDFNHU \ QR D OD RULJLQDO /D SiJLQD
DSyFULID HV PX\ VLPLODU D OD RULJLQDO \ DPHQD]D OD
LQWHJULGDG GHO VLWLR (VWR OR KDFHQ FRQ HO ILQ GH UREDU
FOLHQWHV DO QHJRFLR RULJLQDO R DOWHUDU VX
IXQFLRQDPLHQWR KDFLHQGR FDPELRV HQ ORV SHGLGRV
KHFKRV ORJUDQGR TXH FOLHQWHV WHQJDQ XQD PDOD
H[SHULHQFLD\HOQHJRFLRGLILFXOWDGHVHQVXLQYHQWDULR

Interiores.indd 355

5/9/13 6:29 PM

)UDXGH\URERGHWDUMHWDVGHFUpGLWR
8QD GH ODV SULQFLSDOHV SUHRFXSDFLRQHV SDUD ORV
FRQVXPLGRUHVHVHOURERRIUDXGHGHWDUMHWDVGHFUpGLWR
(Q RFDVLRQHV FOLHQWHV SRWHQFLDOHV GHMDQ GH KDFHU XQD
FRPSUDSRUPLHGRDTXHODLQIRUPDFLyQGHVXWDUMHWDGH
FUpGLWRVHDUREDGD6LQHPEDUJRHVWHWLSRGHFULPHQQR
HV WDQ FRP~Q FRPR XQR SHQVDUtD \ ORV VLVWHPDV GH
VHJXULGDGFDGDYH]ORKDFHQPiVGLItFLO+R\HQGtDOD
PD\RUtD GH ORV KDFNHUV YDQ SRU ORV VHUYLGRUHV
FRUSRUDWLYRV GRQGH KD\ LQIRUPDFLyQ GH PLOORQHV GH
WDUMHWDV GH FUpGLWR 0iV DGHODQWH KDEODUHPRV VREUH
HVWUDWHJLDVSDUDRIUHFHUXQVLWLRVHJXURDWXVFOLHQWHV

$WDTXHVLQWHUQRV
'HVJUDFLDGDPHQWHDOJXQDVDPHQD]DVDODVHJXULGDG
GH XQ VLWLR SXHGHQ YHQLU GHO PLVPR SHUVRQDO GH WX
HPSUHVD$OPDQHMDUGDWRVVHQVLEOHVGHEHUiVHYDOXDU
TXLpQHV WHQGUiQ DFFHVR D HOORV \ HVWDEOHFHU SROtWLFDV
GH FRQILGHQFLDOLGDG GH LQIRUPDFLyQ (Q RFDVLRQHV HO
SHUVRQDO QR WHQGUi XQD PDOD LQWHQFLyQ SHUR
QHJOLJHQFLD GH VX SDUWH SXHGH OOHYDU D H[SRQHU GDWRV
FRQILGHQFLDOHV (V LPSRUWDQWH EULQGDU OD FDSDFLWDFLyQ
QHFHVDULDDXVXDULRVTXHSXGLHUDQSRQHUHQULHVJRHO
VLVWHPDRODLQIRUPDFLyQHQpO

Interiores.indd 356

5/9/13 6:29 PM

(VWUDWHJLDVGH6HJXULGDG
'HVSXpV GH HVWD ODUJD OLVWD GH GHOLWRV LQIRUPiWLFRV
SRGUi SDUHFHU TXH QR KD\ PXFKR TXH KDFHU SDUD
HYLWDUORV (V LQQHJDEOH TXH ODV DPHQD]DV DO FRPHUFLR
HOHFWUyQLFRVRQUHDOHVSHURWDPELpQHVXQDUHDOLGDGTXH
H[LVWH XQ JUDQ DYDQFH HQ HO GHVDUUROOR GH SURJUDPDV
SDUD HYLWDU HVWRV GHOLWRV $ FRQWLQXDFLyQ KDEODUHPRV
VREUHORTXHSXHGHKDFHUXQVLWLRGHHFRPPHUFHSDUD
TXH VHD GLItFLO TXH LQYDGDQ R GHVWUX\DQ HO VLWLR
5HFXHUGD TXH ODV DPHQD]DV D OD VHJXULGDG GH WX VLWLR
SXHGHQVHUDQLYHOGHYtDVGHFRPXQLFDFLyQGHOVHUYLGRU
R GHO FOLHQWH $QDOL]HPRV RSFLRQHV SDUD SURWHJHU FDGD
XQR

(VWUDWHJLDVGH6HJXULGDG
8QDVROXFLyQLQLFLDOHVLQVWDODUXQVRIWZDUH$QWLYLUXVHO
FXDOGHWHFWDYLUXV\ORVHOLPLQDRDtVODHQODFRPSXWDGRUD
SDUDTXHQRSXHGDQFRUUHU6\PDQWHF 1RUWRQ$QWLYLUXV 
\ 0F$IHH VRQ GRV GH ODV FRPSDxtDV GH VRIWZDUH
DQWLYLUXV PiV UHFRQRFLGDV 6LQ HPEDUJR HVWH WLSR GH
VRIWZDUH VyOR VHUi HIHFWLYR VL VH PDQWLHQH DFWXDOL]DGR
(VWR VH GHEH D TXH IUHFXHQWHPHQWH VH LQWURGXFHQ
QXHYRVYLUXV\ODVDFWXDOL]DFLRQHVDJUHJDQHVWRVQXHYRV
YLUXV D OD OLVWD SDUD TXH VHDQ UHFRQRFLGRV \ HOLPLQDGRV
3XHGHV SUHGHWHUPLQDU WX VRIWZDUH SDUD TXH YHULILTXH
GLDULDPHQWHVLKD\DFWXDOL]DFLRQHV\ODVGHVFDUJXH

Interiores.indd 357

5/9/13 6:29 PM

(VWUDWHJLDVGH6HJXULGDG
$OLJXDOTXHHOVRIWZDUHDQWLYLUXVXQDGHODVPDQHUDV
PiV VLPSOHV GH SURWHJHU WXV VHUYLGRUHV \ FOLHQWHV HV
WHQHUDFWLYDGDODDFWXDOL]DFLyQDXWRPiWLFDGHOVLVWHPD
RSHUDWLYR GH WXV FRPSXWDGRUDV 7DQWR :LQGRZV
FRPR $SSOH FRQWLQXDPHQWH PHMRUDQ VXV VLVWHPDV
SDUD FXEULU ODV YXOQHUDELOLGDGHV GHVFXELHUWDV SRU
KDFNHUV /DV GHVFDUJDV GH HVWRV SDUFKHV GH
VHJXULGDG VRQ JUDWXLWDV \ ORV YLUXV \ ZRUPV PiV
FRPXQHVSXHGHQVHUSUHYHQLGRVVLPSOHPHQWHDOWHQHU
WXVVLVWHPDVRSHUDWLYRVDOGtD

(VWUDWHJLDVGH6HJXULGDG
2WUD RSFLyQ GH SURWHFFLyQ EiVLFD H LQGLVSHQVDEOH HV HO
FLIUDGRGHPHQVDMHVTXHHVHOSURFHVRGHWUDQVIRUPDU
WH[WRRGDWDHQWH[WRFLIUDGRTXHQRSXHGHVHUOHtGRSRU
QDGLH PiV TXH HO HPLVRU \ HO UHFHSWRU (O SURSyVLWR GH
HVWD HVWUDWHJLD HV SURWHJHU LQIRUPDFLyQ JXDUGDGD \
WUDQVPLWLGD /RV FHUWLILFDGRV GLJLWDOHV SHUPLWHQ
DXWHQWLFDUTXLpQHQYtDHOPHQVDMHRTXLpQHVWiGHWUiVGH
XQ VLWLR ZHE(O FLIUDGR DWLHQGH  GH ODV  GLPHQVLRQHV
GHVHJXULGDGYLVWDVDOLQLFLRGHODOHFFLyQLQWHJULGDGGHO
PHQVDMH
LUUHSXGLDELOLGDG
DXWHQWLFDFLyQ
\
FRQILGHQFLDOLGDG

Interiores.indd 358

5/9/13 6:29 PM

/RV FHUWLILFDGRV GLJLWDOHV \ OD FODYH GH LQIUDHVWUXFWXUD


S~EOLFD EXVFDQ VROXFLRQDU HO SUREOHPD GH OD LGHQWLGDG
GLJLWDO$VtDOHQWUDUDXQVLWLRVHJXURHO85/HPSH]DUi
FRQKWWSV\DSDUHFHUiHOtFRQRGHXQFDQGDGRFHUUDGR
HQ HO QDYHJDGRU (Q OD OHFFLyQ DQWHULRU KDEODPRV VREUH
FyPR REWHQHU XQ FHUWLILFDGR GLJLWDO HV LPSRUWDQWH VDEHU
TXHVHSXHGHQSURFHVDUSDUDXVRSHUVRQDOLQVWLWXFLRQDO
SDUD XQ VHUYLGRU :HE SDUD HGLWRU GH VRIWZDUH R SDUD
XQD DXWRULGDG FHUWLILFDGRUD 3DUD ILQHV FRPHUFLDOHV HO
FHUWLILFDGR SXHGH VHU VROLFLWDGR SRU HO FOLHQWH DQWHV GH
LQLFLDU XQD WUDQVDFFLyQ \ GHFLIUDUOR XWLOL]DQGR OD OODYH
S~EOLFD GHO FRPHUFLDQWH SDUD REWHQHU WDQWR HO PHQVDMH
FRPRHOFHUWLILFDGRGLJLWDO

(VWUDWHJLDVGH6HJXULGDG
6L HO PHQVDMH FRLQFLGH FRQ HO FHUWLILFDGR HQWRQFHV HO
FRPHUFLDQWH \ OD OODYH VRQ DXWHQWLFDGDV (O
FRPHUFLDQWHDVXYH]SXHGHVROLFLWDUHOFHUWLILFDGRGHO
XVXDULRSDUDDXWHQWLFDUVXLGHQWLGDG
$GHPiV GH SURWHJHU ORV PHQVDMHV TXH VH WUDQVPLWHQ
HQ OtQHD VH GHEH EXVFDU SURWHJHU HO FDQDO GH
FRPXQLFDFLyQ(OFRQFHSWRGHFLIUDGRGHFODYHS~EOLFD
VH XWLOL]D UXWLQDULDPHQWH SDUD DVHJXUDU HVWD iUHD  /D
IRUPDPiVFRP~QGHKDFHUORHVDWUDYpVGHO6HFXUH
6RFNHWV /D\HU 66/  R FDSD GH FRQH[LyQ VHJXUD
XQ QXHYR WLSR GH FHUWLILFDGR TXH LQFOX\HQ
SURFHGLPLHQWRVGHYHULILFDFLyQPiVH[WHQVRV

Interiores.indd 359

5/9/13 6:29 PM

(O 66/ VH XWLOL]D SDUD WHQHU VHVLRQHV VHJXUDV GH


FOLHQWHVHUYLGRU HQ ODV TXH HO 85/ FRQWHQLGRV
IRUPXODULRV\FRRNLHVLQWHUFDPELDGDVHVWDUiQFLIUDGDV
3RU HMHPSOR VL FDSWXUDV HO Q~PHUR GH WX WDUMHWD GH
FUpGLWR HQ XQ IRUPXODULR FRQ 66/ pVWH VHUi FLIUDGR
SDUDTXHQRSXHGDVHUREWHQLGRSRUXQWHUFHUR
(OFHUWLILFDGR66/HVHPLWLGRSDUDHOVHUYLGRUSRUXQD
HQWLGDG FHUWLILFDQWH DXWRUL]DGD SRU HO JRELHUQR
&XDQGR XQD SHUVRQD TXLHUH DEULU XQD SiJLQD VX
QDYHJDGRU YHULILFD VL HO VLWLR WLHQH XQ FHUWLILFDGR TXH
SXHGHUHFRQRFHU6LHOVLWLRQRHVUHFRQRFLGRSRUXQD
HQWLGDG FHUWLILFDQWH GH FRQILDQ]D HO QDYHJDGRU
PRVWUDUiXQDYLVRDOXVXDULRSUHYLQLpQGROR

(VWUDWHJLDVGH6HJXULGDG
2WUD iUHD TXH UHTXLHUH VHU SURWHJLGD HV WX UHG
LQFOX\HQGR WXV VHUYLGRUHV \ FOLHQWHV HQ HVD UHG
3UREDEOHPHQWH KDV HVFXFKDGR KDEODU GH ILUHZDOOV \
VHUYLGRUHVSUR[\(VWDVHVWUDWHJLDVDFW~DQFRPRXQD
SDUHGFRQVWUXLGDDOUHGHGRUGHWXUHG8QILUHZDOOHVHO
KDUGZDUH R VRIWZDUH TXH ILOWUD ORV SDTXHWHV GH
FRPXQLFDFLyQ \ SUHYLHQH D DOJXQRV HQWUDU D OD UHG
EDViQGRVH HQ SROtWLFDV GH VHJXULGDG 7RGRV ORV
PHQVDMHVTXHVRQHQYLDGRVRUHFLELGRVGHVGHODUHGVRQ
SURFHVDGRV SRU HO ILUHZDOO \ pVWD GHWHUPLQD VL HO
PHQVDMHFXPSOHFRQODJXtDGHVHJXULGDGHVWDEOHFLGD

Interiores.indd 360

5/9/13 6:29 PM

(VWUDWHJLDVGH6HJXULGDG
3RU VX SDUWH ORV VHUYLGRUHV SUR[\ VH VRIWZDUH TXH
DGPLQLVWUD WRGDV ODV FRPXQLFDFLRQHV RULJLQDGDV R
HQYLDGDVDO,QWHUQHW(QJHQHUDOORVSUR[LHVOLPLWDQHO
DFFHVR GH FOLHQWHV LQWHUQRV D VHUYLGRUHV GH ,QWHUQHW
H[WHUQRV\IXQFLRQDQFRPRXQDSXHUWDFRPXQLFDQGRD
OD UHG LQWHUQD FRQ OD H[WHUQD $Vt FXDQGR XQ XVXDULR
SLGH XQD SiJLQD ZHE HO VHUYLGRU SUR[\ YDOLGD DO
XVXDULR \ VX SHGLGR VL HV YiOLGR HQYtD HO SHGLGR DO
,QWHUQHW D VX YH] HYDOXDUi OD UHVSXHVWD \ GH VHU
YDOLGDGDODHQYtDDOXVXDULRTXLHQDKRUDSRGUiYHUOD
SiJLQDZHEVROLFLWDGD

(VWUDWHJLDVGH6HJXULGDG
(V LQQHJDEOH TXH ORV GLVSRVLWLYRV PyYLOHV WDPELpQ
SXHGHQ VHU DIHFWDGRV SRU PDOZDUH R KDFNHUV (Q
JHQHUDO HVWRV GLVSRVLWLYRV VH HQIUHQWDQ D ORV PLVPRV
ULHVJRVTXHFXDOTXLHUFRPSXWDGRUDFRQHFWDGDD,QWHUQHW
HLQFOXVLYHDSDUHFHQQXHYRVULHVJRVUHODFLRQDGRVFRQOD
VHJXULGDG GH UHGHV LQDOiPEULFDV /D JUDQ SUHRFXSDFLyQ
VHHQFXHQWUDHQODGHVFDUJDGH$SSVTXHDOVHUFUHDGDV
SRU XVXDULRV H[WHUQRV SXHGHQ FRQWHQHU PDOZDUH R
DFFHVDU OD LQIRUPDFLyQ HQ WX GLVSRVLWLYR &RPR
SURWHFFLyQ HV LPSRUWDQWH OHHU ORV SHUPLVRV VROLFLWDGRV
SRUHO$SSDOVHUGHVFDUJDGR\SHUPLWLUVyORDTXHOORVTXH
QRSUHVHQWHQXQULHVJR

Interiores.indd 361

5/9/13 6:29 PM

(VWUDWHJLDVGH6HJXULGDG
2WUD PHGLGD LPSRUWDQWH HV GHVFDUJDU ODV
DFWXDOL]DFLRQHV DO VLVWHPD RSHUDWLYR HQ FXDQWR
DSDUH]FDQ\DTXHSUREDEOHPHQWHLQFOXLUiQSDUFKHVD
IDOODV GH VHJXULGDG GHWHFWDGDV $Vt FRPR
UHFRPHQGDPRVLQVWDODUXQDQWLYLUXVHQFRPSXWDGRUDV
GHEHV LQVWDODU XQ $SS GH VHJXULGDG HQ WX GLVSRVLWLYR
PyYLO
$QGURLG %LWGHIHQGHU )6HFXUH /RRNRXW7UXVW*R
(6(7
%ODFNEHUU\\$QGURLG0F$IHH

7H SUHJXQWDUiV FyPR OH EULQGR D PLV FOLHQWHV OD


FRQILDQ]DGHHVWDUHQXQVLWLRVHJXUR\SURWHJLGR"8QD
RSFLyQ HQ 0p[LFR HV DxDGLU HO eVWH HV XQ GLVWLQWLYR
RWRUJDGRSRUOD$VRFLDFLyQ0H[LFDQDGH,QWHUQHWSDUD
VLWLRV GH ,QWHUQHW HQ 0p[LFR D WUDYpV GH XQ VHOOR
HOHFWUyQLFR FRQ XQ FHUWLILFDGR GLJLWDO DGMXQWR TXH
UHFRQRFH D ORV QHJRFLRV R LQVWLWXFLRQHV TXH
SURPXHYHQ HO FXPSOLPLHQWR GH OD SULYDFLGDG GH OD
LQIRUPDFLyQ \ HVWiQ OHJtWLPDPHQWH HVWDEOHFLGRV 3DUD
REWHQHUORLQJUHVDVDVXVLWLRZHEYHULILFDVTXHWXVLWLR
FXPSOD FRQ ORV UHTXLVLWRV FRPSOHWDV XQ IRUPXODULR \
UHDOL]DVHOSDJRFRUUHVSRQGLHQWH

Interiores.indd 362

5/9/13 6:29 PM

&LHUUH
5HFXHUGD TXH ODV DPHQD]DV D ORV VLWLRV GH FRPHUFLR
HOHFWUyQLFR VRQ UHDOHV SRU OR TXH GHEHV GH WRPDU
WRGDV ODV PHGLGDV SUHYHQWLYDV QHFHVDULDV SDUD
SURWHJHUWXVLWLR\ODLQIRUPDFLyQSULYDGDGHOQHJRFLR\
WXV FOLHQWHV 1R ROYLGHV DFWXDOL]DU VRIWZDUH DQWLYLUXV \
HOVLVWHPDRSHUDWLYRFRQVWDQWHPHQWHSDUDSURWHJHUWXV
FRPSXWDGRUDV DFpUFDWH D XQD HQWLGDG FHUWLILFDGD
DXWRUL]DGDSDUDFRGLILFDUODLQIRUPDFLyQTXHHQYtHVHQ
OtQHDHLQVWDODILUHZDOOVSDUDSURWHJHUWXVVHUYLGRUHV
&RQ HVWD OHFFLyQ WHUPLQDPRV FRQ HO WHPD GH
VHJXULGDG$FRQWLQXDFLyQKDEODUHPRVVREUHDVSHFWRV
VRFLDOHVFRPROH\HV\pWLFDDIHFWDGRVSRUHOFRPHUFLR
HOHFWUyQLFR

Interiores.indd 363

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin #17: Seguridad
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 17 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. Una vez que concluiste la leccin. Qu entiendes por delito informtico?

2. Qu aspectos de seguridad le preocupan a los cibernautas?

3. Define las 6 dimensiones de seguridad en el comercio electrnico:


a) Irrepudiabilidad
b) Integridad
c) Autenticidad
d) Confidencialidad
e) Privacidad
f) Disponibilidad

4. Enlista 4 amenazas comunes (virus) que hayamos mencionado en la leccin


5. Quin es un hacker?

6. Qu acciones pueden llevarse a cabo para evitar o prevenir delitos informticos?


7. Menciona dos Antivirus de uso libre o gratuito:
a)
b)

Interiores.indd 364

5/9/13 6:29 PM

8. Cmo se relacionan los certificados digitales y las PKI con la seguridad digital?

9. Qu es un SSL Secure Socket Layer?

10. Define las siguientes protecciones de red:


a) Firewall
b) Servidores Proxy

Interiores.indd 365

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 18
Leyes y tica para el comercio electrnico
Duracin:

30 min

Objetivo de aprendizaje: Conocer la regulacin de las autoridades para proteger la


privacidad del consumidor y sus datos personales, as como
los cuestionamientos ticos de la propiedad intelectual en la
era digital.
Subtemas:

Privacidad y proteccin de datos personales


Proteccin al consumidor
Propiedad Intelectual

Requisitos:

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:
Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D 1:
- Texto en el fondo

Desarrollo

Diapositiva 3:
- Incluir definicin de "Derecho a la privacidad
en el fondo": se refiere al derecho que
tenemos las personas de evitar intrusiones de
terceros a sus asuntos personales

1. Privacidad y Proteccin de Datos Personales


- A qu se le considera como datos personales?
- Derecho a la privacidad
-Reglamento de la Ley Federal de Proteccin de
Datos Personales en Posesin de los Particulares

Interiores.indd 366

Notas de Produccin:

D 2:
- Texto en el fondo

D8:
- Texto: Ley Federal de Proteccin de Datos

5/9/13 6:29 PM

- Qu es un aviso de privacidad y cmo


generarlo?

Personales
D9:
- Texto:
1. licitud
2. consentimiento
3. calidad
4. informacin
5. proporcionalidad
6. responsabilidad
D11:
- Texto de fondo:
1. Quin recopila los datos personales?
2. Qu datos se recopilan?
3. Con qu finalidad?
4. Cmo limitar su uso y divulgacin?
5. Cmo revocar su uso?
6. Procedimiento para ejercer sus derechos de
acceso, rectificacin, correccin y oposicin
7. La forma en que se comunican cambios a
este aviso
8. La aceptacin o negativa para autorizar la
transferencia de datos a terceros
D 12:
- Ejemplo de un aviso de privacidad
D 13:
- Texto de fondo:
1 Garantizar el derecho de acceso de las
personas a la informacin pblica
gubernamental.
2 Proteger los datos personales que estn
en manos tanto del gobierno federal,
como de particulares.
Y resolver los reclamos sobre las negativas de
acceso a la informacin que hayan formulado
a los solicitantes.

2. Proteccin al consumidor

D 14:
- Texto: Directrices para la Proteccin de los
Consumidores en el Contexto del Comercio
Electrnico"
D 15- 16:
- Texto de fondo:
1. verificar la identidad del proveedor
2. asegurar que el negocio o vendedor hace

Interiores.indd 367

5/9/13 6:29 PM

una descripcin veraz de los productos


3. Notificar al consumidor sobre las
condiciones y formas de pago
D 17:
- Que aparezca en el fondo:
http://www.profeco.gob.mx/
y http://www.econsumer.gov/
3. Propiedad Intelectual
- La propiedad intelectual y los derechos de autor
- Retos a la propiedad intelectual
- Creative commons

D 20:
- Logotipo INDAUTOR e IMPI y sus
direcciones web
D 23:
- imagen de CC, espectro de derechos
reservados
D 25:
- Demostracin en el navegador

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 368

D 27:
- Pasar las preguntas de reflexin en el fondo
de la pantalla para que comenten en el foro

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ/H\HV\eWLFD

,QWURGXFFLyQ
+ROD GH QXHYR HQ OD OHFFLyQ DQWHULRU FRQFOXtPRV
FRQ HO WHPD GH 6HJXULGDG HQ /tQHD \ DKRUD
FRPHQ]DUHPRV FRQ XQ WHPD UHODFLRQDGR D FyPR
LPSDFWDHOHFRPPHUFHHQWHPDVVRFLDOHVDVtTXH
QRV HQIRFDUHPRV HQ OH\HV \ pWLFD HQ HO FRPHUFLR
HOHFWUyQLFR
3RUHOORHOWHPDJHQHUDOGHODVHVLyQVHUi/H\HV
\eWLFD\GHVDUUROODUHPRVORVVXEWHPDV
 3ULYDFLGDG\3URWHFFLyQGHGDWRVSHUVRQDOHV
 3URWHFFLyQDOFRQVXPLGRU
 3URSLHGDG,QWHOHFWXDO

Interiores.indd 369

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(O2EMHWLYRGHDSUHQGL]DMHHVSHUDGRHVTXHFRQR]FDV
OD UHJXODFLyQ GH ODV DXWRULGDGHV SDUD SURWHJHU OD
SULYDFLGDGGHOFRQVXPLGRU\VXVGDWRVSHUVRQDOHVDVt
FRPR ORV FXHVWLRQDPLHQWRV pWLFRV GH OD SURSLHGDG
LQWHOHFWXDOHQODHUDGLJLWDO

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
(O DXJH GH ,QWHUQHW WDPELpQ KD WUDtGR QXHYDV
FRQVLGHUDFLRQHVVREUHHOGHUHFKRGHSULYDFLGDGGHORV
LQGLYLGXRV\HOXVRGHGDWRVSHUVRQDOHV
+R\HQGtDSRUOH\HV\ODSUiFWLFDLQWHUQDFLRQDO\DQR
HV SRVLEOH VROLFLWDU \ JXDUGDU ORV GDWRV SHUVRQDOHV GH
ORV FRQVXPLGRUHV FRPR VH SRGtD KDFHU DQWHV DKRUD
DO UHDOL]DU DOJXQD FRPSUD SRU ,QWHUQHW OD HPSUHVD
LQWHUPHGLDULD SXHGH VROLFLWDU DOJXQRV GDWRV
SHUVRQDOHV VLQ HPEDUJR VH GHEH DVHJXUDU TXH VH
FXLGDUDQ \D TXH H[LVWHQ VDQFLRQHV \ SpUGLGD GH
SHUPLVRVSRUHOPDOXVRGHORVPLVPRV

Interiores.indd 370

5/9/13 6:29 PM

3URWHFFLyQGHGDWRVSHUVRQDOHV
(O GHUHFKR D OD SULYDFLGDG VH UHILHUH DO GHUHFKR TXH
WHQHPRVODVSHUVRQDVGHHYLWDULQWUXVLRQHVGHWHUFHURV
DVXVDVXQWRVSHUVRQDOHV
&RPR SDUWH GH HVWH GHUHFKR VH HQFXHQWUD OD
SULYDFLGDGGHODLQIRUPDFLyQRHOGHUHFKRDTXHFLHUWD
LQIRUPDFLyQ VHD SULYDGD \ QR UHFROHFWDGD SRU
JRELHUQRV R HPSUHVDV DVt FRPR HO GHUHFKR D WHQHU
FRQWURO GHO XVR GH OD LQIRUPDFLyQ SHUVRQDO TXH HV
UHFROHFWDGD
4XpHQWLHQGHVSRUGDWRVSHUVRQDOHV"

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
3RU GDWRV SHUVRQDOHV QRV UHIHULPRV D QRPEUH
WHOpIRQR GRPLFLOLR FRUUHR HOHFWUyQLFR HGDG
RFXSDFLyQ IRWRJUDItDV R FXDOTXLHU RWUR GDWR TXH
LGHQWLILTXH R SXHGD VHUYLU SDUD LGHQWLILFDU D XQD
SHUVRQD
/RV UHWRV LPSXHVWRV DO GHUHFKR D OD SULYDFLGDG GH OD
LQIRUPDFLyQ VH SUHVHQWDQ WDQWR SDUD HO VHFWRU SULYDGR
FRPR SDUD  HO S~EOLFR \D TXH VH OHV FXHVWLRQD OD
FDQWLGDGGHLQIRUPDFLyQTXHUH~QHQ\HOXVRTXHOHGD
(V LQQHJDEOH FLHUWR WHPRU D TXH HVWD LQIRUPDFLyQ
WHUPLQHHQODVPDQRVHTXLYRFDGDV

Interiores.indd 371

5/9/13 6:29 PM

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
/RV VLWLRV GH HFRPPHUFH UHFROHFWDQ LQIRUPDFLyQ GH
ORV FRQVXPLGRUHV TXH YLVLWDQ VX VLWLR \ GH ORV TXH
KDFHQFRPSUDV(VWDLQIRUPDFLyQSHUPLWHHQWHQGHUODV
QHFHVLGDGHVFDUDFWHUtVWLFDV\FRPSRUWDPLHQWRVGHORV
FRQVXPLGRUHV \ GLULJLU FDPSDxDV SXEOLFLWDULDV
HVSHFtILFDV SDUD FDGD WLSR GH FRQVXPLGRU VLQ
HPEDUJR OD SULYDFLGDG GH ORV FRQVXPLGRUHV VH KD
FRQYHUWLGR HQ XQ FXHVWLRQDPLHQWR pWLFR FODYH
LQGHSHQGLHQWHPHQWH GH VL VH UHDOL]DQ WUDQVDFFLRQHV
FRPHUFLDOHVHQHOVLWLRRQR

(QPDWHULDOHJLVODWLYDHOH[SUHVLGHQWH)HOLSH&DOGHUyQ
+LQRMRVD H[SLGLy HO 5HJODPHQWR GH OD /H\ )HGHUDO GH
3URWHFFLyQ GH 'DWRV 3HUVRQDOHV HQ 3RVHVLyQ GH ORV
3DUWLFXODUHV PLVPR TXH IXH SXEOLFDGR HQ HO 'LDULR
2ILFLDOGHOD)HGHUDFLyQHOGH'LFLHPEUHGHO
(O REMHWLYR GH OD OH\ HV SURWHJHU ORV GDWRV SHUVRQDOHV
HQ SRVHVLyQ GH ODV HPSUHVDV DVt FRPR YDOLGDU TXH
GLFKRVGDWRVVHDQXVDGRV~QLFDPHQWHSDUDODILQDOLGDG
SDUDODTXHIXHURQHQWUHJDGRVTXHVHWHQJDXQFRQWURO
GH TXLpQ \ SDUD TXp ORV WLHQH \ TXH HO GXHxR GH ORV
GDWRVVLHPSUHHVWpLQIRUPDGRGHOWUDWRGHORVPLVPRV
EXVFDQGR FRQ OR DQWHULRU JDUDQWL]DU OD SULYDFLGDG \ HO
GHUHFKR D OD DXWRGHWHUPLQDFLyQ LQIRUPDWLYD GH ORV
LQGLYLGXRV

Interiores.indd 372

5/9/13 6:29 PM

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
/D /H\ VH ULJH SRU  SULQFLSLRV UHFWRUHV TXH VRQ ODV
UHJODV PtQLPDV D REVHUYDU SDUD JDUDQWL]DU HO XVR
DGHFXDGRGHODLQIRUPDFLyQSHUVRQDO(VWRVSULQFLSLRV
VRQ
OLFLWXG TXHVHUHILHUHDORTXHHVOtFLWRRYiOLGRDQWH
ODOH\
FRQVHQWLPLHQWR
FDOLGDG
LQIRUPDFLyQ
SURSRUFLRQDOLGDG
UHVSRQVDELOLGDG

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
 /D LPSOLFDFLyQ PiV LPSRUWDQWH TXH WLHQH HVWD /H\
SDUD ODV HPSUHVDV TXH KDFHQ FRPHUFLR HOHFWUyQLFR
FRUUHVSRQGH D OD REOLJDFLyQ D FDUJR GHO UHFHSWRU GH
GDWRV GH HQWUHJDU D ORV WLWXODUHV GH GDWRV SHUVRQDOHV
XQ LPDJHQ $YLVR GH 3ULYDFLGDG HV XQ GRFXPHQWR
JHQHUDGRSRUODSHUVRQDItVLFDRPRUDOUHVSRQVDEOHGH
OD UHFRSLODFLyQ \ WUDWDPLHQWR GH GDWRV SHUVRQDOHV TXH
VH SUHVHQWD GH PDQHUD ItVLFD HVFULWD HQ SDSHO 
HOHFWUyQLFD SiJLQDZHE RVRQRUD JUDEDFLyQ 

Interiores.indd 373

5/9/13 6:29 PM

3ULYDFLGDG\SURWHFFLyQGHGDWRV
SHUVRQDOHV
eVWH GHEH LQIRUPDU DO WLWXODU VREUH TXLpQ UHFRSLOD ORV
GDWRV SHUVRQDOHV TXp GDWRV VH UHFRSLODQ \ FRQ TXp
ILQDOLGDG FyPR OLPLWDU VX XVR R GLYXOJDFLyQ FyPR
UHYRFDU VX XVR HO SURFHGLPLHQWR SDUD HMHUFHU VXV
GHUHFKRVGHDFFHVRUHFWLILFDFLyQFRUUHFFLyQ\RSRVLFLyQ
FRPXQLFDFLyQ GH FDPELRV D HVWH DYLVR \ OD DXWRUL]DFLyQ
GHODWUDQVIHUHQFLDGHGDWRVDWHUFHURV
$GHPiV GH FUHDU \ SXEOLFDU XQ DYLVR GH SULYDFLGDG VH
GHEHUi QRPEUDU D XQD SHUVRQD R GHSDUWDPHQWR TXH
HVWDUiDOIUHQWHGHODSURWHFFLyQGHGDWRVGHODHPSUHVD

$YLVRGH3ULYDFLGDG
$QWHVGHFRQWLQXDUWHLQYLWDPRVDUHYLVDUXQ
HMHPSORGHDOJ~QDYLVRGHSULYDFLGDGHQ
,QWHUQHW(QHOIRQGRGHSDQWDOODDSDUHFHQ
GLUHFFLRQHVZHEFRUUHVSRQGLHQWHVDORVDYLVRV
GHSULYDFLGDGGH
7(/0(;KWWSZZZWHOPH[
FRPP[FRUSRUDWLYR$YLVRGHSULYDFLGDGB7(/0(;KWPO

68%859,$
KWWSZZZVXEXUELDFRPP[DYLVRGHSULYDFLGDGKWPO

'(/2,77(KWWSZZZGHORLWWH
FRPYLHZHVB0;P[FRQWDFWHQRVOISGSSSLQGH[KWP

Interiores.indd 374

5/9/13 6:29 PM

$YLVRGH3ULYDFLGDG
$KRUDTXHKDVUHYLVDGRDOJXQRVHMHPSORVHVWDUiV
SHQVDQGRHQFyPRJHQHUDUWXSURSLRDYLVR
(O,QVWLWXWR)HGHUDOGH$FFHVRDOD,QIRUPDFLyQ\
3URWHFFLyQGH'DWRV,)$,SRQHDWXGLVSRVLFLyQXQD
JXtDSUiFWLFDSDUDHODERUDUORGHVGHVXVLWLRZHER
GLUHFWDPHQWHHQODGLUHFFLyQ
KWWSLQLFLRLIDLRUJP[3XEOLFDFLRQHVSULYDFLGDGJXLD
SGI

(O ,)$,  HV HO HQFDUJDGR GH JDUDQWL]DU HO GHUHFKR D OD
SURWHFFLyQ GH GDWRV SHUVRQDOHV HQ SRVHVLyQ GH
SDUWLFXODUHV \ YHULILFDU HO FXPSOLPLHQWR GH OD /H\ (VWi
HQFDUJDGRGH
 *DUDQWL]DUHOGHUHFKRGHDFFHVRGHODVSHUVRQDVDOD
LQIRUPDFLyQS~EOLFDJXEHUQDPHQWDO
 3URWHJHU ORV GDWRV SHUVRQDOHV TXH HVWiQ HQ PDQRV
WDQWRGHOJRELHUQRIHGHUDOFRPRGHSDUWLFXODUHV
 < UHVROYHU ORV UHFODPRV VREUH ODV QHJDWLYDV GH
DFFHVR D OD LQIRUPDFLyQ TXH ODV GHSHQGHQFLDV R
HQWLGDGHVGHOJRELHUQRIHGHUDOKD\DQIRUPXODGRDORV
VROLFLWDQWHV

Interiores.indd 375

5/9/13 6:29 PM

3URWHFFLyQDO&RQVXPLGRU
$Vt FRPR H[LVWHQ PHGLGDV SDUD SURWHJHU ORV GDWRV
SHUVRQDOHV WDPELpQ H[LVWHQ RWUDV SDUD SURWHJHU DO
FRQVXPLGRUGHORVGLIHUHQWHVGHOLWRVLQIRUPiWLFRV
/DV DXWRULGDGHV GH SURWHFFLyQ DO FRQVXPLGRU DOUHGHGRU GHO
PXQGR KDQ GHVDUUROODGR XQD VHULH GH OLQHDPLHQWRV TXH
EXVFDQ RWRUJDU XQD PD\RU SURWHFFLyQ D ORV FRQVXPLGRUHV
HQOtQHD3RUHMHPSOROD2UJDQL]DFLyQSDUDOD&RRSHUDFLyQ
\HO'HVDUUROOR(FRQyPLFRV 2&'( GHVDUUROOyHQODV
'LUHFWULFHV SDUD OD 3URWHFFLyQ GH ORV &RQVXPLGRUHV HQ HO
&RQWH[WRGHO&RPHUFLR(OHFWUyQLFRTXHWUDWDQGHXQDVHULH
GH UHFRPHQGDFLRQHV HQFDPLQDGDV D ORJUDU TXH ORV
SURYHHGRUHV GH ELHQHV \ VHUYLFLRV D WUDYpV GH LQWHUQHW
FXPSODQFRQODVGLVSRVLFLRQHVGHODVOH\HVGHSURWHFFLyQDO
FRQVXPLGRU

/D 3URFXUDGXUtD )HGHUDO GHO &RQVXPLGRU RUJDQLVPR


SDUD OD GHIHQVD GH ORV GHUHFKRV GHO FRQVXPLGRU HQ
0p[LFR 3URIHFR  VXJLHUH TXH VH WHQJDQ HQ FXHQWD
DOJXQRVDVSHFWRVDOFRPSUDUSRULQWHUQHW3RUHMHPSOR
9HULILFDU OD LGHQWLGDG GHO SURYHHGRU TXLHQ GHEH
SURSRUFLRQDUDOFLEHUFRQVXPLGRUVXGHQRPLQDFLyQOHJDO\
XELFDFLyQ ItVLFD SDUD TXH HVWH WHQJD ODV KHUUDPLHQWDV
SDUDUHDOL]DUXQUHFODPRHQFDVRGHVHUQHFHVDULR
 3RU RWUR ODGR VH GHEH DVHJXUDU TXH HO QHJRFLR R
YHQGHGRU VH KDFH XQD GHVFULSFLyQ YHUD] GH ORV
SURGXFWRV SDUD TXH HO FRQVXPLGRU SXHGD WRPDU XQD
GHFLVLyQGHFRPSUDELHQIXQGDPHQWDGD\HQHOFDVRGH
ORV SURYHHGRUHV PH[LFDQRV ORV SUHFLRV HQ OtQHD GHEHQ
HVWDUH[SUHVDGRVHQPRQHGDQDFLRQDO

Interiores.indd 376

5/9/13 6:29 PM

3URWHFFLyQDO&RQVXPLGRU
 (O YHQGHGRU WDPELpQ GHEHUi QRWLILFDU DO FRQVXPLGRU
VREUH ODV FRQGLFLRQHV \ IRUPDV GH SDJR DVt PLVPR
PHQFLRQDUVLH[LVWHQFDUJRVDGLFLRQDOHVSRUHQYtR
(OSRUWDOGHEHGHFODUDUSROtWLFDVGHSULYDFLGDGSRUTXH
HV SUREDEOH TXH VH UHTXLHUD TXH HO FOLHQWH UHYHOH GDWRV
GHFDUiFWHUSULYDGRFRPRVHPHQFLRQySUHYLDPHQWHHQH
VWDOHFFLyQ
3RU~OWLPRGHEHQHVWLSXODUFRQFODULGDGODVSROtWLFDVGH
GHYROXFLyQ GH PHUFDQFtDV ODV JDUDQWtDV \ FRQGLFLRQHV
JHQHUDOHVGHODWUDQVDFFLyQ
6LXVWHGYHQGHSURGXFWRVRVHUYLFLRVHQOtQHDOH
UHFRPHQGDPRVWHQHUWRGRHVWRHQFRQVLGHUDFLRQHV

3URWHFFLyQDO&RQVXPLGRU
6L HO FRQVXPLGRU OOHJDUD D WHQHU SUREOHPDV HQ VXV
WUDQVDFFLRQHV FRPHUFLDOHV FRQ SURYHHGRUHV HQ OtQHD
SXHGHFRQWDFWDUDODVDXWRULGDGHVSDUDVHUSURWHJLGR
6L OD RSHUDFLyQ FRPHUFLDO HOHFWUyQLFD VH OOHYy D FDER
FRQ XQ SURYHHGRU GRPLFLOLDGR HQ WHUULWRULR QDFLRQDO
GHEHUi FRQWDFWDU D 3URIHFR KWWSZZZSURIHFRJRE
P[
'H OR FRQWUDULR HO H[WUDQMHUR GHEHUi FRQWDFWDU KWWS
ZZZHFRQVXPHUJRY XQ SRUWDO SDUD HOFRQVXPLGRU
GRQGH VH SXHGH UHSRUWDU TXHMDV VREUH WUDQVDFFLRQHV
HQOtQHDRUHODFLRQDGDVFRQFRPSDxtDVH[WUDQMHUDV

Interiores.indd 377

5/9/13 6:29 PM

3URSLHGDGLQWHOHFWXDO
$O LJXDO TXH OD SULYDFLGDG \ HO XVR TXH VH OH GD ORV
GDWRV SHUVRQDOHV SURSRUFLRQDGRV SRU FOLHQWHV HO
GHUHFKRDODSURSLHGDGLQWHOHFWXDOHVRWUDiUHDTXHVH
KD YXHOWR FRQWURYHUWLGD D UDt] GH OD H[SDQVLyQ GHO
,QWHUQHW\HOFRPHUFLRHOHFWUyQLFR
3RGHPRV FRQVLGHUDU SURSLHGDG LQWHOHFWXDO D ORV
ELHQHV GHULYDGRV GH OD DFWLYLGDG FUHDWLYD VHDQ
WDQJLEOHV R LQWDQJLEOHV \ ODV OH\HV GLULJLGDV D OD
SURSLHGDG LQWHOHFWXDO EXVFDQ TXH ORV DXWRUHV \
SHUVRQDV LQYROXFUDGDV HQ HO SURFHVR FUHDWLYR UHFLEDQ
UHPXQHUDFLyQSRUVXWUDEDMRFDGDYH]TXHHVXWLOL]DGR

3URSLHGDGLQWHOHFWXDO
(V LQGLVFXWLEOH TXH HO ,QWHUQHW KD KHFKR GLItFLO
PDQWHQHU FRQWURO VREUH HO DFFHVR XVR GLVWULEXFLyQ \
FRSLDGHORVSURGXFWRVGLJLWDOHV\DTXHVRQIiFLOPHQWH
FRSLDGRVWUDQVPLWLGRV\DOWHUDGRV
5HIOH[LRQHPRV$OJXQDYH]KDVEDMDGRXQDFDQFLyQR
SHOtFXOD VLQ SDJDU SRU HOORV" &XiQWRV MyYHQHV QR
FRSLDQ \ SHJDQ LQIRUPDFLyQ GH ,QWHUQHW SDUD VXV
WUDEDMRVHVFRODUHVVLQGDUFUpGLWRDODXWRU"(VWRVDFWRV
YLRODQ ORV GHUHFKRV GH SURSLHGDG LQWHOHFWXDO GH
TXLHQHVSURGXMHURQHVDFDQFLyQSHOtFXODXREUD

Interiores.indd 378

5/9/13 6:29 PM

&RPR SDUWH GH OD 1DFLRQHV 8QLGDV VH HQFXHQWUD OD


2UJDQL]DFLyQ 0XQGLDO GH OD 3URSLHGDG ,QWHOHFWXDO OD
FXDOGLYLGHDODSURSLHGDGLQWHOHFWXDOHQGRVUDPDVOD
SURSLHGDG LQGXVWULDO \ HO GHUHFKR GH DXWRU (Q OD
SULPHUDVHLQFOX\HQODVSDWHQWHVGHLQYHQFLyQPDUFDV
GH IiEULFD \ GH FRPHUFLR GLEXMRV \ PRGHORV
LQGXVWULDOHV \ ODV GHQRPLQDFLRQHV GH RULJHQ 3RU VX
SDUWH HO GHUHFKR GH DXWRU DJUXSD ODV REUDV OLWHUDULDV
PXVLFDOHV DUWtVWLFDV IRWRJUiILFDV \ DXGLRYLVXDOHV (Q
0p[LFR HO  ,QVWLWXWR 0H[LFDQR GH OD 3URSLHGDG
,QGXVWULDO\HO,QVWLWXWR1DFLRQDOGH'HUHFKRVGH$XWRU
VHHQFDUJDQGHRWRUJDUSDWHQWHV\UHJLVWURVGHREUDV

$XQTXH HQ OD DFWXDOLGDG XQD SHUVRQD X RUJDQL]DFLyQ


TXH JHQHUD H LQQRYD REUDV DUWtVWLFDV FLHQWtILFDV
LQGXVWULDOHV R FRPHUFLDOHV SXHGH UHFODPDU VHU GXHxR
GHVXREUD\SURWHJHUODGHFDPELRVGLVWULEXFLyQRPDO
XVR HQ UHDOLGDG ODV OH\HV QR KDQ ORJUDGR DEDUFDU ORV
FDPELRVTXHKDWUDtGRODHUDGLJLWDO3RUHOODGRVRFLDO
VH FXHVWLRQD VL FLHUWD WHFQRORJtD GHEH VHU LOHJDO VyOR
SRUDIHFWDUDDOJXQRVGXHxRVGHSURSLHGDGLQWHOHFWXDO
PLHQWUDV TXH GHVGH XQD SHUVSHFWLYD SROtWLFD OD
GLVFXVLyQVHFHQWUDHQFyPRUHJXODUHO,QWHUQHW\HOH
FRPPHUFHSDUDSURWHJHUODLQVWLWXFLyQGHODSURSLHGDG
LQWHOHFWXDO VLQ REVWDFXOL]DU HO FUHFLPLHQWR GHO ,QWHUQHW
\HOFRPHUFLRHOHFWUyQLFR

Interiores.indd 379

5/9/13 6:29 PM

3URSLHGDGLQWHOHFWXDO
6L QR OR KDV KHFKR UHJLVWUD WX PDUFD ORJRV \
SURGXFWRV RULJLQDOHV SDUD WHQHU GHUHFKR VREUH VX XVR
\UHSURGXFFLyQ3RURWURODGRUHFXHUGDTXHHQWXVLWLR
ZHE QR SXHGHV XWLOL]DU LPiJHQHV ORJRV P~VLFD R
GLVHxRVGHWHUFHURVVLQVXH[SUHVRFRQVHQWLPLHQWRDO
PHQRVTXHVHDQGHXVROLEUH
$UDt]GHODGLVFXVLyQVREUHODSURSLHGDGLQWHOHFWXDO\
HO,QWHUQHWKDQVXUJLGRLQLFLDWLYDVFRPRODGH&UHDWLYH
&RPPRQV TXH EXVFD TXH DXWRUHV FRQVHUYHQ VXV
GHUHFKRV DXWRUDOHV LQYLWDQGR D RWURV D XVDU VX REUD
EDMRHOHVTXHPD$OJXQRVGHUHFKRVUHVHUYDGRV

(O REMHWLYR GH HVWD RUJDQL]DFLyQ HV RIUHFHU OLFHQFLDV


PRGHOR TXH IDFLOLWHQ OD GLVWULEXFLyQ \ XVR GH FRQWHQLGRV
/DVOLFHQFLDVGHFUHDWLYHFRPPRQVSURWHJHQODSURSLHGDG
LQWHOHFWXDO \ YDQ GH DFXHUGR D ODV OH\HV GH FRS\ULJKW
UHVHUYDQGRFLHUWDVDFFLRQHVDOGXHxRRULJLQDO\REOLJDQGR
DOXVXDULRDGDUFUpGLWRDTXLHQWHQJDODOLFHQFLDPRVWUDU
DYLVRV GH FRS\ULJKW \ RIUHFHU XQD OLJD D OD OLFHQFLD
$FWXDOPHQWH VH RIUHFHQ  GLIHUHQWHV OLFHQFLDV WRGDV
DVHJXUDQ TXH HO DXWRU R FUHDGRU REWHQJD FUpGLWR GH VX
WUDEDMR\VHSXHGHGHFLGLUHQWUHSHUPLWLUVXXVRFRPHUFLDO
R QR VL SHUPLWH KDFHU FDPELRV R FUHDU QXHYDV REUDV D
SDUWLU GHO RULJLQDO \ SHGLU TXH TXLHQ XWLOLFH OD REUD
FRPSDUWD OD QXHYD YHUVLyQ EDMR OD PLVPD OLFHQFLD
KDFLHQGRFUHFHUORVELHQHVGLJLWDOHVFRPXQHV

Interiores.indd 380

5/9/13 6:29 PM

3URSLHGDGLQWHOHFWXDO
&DEHVHxDODUTXHHODJUHJDUXQDOLFHQFLDGH&UHDWLYH
&RPPRQV QR VXSOH HO UHJLVWUR GH OD REUD DQWH OD
2ILFLQD GH 'HUHFKR GH $XWRU PiV ELHQ IXQFLRQD D OD
SDU GHO FRS\ULJKW (Q JHQHUDO OD FRPXQLGDG &UHDWLYH
&RPPRQV EXVFD TXH HO ,QWHUQHW DOFDQFH VX Pi[LPR
SRWHQFLDO IDFLOLWDQGR HO DFFHVR XQLYHUVDO D
LQYHVWLJDFLyQ \ HGXFDFLyQ \ SHUPLWLU XQD QXHYD IRUPD
GHGHVDUUROORFUHFLPLHQWR\SURGXFWLYLGDG

&LHUUH
<D HVWDPRV SRU FRQFOXLU OD OHFFLyQ DKRUD \D VDEHV
TXH HO WUDWDPLHQWR GH GDWRV SHUVRQDOHV SDUD OOHYDU D
FDERXQDWUDQVDFFLyQHOHFWUyQLFDHVGHOLFDGR
$TXpVHOHFRQVLGHUDGDWRVSHUVRQDOHV"
(Q0p[LFRTXLpQSURWHJHDORVFRQVXPLGRUHVHQ
HOFRPHUFLRHQOtQHD"
4XpUHWRVKDSODQWHDGRHO,QWHUQHWHQUHODFLyQDOD
SURSLHGDGLQWHOHFWXDO"
1R ROYLGHV UHGDFWDU WX $YLVR GH 3ULYDFLGDG SDUD WX
VLWLR KDFHUOR GLVSRQLEOH SDUD ORV XVXDULRV \ WRPDU ODV
PHGLGDV SUHYHQWLYDV QHFHVDULDV SDUD SURWHJHU VX
LQIRUPDFLyQ+DVWDSURQWR

Interiores.indd 381

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin #18: Leyes y tica en el Comercio Electrnico
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 18 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1.

Responde Verdadero (V) o Falso (F) segn corresponda.

- Hoy en da es posible solicitar, guardar y compartir datos personales ____


- Existen sanciones por mal uso o prdida de datos personales _____
- El derecho a la privacidad permite evitar intrusiones de terceros a asuntos personales _____
2. Qu objetivo tiene la Ley Federal de Proteccin de Datos Personales en Posesin de
los Particulares?

3. La Ley se rige por 6 principios rectores,o reglas mnimas a observar para garantizar el
uso adecuado de la informacin personal. Define estos principios.
a) Licitud
b) consentimiento
c) calidad
d) informacin
e)proporcionalidad
f) responsabilidad
4. A qu se le considera datos personales?

5. En la leccin sugerimos revisar ejemplos de avisos de privacidad. Si no lo hiciste


puedes hacerlo ahora. Algunos ejemplos son:

TELMEX:
http://www.telmex.com/mx/corporativo/Avisodeprivacidad_TELMEX.html
SUBURVIA: http://www.suburbia.com.mx/aviso-de-privacidad.html
DELOITTE:
http://www.deloitte.com/view/es_MX/mx/contactenos/lfpdppp/index.htm

Interiores.indd 382

5/9/13 6:29 PM

6. En Mxico, qu organismo el encargado de garantizar el derecho a la proteccin de


datos personales en posesin de particulares y verificar el cumplimiento de la Ley?

7. En Mxico, qu organismo est encargado de garantizar la proteccin al consumidor?

8. Qu quiere decir propiedad intelectual? En Mxico, qu organismo est encargado de


proteger la propiedad intelectual?

9. Qu es Creative Commons y qu propsito tiene?

10. En la leccin se mencion que la PROFECO sugiere que se tengan en cuenta algunos
aspectos al comprar por internet. Escribe 3 medidas que sugieren se llevan a cabo.
-

Interiores.indd 383

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 19
Mensajes clave para el sector empresarial mexicano
Duracin:

30 min

Objetivo de aprendizaje: Analizar aquellas acciones que favorezcan la productividad de


un las empresas dedicadas al comercio electrnico en Mxico.
Subtemas:

Requisitos:

Consideraciones generales para tener xito en el


comercio electrnico

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida a la leccin y presentacin del
instructor.
- Mencin de los objetivos de aprendizaje.
- Mencin de los subtemas a tratar.

D2
-Texto de fondo: tema, subtemas y objetivo

Desarrollo

D 4:
- Texto de fondo: 97% de las personas que
hacen una compra en lnea tienen la intencin
de volver a comprar por este medio.

- Consideraciones iniciales
1. Desarrollo del proyecto

Interiores.indd 384

D 5:
- Texto de fondo: modelo de negocio, define tus
objetivos

5/9/13 6:29 PM

2.Crear tu sitio web

D 7:
-Texto de fondo: dominio, hosting
D 10:
- Texto de fondo: primera compra = lealtad
D 11:
- Texto de fondo: Catlogo en lnea
D 12:
- Texto de fondo: Carrito de compras
D 13:
- Texto de fondo: intermediario financiero y logos
D 14:
- Texto de fondo: Envos = alianzas estratgicas
(logos de proveedores)
D 15:
- Texto de fondo: Servicios adicionales
D 10:
- Texto de fondo: Atencin al consumidor

3. Marketing

D 19:
- Texto de fondo: Recoleccin y anlisis de
datos
D 21:
- Texto de fondo: Estrategia de marketing

4. Seguridad y Confianza

Cierre
- Resumen
- Pregunta de reflexin
- Mencin de la leccin que precede.
- Ejercicios de Prctica

Interiores.indd 385

D 17:
- Texto de fondo: Qu modelo crees que te
ser ms til para hacer negocios en lnea?
Por qu?

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ0HQVDMHVFODYHSDUDHO
VHFWRUHPSUHVDULDOPH[LFDQR

,QIRUPDFLyQ*HQHUDO
%LHQYHQLGRGHQXHYR<DHVWDPRVOOHJDQGRDOILQDOGH
HVWH FXUVR EiVLFR GH FRPHUFLR HOHFWUyQLFR (Q HVWD
OHFFLyQ GDUHPRV DOJXQRV PHQVDMHV FODYH SDUD HO
VHFWRUHPSUHVDULDOPH[LFDQR
7HQLHQGR HQ FXHQWD ODV FRQVLGHUDFLRQHV JHQHUDOHV
SDUDWHQHUp[LWRHQHOFRPHUFLRHOHFWUyQLFR
(O 2EMHWLYR GH DSUHQGL]DMH HV TXH DQDOLFHV DTXHOODV
DFFLRQHV TXH IDYRUHFHQ OD SURGXFWLYLGDG GH ODV
HPSUHVDV TXH SDUWLFLSDQ GHO FRPHUFLR HOHFWUyQLFR HQ
0p[LFR

Interiores.indd 386

5/9/13 6:29 PM

,QWURGXFFLyQ
&RPRKHPRVPHQFLRQDGRDORODUJRGHOFXUVR0p[LFR
HV DFWXDOPHQWH WHUUHQR IpUWLO SDUD LQFXUVLRQDU HQ HO
FRPHUFLRHOHFWUyQLFR/DVFRQGLFLRQHVGHOPHUFDGRVRQ
IDYRUDEOHV FDGD YH] VRQ PiV ORV FRQVXPLGRUHV TXH
VH DFHUFDQ D ,QWHUQHW SDUD LQYHVWLJDU SURGXFWRV \ XQ
Q~PHURHQFRQVWDQWHFUHFLPLHQWRUHDOL]DODFRPSUDHQ
OtQHD $GHPiV HO  GH ODV SHUVRQDV TXH KDFHQ
XQDFRPSUDHQOtQHDWLHQHODLQWHQFLyQGHYROYHUD
FRPSUDUSRUHVWHPHGLR

,QWURGXFFLyQ
$VtFRPRYDDXPHQWDQGRODGHPDQGDGHSURGXFWRV\
VHUYLFLRV HQ OtQHD WDPELpQ FUHFH OD RIHUWD \ HV
LPSRUWDQWH TXH VL GHVHDV LQFRUSRUDUWH DO FRPHUFLR HQ
OtQHD OR KDJDV DKRUD TXH ORV FOLHQWHV GH IiFLO
H[WUDFFLyQ HVWiQ GLVSRQLEOHV (Q GRV R WUHV DxRV
SUREDEOHPHQWH VHUi PXFKR PiV GLItFLO DGTXLULU XQD
FDUWHUDGHFOLHQWHVVyOLGD
$KRUD UHSDVHPRV DOJXQDV GH ODV UHFRPHQGDFLRQHV
SUiFWLFDV TXH KHPRV GDGR D OR ODUJR GHO FXUVR SDUD
DVHJXUDUHOp[LWRHQHOFRPHUFLRHOHFWUyQLFRHQ0p[LFR

Interiores.indd 387

5/9/13 6:29 PM

'HVDUUROORGHOSUR\HFWR
 'HVDUUROOR GHO 3UR\HFWR (VWDEOHFH FXiO VHUi WX
PRGHOR GH QHJRFLR \ GHILQH WXV REMHWLYRV \ PHWDV
GH PDQHUD FODUD \ PHGLEOH 5HFXHUGD TXH LQFRUSRUDU
XQ HQIRTXH GH VLVWHPD HV LPSRUWDQWH SDUD DVHJXUDU
TXH WX VLWLR ZHE GH FRPHUFLR HOHFWUyQLFR HVWp HQ
FRQVWDQWH PDQWHQLPLHQWR \ DFWXDOL]DFLyQ /DV
LQQRYDFLRQHV UHODFLRQDGDV DO HFRPPHUFH VRQ
FRQVWDQWHVSRUORTXHGHEHVHVWDUUHDOL]DQGRFDPELRV
\ PHMRUDV D WX VLWLR \ VLVWHPD FRQVWDQWHPHQWH (V
QHFHVDULR UHFRQRFHU TXH ORV QHJRFLRV HQ OtQHD QR VH
FRPSRUWDQ LJXDO TXH HO FRPHUFLR WUDGLFLRQDO SRU OR
TXHVL\DFXHQWDVFRQXQD

'HVDUUROORGHOSUR\HFWR
WLHQGDItVLFDXRWUDIRUPDGHYHQWDWHUHFRPHQGDPRV
GDUOH HO PLVPR SHVR DO GHSDUWDPHQWR GH FRPHUFLR
HOHFWUyQLFR \ DVLJQDU ORV UHFXUVRV QHFHVDULRV SDUD VX
LQIUDHVWUXFWXUD \ IXQFLRQDPLHQWR 3DUD PXFKDV
HPSUHVDVHOFRPHUFLRHQOtQHDVHYROYHUiHQHO~QLFR
FDQDOGHGLVWULEXFLyQYLDEOH
'HVGH XQ SULQFLSLR HVWDEOHFH ORV VLVWHPDV QHFHVDULRV
SDUD WRGRV ORV SURFHVRV GH WX HPSUHVD GH PDQHUD
TXHSRUHMHPSORWXFDWiORJRHQOtQHDHVWpXQLGRDWX
VLVWHPD GH LQYHQWDULR \ pVWH D VX YH] DO VLVWHPD GH
SHGLGRVGHWXVSURYHHGRUHV

Interiores.indd 388

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
$OFUHDUWXVLWLRZHEGHEHUiV
UHJLVWUDU WX GRPLQLR R GLUHFFLyQ  DQWH XQD HQWLGDG
UHJLVWUDQWHDFUHGLWDGD
VHOHFFLRQDU XQ SURYHHGRU GH KRVWLQJ TXH VHUi HO
HQFDUJDGR GH ORV VHUYLGRUHV HQ ORV TXH VH DORMDUi WX
VLWLR
5HYLVDODVPHGLGDVGHVHJXULGDGTXHLPSOHPHQWHHO
SURYHHGRU SDUD HYLWDU GHOLWRV LQIRUPiWLFRV \
VHOHFFLRQD D TXLHQ WH RIUH]FD HO IXQFLRQDPLHQWR GH
WXVLWLRODVKRUDVGHOGtDORVGtDVGHODVHPDQD
  7DPELpQ HYDO~D ODV RSFLRQHV TXH WH RIUHFH
XQDYH]TXHWXVLWLRWHQJDODQHFHVLGDGGHFUHFHU

&UHDUWXVLWLRZHE
 (Q FXDQWR D OD FUHDFLyQ GH WX VLWLR UHFXHUGD TXH
H[LVWHQ SODWDIRUPDV TXH WH SHUPLWHQ GLVHxDU WX VLWLR FRQ
SODQWLOODV SUHHVWDEOHFLGDV D ODV TXH VH LQFRUSRUDQ ODV
IXQFLRQDOLGDGHV QHFHVDULDV SDUD XQ VLWLR ZHE GH
FRPHUFLR HOHFWUyQLFR $OJXQDV RSFLRQHV VRQ VKRSLI\
FRPP[ \ PHUFDGRVKRSVFRPP[ (Q OD OHFFLyQ 
HQFRQWUDUiV WXWRULDOHV VREUH FRPR XWLOL]DU HVWDV
KHUUDPLHQWDV 7DPELpQ H[LVWHQ RWUDV RSFLRQHV FRPR
MRRPODRGUXSDOODVFXDOHVVRQGHXVROLEUH\UHTXLHUHQ
SRFRFRQRFLPLHQWRGHSURJUDPDFLyQSDUDSRGHULQWHJUDU
ORV HOHPHQWRV GH FRPHUFLR HOHFWUyQLFR QHFHVDULRV SDUD
HOIXQFLRQDPLHQWRGHWXVLWLR\EULQGDQPD\RUIOH[LELOLGDG
HQFXDQWRDOGLVHxR

Interiores.indd 389

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
6L WX HTXLSR WLHQH PD\RU H[SHULHQFLD HQ OHQJXDMH GH
SURJUDPDFLyQSXHGHQXWLOL]DUSURJUDPDVFRPR$GREH
'UHDPZHDYHU 3RU RWUR ODGR VL GHFLGHV FRQWUDWDU XQ
SURYHHGRU SDUD TXH GLVHxH WX VLWLR VHUi PX\
LPSRUWDQWH VDEHU FRPXQLFDUOH WXV REMHWLYRV \
QHFHVLGDGHV SRU OR TXH WH UHFRPLHQGR FRQRFHU ORV
HOHPHQWRV FODYH GH FXDOTXLHU VLWLR ZHE GH FRPHUFLR
HOHFWUyQLFR (V LQGLVSHQVDEOH SDUD HO p[LWR GH WX
QHJRFLRUHIOH[LRQDUVREUHODH[SHULHQFLDTXHWHQGUiWX
FOLHQWHGXUDQWHWRGRHOSURFHVRGHFRPSUD'HVGHTXH
HQWUDDOVLWLRKDVWDTXHUHFLEH\XVDHOSURGXFWR

&UHDUWXVLWLRZHE
$GLIHUHQFLDGHOFRPHUFLRWUDGLFLRQDOJUDQSDUWHGHOp[LWR
GHXQVLWLRZHEGHFRPHUFLRHOHFWUyQLFRHVORJUDUTXHXQ
FRQVXPLGRU KDJD VX SULPHUD FRPSUD 8QD YH] TXH OR
KDFH OD OHDOWDG GH ORV FOLHQWHV D ORV QHJRFLRV GH H
FRPPHUFH HV PX\ DOWD (VWR UHTXHULUi FUHDWLYLGDG H
LQYHUVLyQGHWXSDUWHLQFOXVLYHGHEHVGHHVWDUGLVSXHVWR
D RIUHFHU XQ SURGXFWR D XQ SUHFLR PX\ EDMR FRQ WDO GH
REWHQHU D HVH FOLHQWH TXH D IXWXUR UHDOL]DUi WRGDV VXV
FRPSUDVHQOtQHDFRQWLJR3XHGHTXHFRQVXPDVPXFKD
HQHUJtD SDUD GHVSHJDU SHUR HVWR WH SHUPLWLUi
SRVLFLRQDUWH\REWHQHUXQDEDVHGHFOLHQWHVVyOLGD

Interiores.indd 390

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
5HYLVHPRVDOJXQRVHOHPHQWRVHVHQFLDOHVGHXQVLWLRZHE
GHFRPHUFLRHOHFWUyQLFR
 &DWiORJR HQ OtQHD LQFOXLU WRGD OD LQIRUPDFLyQ TXH HO
FOLHQWH SXGLHUD VROLFLWDU VREUH HO SURGXFWR SDUD LGHQWLILFDU
ORV SURGXFWRV XWLOL]D HO YRFDEXODULR GHO FOLHQWH SDUD TXH
pVWH ORV HQFXHQWUH IiFLOPHQWH H LQFOX\H XQ EXVFDGRU
GHQWUR GH WX VLWLR $JUHJD VXJHUHQFLDV GH SURGXFWRV
VLPLODUHV R TXH KDQ VLGR FRPSUDGRV SRU FOLHQWHV TXH
YLHURQ R FRPSUDURQ HVH SURGXFWR /RV FDWiORJRV PiV
QXHYRV VH DGDSWDQ D ORV JXVWRV \ QHFHVLGDGHV GH ORV
FOLHQWHVXWLOL]DQGRORVUHJLVWURVGHODVYLVLWDVDQWHULRUHVHO
FDWiORJR VH UHGXFH SDUD PRVWUDU HVRV SURGXFWRV TXH
SXHGHQVHUGHVXLQWHUpV

&UHDUWXVLWLRZHE
FDUULWRGHFRPSUDVORVVRIWZDUHVRSODWDIRUPDVSDUD
VLWLRVZHEGHFRPHUFLRHOHFWUyQLFRWHSHUPLWLUiQDJUHJDU
XQDH[WHQVLyQGHFDUULWRGHFRPSUDV6LFXHQWDVFRQXQ
UHJLVWUR GH FOLHQWHV SRGUiV JXDUGDU ORV DUWtFXORV TXH
VHOHFFLRQDURQ HQ VX FDUULWR GH FRPSUDV SDUD VX
VLJXLHQWH YLVLWD 2WUD HVWUDWHJLD OLJDGD DO FDUULWR GH
FRPSUDV HV HQYLDU XQ FRUUHR HOHFWUyQLFR D DTXHOORV
FOLHQWHVTXHGHMDURQDUWtFXORVVHSDUDGRVHQVXFDUULWR\
QR FRPSOHWDURQ OD FRPSUD UHFRUGiQGROHV TXH WLHQHQ
SURGXFWRVSHQGLHQWHV

Interiores.indd 391

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
 3URFHVDPLHQWR GH SDJRV $XQTXH FDGD YH] VRQ PiV ORV
XVXDULRV TXH FXHQWDQ FRQ XQD WDUMHWD GH FUpGLWR HV
LPSRUWDQWH RIUHFHU GLYHUVDV IRUPDV GH SDJR /D
UHFRPHQGDFLyQ JHQHUDO HV LQFRUSRUDU HO VHUYLFLR GH XQ
LQWHUPHGLDULR ILQDQFLHUR ORJRV 6DIHW\ 3D\ 3D\SDO R
0HUFDGR 3DJR  (VWRV SURYHHGRUHV KDQ WRPDGR DFFLRQHV
LPSRUWDQWHVSDUDFRQWUDUUHVWDUORVULHVJRVGHIUDXGHV\KDQ
KHFKR JUDQGHV LQYHUVLRQHV HQ VHJXULGDG SDUD RIUHFHU
SURWHFFLyQ D WL \ D WXV FOLHQWHV (Q HVWH PRPHQWR HQ
0p[LFR OD PHMRU RSFLyQ HV LQWHJUDU VXV VHUYLFLRV D WX VLWLR
ZHE

&UHDUWXVLWLRZHE
 (QYtRV 8QD GH ODV SUHRFXSDFLRQHV GH ORV
FRQVXPLGRUHV HV QR UHFLELU OD PHUFDQFtD SRU OD TXH
KDQ SDJDGR R TXH HVWD WDUGH PiV GH OR HVSHUDGR HQ
OOHJDU (VWDEOHFH DOLDQ]DV HVWUDWpJLFDV FRQ
SURYHHGRUHV GH VHUYLFLRV GH SDTXHWHUtD TXH VHDQ
VHULRV\SXQWXDOHV%XVFDTXHJDUDQWLFHQODHQWUHJDD
WLHPSR\RIUH]FDQXQVHJXURFRQWUDURER7DPELpQHV
UHFRPHQGDEOHRIUHFHUDWXVFOLHQWHVVHUYLFLRGHUDVWUHR
GH ORV SURGXFWRV \ GLVWLQWDV RSFLRQHV GH HQWUHJD GtD
VLJXLHQWH  GtDV  HWF  5HFXHUGD TXH DOJXQRV
SURYHHGRUHVVRQ'+/(VWDIHWD836

Interiores.indd 392

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
 6HUYLFLRV DGLFLRQDOHV $O RIUHFHU XQ SURGXFWR HV
QHFHVDULR FRQVLGHUDU OD H[SHULHQFLD WRWDO GHO FOLHQWH
1HFHVLWD DOJR PiV XQD YH] TXH UHFLEH HO SURGXFWR"
6L HO SURGXFWR HV JUDQGH R SHVDGR R QHFHVLWD
LQVWDODFLyQ SXHGR RIUHFHU HO VHUYLFLR GH GHVHPSDTXH
HLQVWDODFLyQGHVGHPLVLWLRZHEDOPRPHQWRTXHKDFH
OD FRPSUD R SURSRUFLRQDU GDWRV GH SURYHHGRUHV TXH
SXHGHQ GDUOH HVWH VHUYLFLR 7DPELpQ SXHGR RIUHFHU OD
RSFLyQ GH UHJDOR \ PDQGDU HO SURGXFWR D OD GLUHFFLyQ
GHTXLHQUHFLELUiHOUHJDORHQYXHOWR\FRQXQUHFLERGH
UHJDORHQHOTXHQRVHLQFOX\DHOSUHFLR

&UHDUWXVLWLRZHE
 $WHQFLyQ DO FRQVXPLGRU &RPR PHQFLRQDPRV
DQWHULRUPHQWHORVFOLHQWHVGHHFRPPHUFHVRQPX\OHDOHV
D ODV WLHQGDV HQ ODV TXH KDFHQ FRPSUDV \ XQD YH] TXH
KDFHVXSULPHUDFRPSUDODSUREDELOLGDGGHTXHUHJUHVHD
HVD PLVPD WLHQGD HQ OtQHD HV PX\ DOWD 0iV DGHODQWH
KDEODUHPRVVREUHODLPSRUWDQFLDGHLQFRUSRUDUXQUHJLVWUR
GH FOLHQWHV SDUD TXH HVWD SUREDELOLGDG VHD D~Q PiV DOWD
3ULPHUR GHEHV GH HVWDEOHFHU XQD EXHQD UHODFLyQ FRQ
HOORV \D TXH OD GHFLVLyQ GH FRPSUD \ VX ILGHOLGDG
GHSHQGHUiHQJUDQSDUWHGHFyPRWHUHODFLRQDVFRQHOORV


Interiores.indd 393

5/9/13 6:29 PM

&UHDUWXVLWLRZHE
5HFXHUGD TXH HV LPSRUWDQWH LQFRUSRUDU D WX VLWLR ZHE
GLIHUHQWHV IRUPDV GH FRPXQLFDUWH FRQ WXV FOLHQWHV GH
PDQHUD TXH VH HVWDEOH]FD XQD UHODFLyQ GH FRQILDQ]D \ HO
FOLHQWH VHSD TXH SXHGH HQFRQWUDU D DOJXLHQ TXH DWLHQGD
VXV VROLFLWXGHV HQ HO PRPHQWR TXH OR QHFHVLWH $xDGH XQ
FRUUHR HOHFWUyQLFR GH FRQWDFWR WHOpIRQR  \ XQ
VHUYLFLR GH FKDW HQ WLHPSR UHDO SDUD GDU VHUYLFLR D WXV
FOLHQWHV $ OD PLVPD YH] UHFXHUGD TXH HO FOLHQWH WLHQH HO
SRGHU (VWR QR HV VyOR DQWH LQVWLWXFLRQHV FRPR OD
352)(&2  ODV UHGHV VRFLDOHV \ SiJLQDV FRPR DSHVWD
FRPSXHGHQFDXVDUWHXQSUREOHPDVHULRGHUHSXWDFLyQ

&UHDUWXVLWLRZHE
,QFOX\HHQODSiJLQDGHFDGDSURGXFWRXQDGHVFULSFLyQ
HVSHFtILFD GH pO SHUR WDPELpQ DJUHJD RSLQLRQHV \
HYDOXDFLRQHVGHXVXDULRVVREUHVXH[SHULHQFLD(VWROR
SXHGHV ORJUDU HQYLDQGR XQ FRUUHR DO FOLHQWH XQD YH]
TXH UHFLELy HO SURGXFWR VHUi LPSRUWDQWH DWHQGHU
DTXHOORV DVSHFWRV TXH QR KD\DQ VLGR GHO DJUDGR GHO
FOLHQWH 7DPELpQ GHEHUiV VHU KRQHVWR H LQFOXLU
FRPHQWDULRV SRVLWLYRV \ QHJDWLYRV HQ OD VHFFLyQ GH
RSLQLRQHV

Interiores.indd 394

5/9/13 6:29 PM

0DUNHWLQJ
 0DUNHWLQJ /D LQIRUPDFLyQ GH WXV FOLHQWHV TXH REWHQJDV
HQ OtQHD SXHGH VHU DQDOL]DGD \ XWLOL]DGD HQ HVWUDWHJLDV GH
PDUNHWLQJ &RPR PHQFLRQDPRV VREUH OD 5HFROHFFLyQ \
DQiOLVLV GH LQIRUPDFLyQ OD WHFQRORJtD GH ,QWHUQHW KD
SHUPLWLGR UHFRSLODU JUDQGHV FDQWLGDGHV GH LQIRUPDFLyQ
VREUH ORV JXVWRV KiELWRV \ FDUDFWHUtVWLFDV GH
FRQVXPLGRUHV  8Q HOHPHQWR LQGLVSHQVDEOH HV SHGLU D WXV
FOLHQWHV TXH OOHQHQ XQ IRUPXODULR GH UHJLVWUR FRQ VX
LQIRUPDFLyQ
GH
FRQWDFWR
&RPR
PHQFLRQDPRV
DQWHULRUPHQWH XQD YH] TXH XQ FOLHQWH WLHQH VXV GDWRV
DOPDFHQDGRV HQ XQ VLWLR OD SUREDELOLGDG GH TXH UHJUHVH D
pVWHDXPHQWD\DTXHQRTXHUUiWHQHUTXHYROYHUDUHDOL]DU
HOSURFHVRHQRWURVLWLR

0DUNHWLQJ
5HFXHUGD TXH KR\ HQ GtD LQIRUPDFLyQ HV SRGHU SRU OR
TXHHOUHFRSLODUGDWDVREUHORVKiELWRVGHTXLHQHVYLVLWDQ
WX VLWLR VHUi XQD KHUUDPLHQWD ~WLO HQ HO GLVHxR GH WXV
HVWUDWHJLDV GH PDUNHWLQJ \ HO PHMRUDPLHQWR GH WX VLWLR
ZHE 7DPELpQ GHEHV DSURYHFKDU ODV WHFQRORJtDV GH
PDUNHWLQJ SDUD UHFRSLODU LQIRUPDFLyQ VREUH TXp WDQ
HILFLHQWHV HVWiQ VLHQGR WXV FDPSDxDV \ TXp WDQ
UHGLWXDEOH HVWi VLHQGR WX LQYHUVLyQ HQ SXEOLFLGDG (VWRV
VLVWHPDV GHEHUiQ HVWDU HVWDEOHFLGRV GHVGH DQWHV GH
ODQ]DU OD FDPSDxD $Vt IiFLOPHQWH SRGUiV FDOFXODU HO
FRVWR GH DGTXLVLFLyQ GH FDGD FOLHQWH GHSHQGLHQGR GHO
PHGLRSRUHOFXDOOOHJDURQDWL\GHFLGLUHQTXpPHGLRVHV
PiVFRQYHQLHQWHHQIRFDUWH

Interiores.indd 395

5/9/13 6:29 PM

0DUNHWLQJ
 (VWUDWHJLDV GH PDUNHWLQJ (Q XQ SULQFLSLR WX
HVWUDWHJLDGHPDUNHWLQJGHEHHQIRFDUVHHQODDGTXLVLFLyQ
GH FOLHQWHV 'HILQH TXLpQ HV WX FRQVXPLGRU \ TXp KDFH
FXDQGRHVWiHQOtQHD6XVKiELWRVWHSHUPLWLUiQGHILQLUWX
HVWUDWHJLD 5HFXHUGD OD LPSRUWDQFLD GH XELFDUWH HQ ORV
SULPHURV OXJDUHV GH ORV UHVXOWDGRV GH E~VTXHGD GH ORV
SULQFLSDOHV EXVFDGRUHV HOLJH SDODEUDV FODYH TXH VHDQ
UHOHYDQWHV SDUD WX QHJRFLR JHQHUD FRQWHQLGR TXH VHD
~WLO SDUD WXV SRVLEOHV FOLHQWHV DSy\DWH HQ ODV UHGHV
VRFLDOHV\ORVGLVSRVLWLYRVPyYLOHVSDUDOOHJDUDFOLHQWHV
SHUPDQHFH HQ FRQWDFWR FRQ WXV FOLHQWHV \ Vp SDFLHQWH
LQFRUSRUDQGRHVWUDWHJLDVDODUJRSOD]R

6HJXULGDG\&RQILDQ]D
8QRGHORVUHWRVPiVJUDQGHVSDUDORVQHJRFLRVGHH
FRPPHUFH HQ 0p[LFR HV EULQGDU OD FRQILDQ]D
QHFHVDULD D ORV FRQVXPLGRUHV 6HOORV FRPR HO GH OD
$0,3&, EULQGDQ WUDQTXLOLGDG D ORV FOLHQWHV
LGHQWLILFiQGRWHFRPRXQQHJRFLRDXWpQWLFR\FRQILDEOH
7DPELpQ GHEHUiV HVWDEOHFHU PHGLGDV GH VHJXULGDG
FRPR DQWLYLUXV ILUHZDOOV \ FyGLILFDFLyQ GH PHQVDMHV
SDUDHYLWDUDWDTXHV
3RU ~OWLPR UHFXHUGD TXH HV QHFHVDULR FRQWDU FRQ XQ
DYLVR GH SULYDFLGDG TXH LQIRUPH D TXLHQHV
SURSRUFLRQDQLQIRUPDFLyQHOXVRTXHVHOHGDUiDpVWD

Interiores.indd 396

5/9/13 6:29 PM

&LHUUH
(O FRPHUFLR HOHFWUyQLFR HQ 0p[LFR VH HQFXHQWUD HQ XQD
HWDSD GH FUHFLPLHQWR DFHOHUDGD (V LQGLVFXWLEOH TXH HO
KDFHUWRGRORSRVLEOHSRUDGTXLULUFOLHQWHVKR\HVXQSDVR
LPSRUWDQWH SDUD REWHQHU HO p[LWR HQ XQ IXWXUR (Q WUHV
DxRV PiV OD FDUWHUD GH FOLHQWHV QXHYRV YD D VHU PX\
UHGXFLGD\ORVFOLHQWHVILHOHVHVWDUiQUHJLVWUDGRVHQRWURV
VLWLRV1RQHFHVLWDVKDFHUXQDJUDQLQYHUVLyQSDUDORJUDU
XQ VLWLR GH FRPHUFLR HOHFWUyQLFR H[LWRVR KD\ PXFKDV
KHUUDPLHQWDV GH XVR OLEUH GLVSRQLEOHV 0iV ELHQ HV
LPSRUWDQWH VDEHU DQDOL]DU GyQGH VH HQFXHQWUDQ ORV
FOLHQWHV SURVSHFWLYRV FRQRFHU VXV LQWHUHVHV \
QHFHVLGDGHV \ GLULJLUWH D HOORV DSURYHFKDQGR OD UDSLGH]
GHO ,QWHUQHW  1RV YHUHPRV HQ OD ~OWLPD OHFFLyQ GH HVWH
FXUVR6LJXHFRQQRVRWURV

Interiores.indd 397

5/9/13 6:29 PM

Curso Introductorio al Comercio Electrnico


Prctica Leccin #19: Mensajes Clave para el Sector Empresarial
______________________________________________________________________________
Instrucciones: Una vez que hayas concluido la leccin 19 del curso, responde a las siguientes
preguntas y haz lo que se te pide para reforzar los aprendizajes adquiridos.
1. En esta leccin se dieron una serie de recomendaciones Qu se sugiri hacer durante
la fase de desarrollo de proyecto?

2. Qu opciones recomendamos para la creacin de tu sitio web de e- commerce?

3. Mencionamos que la experiencia que el cliente tenga de la compra puede enriquecerse


con servicios adicionales. Por favor menciona dos acciones que representen un valor
agregado para tus clientes:
a)
b)
4. Dimos diferentes consejos para brindar confianza a los consumidores. Escribe 3:
a)
b)
c)
5. Escribe Verdadero (V) o Falso (F) segn corresponda.
- En tres aos ms la cartera de clientes nuevos va a ser muy reducida y los clientes
fieles estarn registrados en otros sitios. _____
- No necesitas hacer una gran inversin para lograr un sitio de comercio electrnico
exitoso, hay muchas herramientas de uso libre disponibles. _____
-Es importante saber analizar dnde se encuentran los clientes prospectivos, conocer
sus intereses y necesidades, y dirigirte a ellos aprovechando la rapidez del Internet. ____
6. Qu consejos dimos para elaborar estrategias de marketing?

Interiores.indd 398

5/9/13 6:29 PM

7. Mencionamos que la relacin y seguimiento a los clientes es importante para la atencin


que se les brinde. Qu formas comunicacin existen para un sitio de comercio
electrnico?

8. Qu preocupaciones existen en torno al envo de los productos adquiridos en lnea?


Cmo puedes solucionar este problema?

9. En la leccin se abri un abanico de posibilidades en el tema de medios de pago.


Menciona 3 medios aplicables al comercio en lnea.
a)
b)
c)

10. Cul fue el mensaje clave o aprendizaje ms significativo para ti en esta leccin o en el
curso en general?

Interiores.indd 399

5/9/13 6:29 PM

Comercio Electrnico
Plan de Leccin 20
Recapitulando
Duracin:

30 min

Objetivo de aprendizaje: Recapitular e integrar los aprendizajes previos.


Subtemas:

Requisitos:

Internet
Comercio Electrnico
Situacin en Mxico
Crear presencia en Lnea
Online Marketing
Medios de Pago
Seguridad
Leyes y tica
Modelos de Negocio en Lnea

Computadora, Tablet o dispositivo desde el cual pueda


tomarse el curso en lnea.
Conexin a Internet

Agenda:
Contenido:

Notas de Produccin:

Introduccin
- Bienvenida
-Tema, subtemas y objetivo de aprendizaje

D2
-Texto de fondo: tema, subtemas y objetivo

Desarrollo

D 4:
- Texto: Web, Internet, Navegador
Grficos

1. Internet
2. Comercio Electrnico
2.1 Situacin en Mxico

Interiores.indd 400

D 6:

5/9/13 6:29 PM

3. Crear presencia en Lnea


4. Online Marketing
5. Medios de Pago
6. Seguridad
7. Leyes y tica
8. Modelos de Negocio en Lnea

- Comercio Electrnico
D 8:
- El Instituto Federal de acceso a la
Informacin (IFAI)
D 10:
- TEXTO: crear presencia en lnea
D 14:
- Logotipos de las empresas mencionadas
D 15:
- Texto: Online Marketing
D 19:
- Texto: Medios de Pago
D 21:
- Texto: Seguridad
D 25:
- Texto: Leyes y tica
D 26:
Reglamento de la Ley Federal de Proteccin
de Datos Personales en Posesin de los
Particulares
D 27:
- Instituto Federal de Acceso a la Informacin
y Proteccin de Datos (IFAI)
-La Procuradura Federal del Consumidor
(Profeco)
D 28:
- Modelos de Negocio en Lnea

Cierre
- Agradecimiento
- Recordatorio de consulta de material
- Despedida
- Ejercicios de Prctica

Interiores.indd 401

D 30:
-Consulta de notas y video

5/9/13 6:29 PM

3UR\HFWRGH'HVDUUROORGH
OD,QGXVWULDGHODV
7HFQRORJtDVGHOD
,QIRUPDFLyQ
/HFFLyQ:UDS8S

,QIRUPDFLyQ*HQHUDO
4XH WDO %LHQYHQLGRV D OD ~OWLPD OHFFLyQ GHO FXUVR
EiVLFR GH HFRPPHUFH  (VSHUDPRV TXH WRGRV ORV
FRQWHQLGRVKD\DQVLGRGHJUDQXWLOLGDGSDUDD\XGDUWHD
HPSUHQGHU R PHMRUDU WX HVWUDWHJLD SDUD KDFHU
FRPHUFLRHOHFWUyQLFR
+R\ VLPSOHPHQWH UHWRPDUHPRV ORV SULQFLSDOHV
DSUHQGL]DMHV REWHQLGRV GXUDQWH HO FXUVR SDUD
UHFDSLWXODU\FRQFOXLUFRQHVWHSURJUDPD

Interiores.indd 402

5/9/13 6:29 PM

,QIRUPDFLyQ*HQHUDO
(QHVWDVHVLyQUHFDSLWXODUHPRVORVWHPDVYLVWRV
,QWHUQHW
&RPHUFLR(OHFWUyQLFR
6LWXDFLyQHQ0p[LFR
&UHDUSUHVHQFLDHQ/tQHD
2QOLQH0DUNHWLQJ
0HGLRVGH3DJR
6HJXULGDG
/H\HV\eWLFD
0RGHORVGH1HJRFLRHQ/tQHD

2EMHWLYR5HFDSLWXODUHLQWHJUDUDSUHQGL]DMHVSUHYLRV

,QWHUQHW
5HFRUGHPRVORDSUHQGLGR
,QLFLDPRVHVWHFXUVRFRQHOWHPDGH,QWHUQHW:HE\
1DYHJDGRUHVSRUTXHGHILQLWLYDPHQWHHVLPSRUWDQWH
FRPSUHQGHUFyPRIXQFLRQDODUHG\ODFRQH[LyQPXQGLDO
DQWHVGHFRPHQ]DUDYHQGHUHQHVWHPHGLR
5HFXHUGDVFXiOHVODGLIHUHQFLDHQWUH:HE,QWHUQHW\
1DYHJDGRU"6HJXURTXHVLHO,QWHUQHWHVODPD\RUUHG
GHLQWHUFRQH[LyQGHUHGHVGHOPXQGRTXHSHUPLWHD
WRGRVVXVXVXDULRVODXWLOL]DFLyQGHVXVVHUYLFLRVSRU
PHGLRGHODVLPSOHFRQH[LyQDXQRGHORVPLOORQHVGH
VHUYLGRUHVTXHSURSRUFLRQDQDFFHVRDODUHG

Interiores.indd 403

5/9/13 6:29 PM

,QWHUQHW
/D 5HG PXQGLDO R :RUOG :LGH :HE HV VROR XQD SDUWH
GHO ,QWHUQHW \ SURYHH DFFHVR D WRGDV ODV SiJLQDV ZHE
DELHUWDV ODV FXDOHV VH SXHGHQ YLVLWDU XWLOL]DQGR XQ
QDYHJDGRU
8Q QDYHJDGRU HV XQ SURJUDPD LQVWDODGR HQ WX
FRPSXWDGRUD TXH WH SHUPLWH FRPR VX QRPEUH OR GLFH
QDYHJDU HQ OD UHG PXQGLDO \ YLVLWDU VLWLRV \ SiJLQDV
ZHE
(VWRVFRQFHSWRVEiVLFRVQRVD\XGDQDFRPSUHQGHUOD
EDVHGHOIXQFLRQDPLHQWRGHOFRPHUFLRHOHFWUyQLFRHOFXiO
IXpHOWHPDGHQXHVWUDVHJXQGDOHFFLyQHQHVWHFXUVR

&RPHUFLRHOHFWUyQLFR
'HILQLPRVDOOFRPHUFLRHOHFWUyQLFRFRPRHOLQWHUFDPELR
GHELHQHV\VHUYLFLRVUHDOL]DGRDWUDYpVGHODV
7HFQRORJtDVGHOD,QIRUPDFLyQ\ODV&RPXQLFDFLRQHV
KDELWXDOPHQWHFRQHOVRSRUWHGHSODWDIRUPDV\
SURWRFRORVHVWDQGDUL]DGRV$SUHQGLPRVTXHHOFRPHUFLR
HOHFWUyQLFRHVWiLQFXUVLRQDQGRDQLYHOPXQGLDO\ORV
HPSUHVDULRVWLHQHQJUDQGHVRSRUWXQLGDGHVGH
FUHFLPLHQWRDOLPSOHPHQWDUHVWDSUiFWLFD
$FRQWLQXDFLyQDQDOL]DPRVGHFHUFDODVLWXDFLyQGH
EDQGHUD0p[LFRHQHOHFRPPHUFHFRQFOX\HQGRTXH
0p[LFRHVDFWXDOPHQWHWHUUHQRIpUWLOSDUDLPSXOVDUHVWD
SUiFWLFDSRUP~OWLSOHVIDFWRUHV

Interiores.indd 404

5/9/13 6:29 PM

&RPHUFLR(OHFWUyQLFR
6LWXDFLyQGH0p[LFR
/DRSRUWXQLGDGHVTXHWLHQH0p[LFRHVWiQ
SULQFLSDOPHQWHHQHOQ~PHURGHXVXDULRVGH,QWHUQHW
HOQ~PHURFUHFLHQWHGHSOiVWLFRVEDQFDULRV\
HVSHFLDOPHQWHHOQ~PHURGHPH[LFDQRVTXHFRPSUDQ
SRUHVWHPHGLRGLJLWDO7DPELpQDQDOL]DPRVHOHVWXGLR
SUHVHQWDGRSRUOD$0,3&,HQHO\DSUHQGLPRV
TXHHOHFRPPHUFHHQ0p[LFRKDLGRFUHFLHQGR
SRVLWLYDPHQWHHQORV~OWLPRVDxRV3ULQFLSDOPHQWHHQ
HOVHFWRUWXULVPR\DTXHODVFRPSUDVGHEROHWRVGH
DYLyQ\UHVHUYDVGHKRWHOHVSRULQWHUQHWVRQODVPiV
SRSXODUHVVHJXLGDVGHHTXLSRVHOHFWUyQLFRV

7DPELpQFRQRFLPRVVREUHODOHJLVODFLyQPH[LFDQDTXH
UHJXODODVWUDQVDFFLRQHVHOHFWUyQLFDV/DOH\VHKD
PRGLILFDGRDGHFXiQGRVHDHVWDVSUiFWLFDVFRPHUFLDOHV
GHPDQHUDTXHVHFRQVLGHUDFRPRXQFRQWUDWROHJDO
FXDOTXLHUPHGLRGHFRPXQLFDFLyQHQGRQGHVHSDFWHHO
LQWHUFDPELRGHELHQHVRVHUYLFLRV'HLJXDOPDQHUD
FRQRFLPRVFXiOHVVRQORVRUJDQLVPRVUHJXODGRUHVGHOD
SULYDFLGDG\SURWHFFLyQGHGDWRVSHUVRQDOHV(O,QVWLWXWR
)HGHUDOGHDFFHVRDOD,QIRUPDFLyQ ,)$, DOFXDO
SRGUiQGLULJLUVHSDUDSUHYHQLUHOPDOXVRGHORVGDWRV\
RULHQWDUDORVUHVSRQVDEOHVGHOWUDWDPLHQWRGHORV
PLVPRVDVtFRPRJXLDUORVHQODFUHDFLyQGHODYLVRGH
SULYDFLGDGTXHDKRUDSRUOH\VLPDQHMDVGDWRV
SHUVRQDOHVGHEHVSXEOLFDUOR

Interiores.indd 405

5/9/13 6:29 PM

&RPHUFLR(OHFWUyQLFR
6LWXDFLyQGH0p[LFR
3RU~OWLPRFRQRFLPRVDOJXQRVUHWRVSDUDTXH0p[LFR
LQFXUVLRQHHQHOFRPHUFLRHOHFWUyQLFR\YLPRVTXH
DOJXQDVEDUUHUDVTXHD~QWLHQHQORVPH[LFDQRVSDUD
IRUPDUSDUWHGHHVWDSUiFWLFDVRQ
/DIDOWDGHFRQILDQ]DHQODVHJXULGDGGHVXVGDWRV
EDQFDULRV
/DIDOWDGHLQIRUPDFLyQ
/DHVFDVH]GHPHGLRVGHSDJR
(QWUHRWURV

&UHDUSUHVHQFLDHQOtQHD
'HVSXpVGHFRQRFHUHOSDQRUDPDJHQHUDOGH0p[LFR
FRPHQ]DPRVDDGHQWUDUQRVHQORVFRQFHSWRVFODYHTXH
QHFHVLWDVSDUDKDFHUHFRPPHUFH
&RPHQ]DPRVFRQORSULQFLSDOFUHDUSUHVHQFLDHQOtQHD
3XHGHVFUHDUSUHVHQFLDHQODZHEGHGLYHUVDVIRUPDV
SULPHURDQiOL]DPRVODRSFLyQGHFUHDUXQDWLHQGDYLUWXDO\
DTXtUHFRQRFLPRVODLPSRUWDQFLDGHGHVLJQDUODVWDUHDVGH
GHVDUUROOR\DGPLQLVWUDFLyQGHOVLWLRDORVFRODERUDGRUHV
FDSDFLWDGRVGHWXHTXLSRRDDOJ~QSURYHHGRUH[WHUQR3DUD
ODFUHDFLyQGHXQVLWLRZHESHQVDGRSDUDKDFHUHFRPPHUFH
VHVXJLULyVHJXLUORVVLJXLHQWHVSDVRVSODQHDFLyQGLVHxRGH
VLVWHPDFRQVWUXFFLyQGHOVLVWHPDSUXHEDHLPSOHPHQWDFLyQ

Interiores.indd 406

5/9/13 6:29 PM

&UHDUSUHVHQFLDHQOtQHD
6LGHFLGHVFUHDUWXSURSLRVLWLRZHESDUDUHDOL]DU
FRPHUFLRHOHFWUyQLFRQHFHVLWDV
8QGRPLQLR
8QVLWLRZHE
+RVSHGDMH
&XHQWDVGHFRUUHRSHUVRQDOL]DGDV
7DPELpQSXHGHVFRQVWUXLUHOVLVWHPDFRQD\XGDGH
H[SHUWRVRELHQXWLOL]DQGRSDTXHWHUtD SODQWLOODV \
VHUYLGRUHVH[WHUQRVSDUDKDFHUOR8QDYH]TXHHO
VLVWHPDVHKDFRQVWUXLGR\SURJUDPDGRVHGHEH
SUREDUHOSURFHVR(O~OWLPRSDVRHVHOGH
LPSOHPHQWDFLyQ

&UHDUSUHVHQFLDHQOtQHD
(OUHVXPHQGHHVWDIDVHSDUDFUHDUXQVLWLRZHEHV
3ODQHDFLyQ4XpTXHUHPRVTXHHVWHVLWLRKDJDSRUQXHVWUR
QHJRFLR"
 'LVHxR GH VLVWHPD 4Xp QHFHVLWDPRV TXH HO VLWLR KDJD
SDUDORJUDUORVREMHWLYRVTXHKHPRVSODQWHDGR"
 &RQVWUXFFLyQ GHO VLVWHPD 4XLpQ YD D FRQVWUXLU HO VLWLR"
'yQGHVHDORMDUi"
 3UXHED )XQFLRQDQ WRGDV ODV OLJDV" &yPR HV OD
H[SHULHQFLDGHOXVXDULR"
,PSOHPHQWDFLyQ&yPRSXHGRDFWXDOL]DU\PHMRUDUHO
VLWLR"

Interiores.indd 407

5/9/13 6:29 PM

&UHDUSUHVHQFLDHQOtQHD
5HFXHUGDVFXiOHVVRQORVHOHPHQWRVFODYHDLQFOXLU
HQXQVLWLRZHEGHHFRPPHUFH"
&DWiORJRHQOtQHD
&DUULWRGHFRPSUD
3URFHVDPLHQWRGHSDJRV
&RRUGLQDFLyQGHHQYtRV
6LVWHPDGHLQYHQWDULR
$WHQFLyQDOFRQVXPLGRU

6LHQGRHVWH~OWLPRGHORVPiVLPSRUWDQWHV5HFXHUGD
TXHHOHTXLSRHQFDUJDGRGHPDQWHQHUHOVLWLRGHEHUi
HVWDUDWHQWRDORVFRPHQWDULRV\UHFRPHQGDFLRQHVGH
FOLHQWHVSXHVHOp[LWRGHORVVLWLRVGHHFRPPHUFHHV
TXHHVWpQHQFRQVWDQWHPHMRUD

&UHDUSUHVHQFLDHQOtQHD
7DPELpQFRQRFLPRVRWUDVRSFLRQHVSDUDWHQHU
SUHVHQFLDHQ,QWHUQHWSRUHMHPSORDORMDUVHHQSRUWDOHV
FRPR*URXSRQ0HUFDGR/LEUH*RRJOHHWF
2SRUHMHPSORODV5HGHV6RFLDOHVHQHVWDOHFFLyQ
DSUHQGLPRVFRPRWHQHUSUHVHQFLDHQODVUHGHV
VRFLDOHVPiVSRSXODUHVGHPDQHUDTXHSXHGDV
HVWDEOHFHUFRQWDFWRFRQPLOHVGHXVXDULRV
$SUHQGLPRVTXHORVSRUWDOHVGHODVUHGHVVRFLDOHVVRQ
XQDJUDQRSFLyQSDUDKDFHUSXEOLFLGDGRVRFLDO
PDUNHWLQJ

Interiores.indd 408

5/9/13 6:29 PM

2QOLQH0DUNHWLQJ
<HVWRQRVOOHYyDOVLJXLHQWHWHPDSDUDOHFFLRQHVGHO
FXUVR2QOLQH0DUNHWLQJ
(QHVWDSDUWHGHOFXUVRDSUHQGLPRVTXH,QWHUQHWHV
XQDJUDQKHUUDPLHQWDSDUDKDFHUPHUFDGRWHFQLD
VREUHWRGRSRUTXHIDYRUHFHODFRPXQLFDFLyQFRQ
PLOORQHVGHF\EHUFRQVXPLGRUHV
$OJXQDVHVWUDWHJLDVGHRQOLQHPDUNHWLQJTXH
FRQRFLPRVIXHURQQHWZRUNPDUNHWLQJSHUPLVVLRQ
PDUNHWLQJPDLOLQJPDUNHWLQJYLGHRPDUNHWLQJYLUDO
PDUNHWLQJPDUNHWLQJGHDILOLDGRVVRFLDOPDUNHWLQJ
SXEOLFLGDGHQOtQHDDGGVHQWUHRWURV

2QOLQH0DUNHWLQJ
$FRQWLQXDFLyQDSUHQGLPRVTXHXQDGHODVPD\RUHV
YHQWDMDVTXHWLHQHHO2QOLQH0DUNHWLQJHVODIDFLOLGDGFRQ
ODTXHSXHGHPHGLUHOLPSDFWRGHXQDFDPSDxDGH
PDUNHWLQJGLJLWDODVtFRPRODIDFLOLGDGSDUDUHFROHWDU
GDWRVLPSRUWDQWHVGHFOLHQWHVSRWHQFLDOHV\FOLHQWHV
IUHFXHQWHV
5HFXHUGDVTXHDSUHQGLPRVVREUHPpWULFDVUDVWUHR\
UHFROHFFLyQGHGDWRV"
/DLQIRUPDFLyQTXHUHJUHVDGHWXVFDPSDxDVGH
PHUFDGRWHFQLDHVPX\YDOLRVDSDUDPHMRUDUWXSURGXFWR\
FRQRFHUHOSHUILOGHWXPHUFDGR

Interiores.indd 409

5/9/13 6:29 PM

2QOLQH0DUNHWLQJ
$VtPLVPRQRVDFHUFDPRVDODQXHYDWHQGHQFLDGH
0RELOH0DUNHWLQJ(QHVWDOHFFLyQDSUHFLDPRV
HVWDGtVWLFDVGHXVXDULRVGHWHOHIRQtDPyYLO\VHUYLFLRGH
EDQGDDQFKDGHVGHWXVPDUWSKRQH\FRQFOXtPRVTXH
HVWiFUHFLHQGRFRQUDSLGH]HOQ~PHURGHSHUVRQDV
FRQHFWDGDVDLQWHUQHWGHVGHVXVFHOXODUHV(VWR
FRQYLHUWHDOFRPHUFLRPyYLOHQXQQLFKRGHRSRUWXQLGDG
SDUDORVFRPHUFLRVHQOtQHD$GHPiVDODOLVWDGH
GLVSRVLWLYRVPyYLOHVSRGHPRVDJUHJDUWHOpIRQRV
FHOXODUHVDORVTXHQRVHOHLQVWDODQDSOLFDFLRQHV
GLVSRVLWLYRVFRPRHOL3RGWRXFK\ODVWDEOHWDV
HOHFWUyQLFDV$XPHQWDQGRHOSRUFHQWDMHGHXVXDULRVTXH
XWLOL]DQDOJ~QWLSRGHGLVSRVLWLYRPyYLOSDUDHVWDUHQ
OtQHD

2QOLQH0DUNHWLQJ
3HURSDUDTXHWXWLHQGDHQOtQHDVHDFRQVXOWDEOHGHVGH
GLIHUHQWHVGLVSRVLWLYRVPyYLOHVHVLPSRUWDQWHGHVDUUROODU
WX$3345TXHSXHGDQVHUOHJLEOHVSRUPHGLRGH
WHOpIRQRVFHOXODUHV\VLPLODUHV
2WURWHPDLPSRUWDQWHTXHUHYLVDPRVHQHVWHDSDUWDGR
GHOFXUVRIXHURQORVPHGLRVGHSDJRGLVSRQLEOHVSDUD
FHOXODUHVHOFXiOGHEHUiVVHOHFFLRQDU\WUDPLWDUFRQXQD
LQVWLWXFLyQEDQFDULD\RLQWHUPHGLDULRVGHSDJR
1XHVWUDVLJXLHQWHOHFFLyQIXpSUHFLVDPHQWHPHGLRVGH
SDJR

Interiores.indd 410

5/9/13 6:29 PM

0HGLRVGH3DJR
(QHVWDSDUWHGHOFXUVRFRQRFLPRVGLIHUHQWHVIRUPDVGH
SDJR0e72'2621/,1(2))/,1(<35(3$*2
&RPRPpWRGRVRIIOLQHFRQRFLPRVHOLPDJHQHV
&RQWUDUHHPEROVRWUDQVIHUHQFLDEDQFDULD\GRPLFLOLDFLyQ
EDQFDULD
&RPRPpWRGRVRQOLQHFRQRFLPRVSDJRFRQWDUMHWDGH
FUpGLWRDWUDYpVGHXQ739SDJRDWUDYpVGHXQ
LQWHUPHGLDULR 3D\3DO6DIHW\3D\HWF 
<HQPpWRGRVGHSUHSDJRODSRVLELOLGDGGHFRPSUDU
WDUMHWDVFRQVDOGRSDUDKDFHUFRPSUDVHQOtQHD

0HGLRVGH3DJR
(QHVWHDSDUWDGRFRPSUHQGLPRVORTXHHVXQ
FRQWUDFDUJRHVXQDIRUPDGHSURWHFFLyQGHOFOLHQWH
SURYLVWRSRUODVHQWLGDGHVEDQFDULDVTXHSHUPLWHDORV
WDUMHWDKDELHQWHVSUHVHQWDUXQDTXHMDHQFXDQWRD
WUDQVDFFLRQHVIUDXGXOHQWDVRQRUHFRQRFLGDVHQVX
HVWDGRGHFXHQWD
<PHQFLRQDPRV4XpPRWLYRVSXHGHQFDXVDUXQ
FRQWUDFDUJR"SDUDTXHHVWpVDOHUWD\SXHGDV
SUHYHQLUWHRGHIHQGHUWHGHXQRHQFDVRGH
SUHVHQWDUVH

Interiores.indd 411

5/9/13 6:29 PM

6HJXULGDG
<KDEODQGRGHSURWHFFLyQQXHVWURVLJXLHQWHWHPDIXH
VHJXULGDGHQOtQHD$TXtGHVDUUROODPRVDOJXQRV
HOHPHQWRVTXHJDUDQWL]DQODVHJXULGDGWDQWRGHO
FRPHUFLDQWHFRPRGHOFRQVXPLGRU
&RPSUHQGLPRVHOYDORUGHODILUPDHOHFWUyQLFD\ORV
FHUWLILFDGRVGLJLWDOHVTXHWLHQHQSRUREMWLYRDXWHQWLFDUD
DPEDVSDUWHV\UHVSRQGLPRVDODSUHJXQWD&yPR
REWHQHUORV"$WUDYpVGHO6DW 6HUYLFLRGH
$GPLQLVWUDFLyQ7ULEXWDULDHQ0p[LFR 

$VtPLVPRDQDOL]DPRVHOSURSyVLWRGHODV
FRQWUDWDFLRQHVHOHFWUyQLFDVFRPSUHQGLHQGRTXH
FXDOTXLHUPHGLRGHFRPXQLFDFLyQHQHOTXHVH
HVWDEOH]FDXQDFXHUGRDOPRPHQWRGHKDFHUXQD
FRPSUDYHQWDHQOtQHDHVUHFRQRFLGRSRUODOH\FRPR
XQFRQWUDWRHOHFWUyQLFR
3RURWURODGRDSUHQGLPRVTXHORV&RPSUREDQWHV
)LVFDOHV'LJLWDOHVVRQXQPHFDQLVPRSDUDOD
FRPSUREDFLyQILVFDOGHLQJUHVRVHJUHVRV\SURSLHGDG
GHPHUFDQFtDVHQWUDVODGRSRUPHGLRVHOHFWUyQLFRV
TXHXWLOL]DODVWHFQRORJtDVGHODLQIRUPDFLyQSDUDHO
SURFHVDPLHQWRGHORVGRFXPHQWRVILVFDOHVGHPDQHUD
GLJLWDO3DUDHPLWLUFRPSUREDQWHVGHEHVKDFHUHO
WUiPLWHFRQHO6$7

Interiores.indd 412

5/9/13 6:29 PM

6HJXULGDG
3HURODVHJXULGDGHQHOFRPHUFLRHOHFWUyQLFRWDPELpQ
LPSOLFDSUHYHQLUGHOLWRVLQIRUPiWLFRV/RVGHOLWRV
LQIRUPiWLFRVDWDFDQXQDRPiVGHHVWDVGLPHQVLRQHV\
DFRUGDPRVTXHGHEHQVHUDWHQGLGRVSRUODVPHGLGDVGH
VHJXULGDGTXHGHFLGDVWRPDU'HVGHHOSXQWRGHYLVWD
WHFQROyJLFRVHSXHGHQLGHQWLILFDUSXQWRVYXOQHUDEOHV
HOFOLHQWHHOVHUYLGRU\ODYtDGHFRPXQLFDFLyQ
(QWUHORVGHOLWRVPiVFRPXQHVHVWiQORVFyGLJRV
PDOLFLRVRVURERVGHLGHQWLGDGSKLVLQJ\IUDXGH
$OJXQVRFRQVHMRVTXHGLPRVHQHVWDOHFFLyQIXHURQXVR
GHDQWLYLUXVFUHDFLyQGHFRQWUDVHxDVVHJXUDVFLIUDGR
GHFODYHS~EOLFDHQWUHRWUDVDFFLRQHV

6HJXULGDG
$VtPLVPRFRPRFRPHUFLDQWHGHEHVHVIRU]DUWHSRU
EULQGDUOHVHJXULGDGDWXVFOLHQWHV0HQFLRQDPRVTXH
LQFOXLUHO6HOORGHFRQILDQ]DGHOD$0,3&,SXHGHGDU
VHQVDFLyQGHWUDQTXLOLGDGDOLJXDOTXHGLYHUVLILFDU
PHGLRVGHSDJRGHPDQHUDTXHSXHGDQRSWDUSRU
UHDOL]DUHOSDJRVLQHQYLDULQIRUPDFLyQFRQILGHQFLDO
3URWHJHUODLQIRUPDFLyQFRQILGHQFLDOGHWXVFOLHQWHVHV
LPSRUWDQWHHVWRQRVOOHYyDOVLJXLHQWHWHPD/H\HV\
pWLFDHQHOFRPHUFLRHOHFWUyQLFR

Interiores.indd 413

5/9/13 6:29 PM

/H\HV\pWLFD
(QHVWDOHFFLyQDSUHQGLPRVTXHKR\HQGtDSRUOH\HV\OD
SUiFWLFDLQWHUQDFLRQDO\DQRHVSRVLEOHVROLFLWDU\JXDUGDU
ORV GDWRV SHUVRQDOHV GH ORV FRQVXPLGRUHV FRPR VH
SRGtD KDFHU DQWHV DKRUD DO UHDOL]DU DOJXQD FRPSUD SRU
,QWHUQHWODHPSUHVDLQWHUPHGLDULDSXHGHVROLFLWDUDOJXQRV
GDWRVSHUVRQDOHVVLQHPEDUJRVHGHEHDVHJXUDUTXHVH
FXLGDUDQ \D TXH H[LVWHQ VDQFLRQHV \ SpUGLGD GH
SHUPLVRV SRU HO PDO XVR GH ORV PLVPRV 7DPELpQ
FRPSUHQGLPRV TXH HO GHUHFKR D OD SULYDFLGDG VH UHILHUH
DO GHUHFKR TXH WHQHPRV ODV SHUVRQDV GH HYLWDU
LQWUXVLRQHV GH WHUFHURV D VXV DVXQWRV SHUVRQDOHV&RPR
SDUWH GH HVWH GHUHFKR VH HQFXHQWUD OD SULYDFLGDG GH OD
LQIRUPDFLyQ

5HFXHUGDV TXH PHQFLRQDPRV HO 5HJODPHQWR GH OD


/H\ )HGHUDO GH 3URWHFFLyQ GH 'DWRV 3HUVRQDOHV HQ
3RVHVLyQ GH ORV 3DUWLFXODUHV" GHFtDPRV TXH HO
REMHWLYRGHODOH\HVSURWHJHUORVGDWRVSHUVRQDOHVHQ
SRVHVLyQ GH ODV HPSUHVDV DVt FRPR YDOLGDU TXH
GLFKRVGDWRVVHDQXVDGRV~QLFDPHQWHSDUDODILQDOLGDG
SDUD OD TXH IXHURQ HQWUHJDGRV /D LPSOLFDFLyQ PiV
LPSRUWDQWHTXHWLHQHHVWD/H\SDUDODVHPSUHVDVTXH
KDFHQ FRPHUFLR HOHFWUyQLFR FRUUHVSRQGH D OD
REOLJDFLyQDFDUJRGHOUHFHSWRUGHGDWRVGHHQWUHJDUD
ORV WLWXODUHV GH GDWRV SHUVRQDOHV XQ $YLVR GH
3ULYDFLGDG GRFXPHQWR JHQHUDGR SRU OD SHUVRQD
UHVSRQVDEOH GH OD UHFRSLODFLyQ \ WUDWDPLHQWR GH GDWRV
SHUVRQDOHV TXH VH SUHVHQWD GH PDQHUD ItVLFD
HOHFWUyQLFDRVRQRUD

Interiores.indd 414

5/9/13 6:29 PM

(QHVWHWHPDVHxDODPRVTXHHO,QVWLWXWR)HGHUDOGH
$FFHVRDOD,QIRUPDFLyQ\3URWHFFLyQGH'DWRV ,)$, HVHO
HQFDUJDGRGHJDUDQWL]DUHOGHUHFKRDODSURWHFFLyQGH
GDWRVSHUVRQDOHVHQSRVHVLyQGHSDUWLFXODUHV\YHULILFDUHO
FXPSOLPLHQWRGHOD/H\$VtFRPROD3URFXUDGXUtD)HGHUDO
GHO&RQVXPLGRU 3URIHFR HVHORUJDQLVPRSDUDODGHIHQVD
GHORVGHUHFKRVGHOFRQVXPLGRUHQ0p[LFR$OLJXDOTXHOD
SULYDFLGDG\HOXVRGHGDWRVSHUVRQDOHVHOGHUHFKRDOD
SURSLHGDGLQWHOHFWXDOHVRWUDiUHDTXHVHKDYXHOWR
FRQWURYHUWLGDDUDt]GHODH[SDQVLyQGHO,QWHUQHW\HO
FRPHUFLRHOHFWUyQLFR
(Q0p[LFRHO,QVWLWXWR0H[LFDQRGHOD3URSLHGDG,QGXVWULDO
,03,VHHQFDUJDGHSURWHJHUODSULYDFLGDGHLQFOXVRLPSDUWH
FXUVRVJUDWXLWRV

0RGHORVGH1HJRFLRHQ/tQHD
0iVDGHODQWHHQHOFXUVRQRVDGHQWUDPRVHQORV
GLIHUHQWHVPRGHORVTXHH[LVWHQSDUDKDFHUFRPHUFLR
HOHFWUyQLFR3ULPHURDQDOL]DPRVHOPRGHOR%&
1HJRFLRDFRQVXPLGRU(QHVWHPRGHORODV
WUDQVDFFLRQHVFRPHUFLDOHVVHGDQHQWUHXQD
RUJDQL]DFLyQ\XQFRQVXPLGRULQGLYLGXDO$SUHQGLPV
TXHHVWHVHFWRUHVDOWDPHQWHFRPSHWLWLYR\DTXHOD
EDUUHUDGHHQWUDGDHVEDMD\DFWXDOPHQWHH[LVWHQPLOHV
GHSHTXHxDVPHGLDQDV\JUDQGHVWLHQGDVHQOtQHD
RIUHFLHQGRVXVSURGXFWRVHQOtQHD2WURPRGHORGH
QHJRFLRHVHO%%TXHVHUHILHUHDDTXHOORVQHJRFLRV
FX\RVFOLHQWHVVRQRWUDVRUJDQL]DFLRQHV

Interiores.indd 415

5/9/13 6:29 PM

0RGHORVGH1HJRFLRHQ/tQHD
&RQFOXtPRVTXHHOPRGHORGHQHJRFLR%%VHSXHGH
GLYLGLUHQUDPDV1HWPDUNHWSODFHV\5HGHVLQGXVWULDOHV
SULYDGDV/RVQHWPDUNHWSODFHVVRQPHUFDGRVHQOtQHD
TXHSXHGHQWRPDUGLIHUHQWHVIRUPDVFRPRHGLVWULEXLGRU
HSURFXUHPHQWLQWHUFDPELRV\FRQVRUFLRVLQGXVWULDOHV
/DVUHGHVLQGXVWULDOHVSULYDGDVSHUPLWHQODFRODERUDFLyQ
HQWUHHPSUHVDVJUDQGHV\VXVSURYHHGRUHVIDFLOLWDQGR
ORVSURFHVRVGHDEDVWHFLPLHQWR
3RU~OWLPRFRQRFLPRVORVPRGHORVGHQHJRFLR33\
&&PRGHORVTXHSHUPLWHQDORVFRQVXPLGRUHV
FRQHFWDUVHFRQRWURVFRQVXPLGRUHV\KDFHUQHJRFLRD
WUDYpVGHSRUWDOHVHQLQWHUQHWTXHIXQJHQFRPR
LQWHUPHGLDULRV\FREUDQSRUVXVVHUYLFLRV

0HQVDMHVSDUDHPSUHVDULRV
)LQDOPHQWHOOHJDPRVDOD~OWLPDOHFFLyQGHOSURJUDPD
GHOFXUVR0HQVDMHV&ODYHSDUDHPSUHVDULRV
PH[LFDQRV
(VSHUDPRVKD\DQVLGRGHXWLOLGDGDOLJXDOTXHWRGRHO
FXUVR5HFXHUGDTXHSXHGHVUHJUHVDUFXDQGRTXLHUDV
DUHDOL]DUXQDFRQVXOWDHQWXVQRWDV\HQORVYLGHRV
0XFKDVXHUWH\+DVWDODSUy[LPD

Interiores.indd 416

5/9/13 6:29 PM

Interiores.indd 417

5/9/13 6:29 PM

a. URL
b. Explicacin de los componentes de la
plataforma educativa Mayahii

IV. Creacin y transformacin de


contenido didctico a video

Interiores.indd 418

5/9/13 6:29 PM

De acuerdo a lo estipulado en los trminos de referencia del presente


proyecto, los contenidos didcticos desarrollados para el curso Introduccin
al Comercio Electrnico fueron transformados a video y se puede tener
acceso a ellos en www.mayahii.com y utilizar la barra de bsqueda, o bien,
acceder directamente a travs de la siguiente direccin:
http://www.mayahii.com/panel/panel.action#a=0&c=0&e=0&l=296&f=&t=3&p=
0&et=&ct=&lt=Introduccin+al+Comercio+Electrnico&pt=

Como se explicar ms adelante, los contenidos tambin estarn disponibles


a travs de un iframe integrado a otros sitios web como el de PROSOFT y
CANIETI.

As mismo, se anexa al final de este compendio los videos en formato DVD.

A continuacin, se presenta una explicacin de los componentes de la


plataforma educativa Mayahii, misma que justifique la seleccin de esta
plataforma, al cumplir con las caractersticas de ser una plataforma educativa
que no requiere registro ni trmite alguno para usarse por el pblico en
general, permitiendo su uso libre. A la vez, la herramienta fomenta la
interaccin entre usuarios a travs de su foro de discusin, facilita el
aprendizaje permitiendo al usuario tomar notas y realizar bsquedas
instantneas dentro de los videos.

Interiores.indd 419

5/9/13 6:29 PM

Mayahii: potenciando la transmisin del conocimiento


humano
I. Quienes Somos
Mayahii es una empresa Mexicana de tecnologa enfocada en el desarrollo de
contenidos educativos, currculum y capacitacin a gran escala con una metodologa
de diseo centrado en el usuario. Su visin es proveer a todo individuo y
organizacin con las herramientas necesarias para aprender o ensear cualquier
tema instantneamente.
Mayahii desarrolla una plataforma tecnolgica de aprendizaje en la nube que permite
a nuestros usuarios mantener acceso permanente a toda la educacin que han
recibido durante toda su vida en un solo lugar.
Mayahii resuelve el problema de capacitacin y entrenamiento a gran escala
mediante nuestra plataforma de aprendizaje y nuestra experiencia en el desarrollo
de currculum y procesos pedaggicos. Nuestra plataforma y metodologa han
probado ser de gran valor en proyectos y regiones donde es necesario entrenar a
miles de alumnos que se encuentran dispersos geogrficamente, manteniendo un
mismo estndar de calidad para toda la poblacin y brindndole a cada alumno la
flexibilidad de aprender a su ritmo individual, y la facilidad de mantener contacto con
los instructores y el resto de los alumnos mediante los foros de discusin.

II. Nuestra Plataforma


Mayahii provee tecnologa de ltima generacin para facilitar un aprendizaje
eficiente al usuario. La plataforma tecnolgica permite al alumno:

Interiores.indd 420

Acceder a sus cursos en video desde cualquier computadora en cualquier


parte del mundo.
Realizar bsquedas instantneas dentro del video: los alumnos pueden
buscar dentro de los videos y encontrar instantneamente el momento
preciso que requieren revisar.
Notas personales: el usuario puede tomar sus notas mientras observa el
video, y las notas quedan ligadas al momento del video en que se estn
tomando. El usuario puede hacer doble clic en las notas tomadas y el video
brincar automticamente al momento ligado a esa nota en particular
facilitando as el repaso de la clase.
Instruccin y aprendizaje individualizado: los alumnos tienen el control de ir
tan rpido o tan lento como lo deseen, con la flexibilidad de aprender a su
propio ritmo. La velocidad del video puede ajustarse a cuatro velocidades y el
alumno puede decidir cundo est lo suficientemente preparado para
avanzar a la siguiente leccin.

5/9/13 6:29 PM

Foro: Cada leccin tiene su propio foro de discusin, accesible a todos los
usuarios y desde el cual pueden iniciar discusiones e intercambiar puntos de
vista con otros usuarios y tutores. El foro cuenta adems con bsqueda
universal, de manera que los usuarios podrn ver instantneamente si su
pregunta ya fue respondida en el pasado y obtener as una respuesta
instantnea.
Tutor: el sistema permite asignar uno o varios tutores a cada foro, de manera
que las preguntas de usuarios puedan ser contestadas por expertos o
directamente por los profesores, manteniendo as un alto nivel de calidad en
la discusin.
Archivos: a cada leccin se le pueden anexar materiales y documentos
adicionales de estudio, tanto por parte del administrador de la leccin como
por parte de la comunidad y los estudiantes.
Filminas sincronizadas con el video.
Navegacin simplificada
Bsqueda instantnea desde cualquier parte del sitio
Acceso a travs de cuentas de Google, Facebook o Linkedin
Listas personales: El usuario podr marcar las lecciones que ms le
interesen para rpido acceso futuro.
Historial: el usuario podr revisar su propio historial de navegacin en
cualquier momento y regresar a lecciones y cursos de su inters.

Aplicacin Mvil
La plataforma Mayahii en su versin mvil consiste en una aplicacin especializada
que permite a los usuarios:

Navegar por todo el repositorio de cursos de manera eficiente


Visualizar las lecciones en video en streaming
Descargar los videos disponibles y verlos 24/7 sin conexin a Internet.

Foto 1. App de Mayahii: ejemplo pantalla leccin

Interiores.indd 421

5/9/13 6:29 PM

Foto 2. App de Mayahii: ejemplo pantalla curso

Mayahii Para Llevar


Mayahii Para Llevar se refiere a el servicio de uso de la plataforma personalizada
en cuanto a marca, contenido y direccin web. La plataforma, con los contenidos
especficos, queda embebida en el sitio web de la institucin.
Capacitacin y entrenamiento a gran escala
Mayahii permite entrenar a cualquier cantidad de usuarios en cualquier parte del
mundo, manteniendo un mismo estndar de calidad.

Interiores.indd 422

Infraestructura y escalabilidad ilimitada: no importa cuntos alumnos se


conecten simultneamente, la plataforma siempre ser capaz de atender las
demandas de los usuarios con la misma efectividad.
Tecnologa lista para usarse
No requiere plugins ni otras instalaciones especiales para acceder a
ella. Basta contar con un navegador estndar de internet o un
dispositivo mvil.

5/9/13 6:29 PM

Herramientas para el Administrador del Curso


Mayahii provee una amplia gama de herramientas que le permiten al administrador
del curso mantener control total de sus cursos, lecciones, documentos, foros y
contenidos en general, en todo momento:

Panel de Administrador: permite administracin completa de


cursos,
lecciones, documentos, filminas, imgenes, alumnos, profesores y
organizaciones en un solo lugar.
Estadstica: acceso a estadstica completa de uso y avance alumno por
alumno, minuto a minuto de cada leccin.
Alumnos: control sobre la lista de alumnos que tienen derecho a acceder a
cualquier contenido controlado por el administrador. Habilidad de abrir
cursos al mundo o cerrarlos a alumnos especficos.

Foto 3. Estadstica disponible para el Administrador

III. Justificacin

Interiores.indd 423

5/9/13 6:29 PM

En Mxico el 81% de la poblacin en lnea ve videos en Internet, consumiendo en


promedio 14 horas de video online por persona al mes, superando al resto de los
pases latinoamericanos. Cada vez son ms las personas que estn sintonizando y
consumiendo videos en lnea, principalmente en sitios como Youtube, convirtiendo a
Mxico en el mercado de mayor crecimiento en la regin (Milenio, 2012)1. Los
avances en las tecnologas web permiten no solamente disfrutar de videos para fines
de entretenimiento, sino aprovecharlos para favorecer el aprendizaje. Varios
estudios han comprobado que la educacin en lnea es tan efectiva como la
presencial, citando la asincrona de la educacin a distancia como una de sus
ventajas principales. Incorporar a la educacin en lnea materiales multimedia, como
el video, muestran la informacin de una manera ms vvida y llevan al alumno a
utilizar diferentes sentidos en su proceso de aprendizaje, aumentando la motivacin
hacia ste (Lam y McNaught, 2006)2. El video estimula ms reas de la memoria de
trabajo que la lectura, aumentando la retencin de la informacin, y permite a los
alumnos establecer una conexin ms humana con el instructor (Hughes, 2009)3.
Adems, el ver y escuchar al instructor dar una explicacin permite al alumno captar
pistas visuales y auditivas, como tono de voz, nfasis, gestos faciales y movimientos
corporales, apoyando de manera significativa los procesos cognitivos para digerir y
retener la informacin.
El utilizar una plataforma educativa con las funcionalidades especficas de Mayahii
permite personalizar y hacer flexible lo que alguna vez se consider un medio de
entrega rgido. Los alumnos pueden pausar, regresar, repasar, acelerar y reflexionar
el material mientras avanzan en el curso. Es innegable que las teoras educativas
ms innovadoras se centran en el alumno, resaltando la capacidad de ste para
crear su propio conocimiento. Considerar que cada persona aprende de manera
distinta y necesita de distintas estrategias para llegar a la comprensin debe ser
parte fundamental del diseo educativo. La plataforma de Mayahii, centrada en el
usuario, no slo utiliza videos para facilitar el contenido; materiales adicionales se
incorporan para complementar lo expuesto por el instructor u ofrecer informacin que
permita a los alumnos interesados explorar el tema con mayor profundidad, lo que
permite atender los diferentes estilos de aprendizaje de los alumnos. Otra
funcionalidad de Mayahii que resuelve las necesidades especficas de cada usuario
es la posibilidad de controlar la velocidad en el video, permitiendo a ste ajustar la
velocidad con que recibe la explicacin de acuerdo a su capacidad para procesarla.
Tomar notas permite a alumnos reducir la informacin a una cantidad manejable y
recordable. Adems, esta prctica ayuda a la concentracin durante una explicacin
y a reforzar la informacin, comenzando el proceso para almacenarla en la memoria
a largo plazo (Pearson, s.f.)4. Al tomar notas, el alumno resume la informacin y la


1

http://www.milenio.com/cdb/doc/noticias2011/0f3f4dc87152c7cd20421624d28c8b29

Lam, P. y McNaught, C. (2006) Design and evaluation of online courses containing media-enhanced learning
materials. Educational Media International, 43 (3).
3
4

Interiores.indd 424

Hughes, G. (2009) Using Videos to Bring Lecture to the Online Classroom. College Quarterly, 12 (1).
http://wps.pearsoned.co.uk/ema_uk_pp_studyskills/128/33013/8451396.cw/index.html

5/9/13 6:29 PM

pone en sus propias palabras. La plataforma de Mayahii no solamente dispone de un


espacio donde el alumno puede tomar notas personales sobre el contenido, sino que
liga cada nota al momento en el video en el que se realiz. Al repasar el contenido el
alumno no dispone nicamente de sus notas, ya que con un solo click puede
regresar al segundo exacto en el que el instructor dio la explicacin. Como se
mencion anteriormente, la plataforma Mayahii permite al alumno repasar el
contenido del curso cuantas veces sea necesario y en el momento que lo desee, ya
sea para estudiar o para simplemente acceder a informacin especfica que
necesita. La bsqueda permite a alumnos encontrar rpidamente la informacin que
estn buscando, ya sea dentro del video, en sus notas o en el foro de discusin.
El ofrecer espacios de interaccin permite a alumnos participando en cursos en lnea
obtener un sentido de comunidad y pertenencia. Aunque puede pensarse que la
interaccin en sesiones presenciales puede ser mayor, estudios han demostrado
que, dados los medios necesarios, el sentido de comunidad incrementa en los
cursos en lnea, hay menos miedo de participar, y los alumnos se sienten ms
dueos del entorno de aprendizaje (Hansen, 2008)5. El foro en lnea de la plataforma
Mayahii permite a los alumnos expresar sus dudas, opiniones y reflexiones sobre el
contenido de la leccin, creando una comunidad en lnea. Adems, el foro es un
medio para encontrar a aquellos otros alumnos que comparten las mismas dudas u
opiniones y, as, profundizar en el contenido. De esta forma, los diferentes
componentes que conforman esta propuesta estn todos basados en una slida
metodologa de aprendizaje que permite a los alumnos capacitarse con las mejores
herramientas disponibles hoy en da para el aprendizaje.


5

Interiores.indd 425

Hansen, D. (2008) Knowledge transfer in online learning environments. Journal of Marketing Education, 30:93.

5/9/13 6:29 PM

Interiores.indd 5

5/15/13 1:24 PM

Interiores.indd 426

5/9/13 6:29 PM

a. Resultados, recomendaciones y generacin


de estadstica

V. Reporte Final

Interiores.indd 427

5/9/13 6:29 PM

El presente proyecto se desarroll con el objetivo de generar contenidos de capacitacin


para empresas en materia de comercio electrnico, a fin de promover su uso y
aprovechamiento. Especficamente, el proyecto consiste en un curso introductorio al
comercio electrnico cuyas lecciones estn disponibles en video a travs de la plataforma
educativa Mayahii.
Se trabaj durante 16 semanas en la realizacin del proyecto, iniciando por una
investigacin profunda de la literatura y casos de estudio que permiti plantear el marco
terico que sustenta lo expuesto en cada leccin. Con base en lo desarrollado en el
marco terico, se realiz el diseo instruccional, determinando el objetivo general del
curso, as como el objetivo especfico de cada leccin, para posteriormente desarrollar el
contenido de cada cpsula y el material adicional correspondiente. A partir del contenido
de cada leccin se redactaron los guiones de cada video para proseguir con la filmacin,
edicin y produccin de stos. Una vez que se obtuvieron las cpsulas editadas, se
habilitaron en la plataforma en lnea y se cre el iframe correspondiente al curso para su
difusin.
De este modo se cumpli con los cuatro entregables establecidos en los Trminos de
Referencia del proyecto:

Interiores.indd 428

Entrega

Contenido

1Entrega: Primer Avance

a) Plan de trabajo de la firma consultora para


abarcar las actividades previstas en los presentes
Trminos de Referencia.
b) Investigacin inicial y diagnstico de
necesidades

2 Entrega: Segundo Avance

c) Diseo Instruccional

3 Entrega: Tercer Avance

d) Creacin y transformacin de contenido


didctico a video.

4 Entrega: Cuarto Avance

e) Reporte Final

5/9/13 6:29 PM

Resultados del proyecto


El curso est compuesto por 20 lecciones en video. El objetivo general de aprendizaje es
que al finalizar el curso el alumno sea capaz de comprender qu es el comercio
electrnico, su situacin en Mxico y sus componentes clave para aplicarlos en tu prctica
empresarial. A la vez, que logre analizar los mensajes clave para los empresarios
mexicanos en materia de comercio electrnico. Esto se logra a travs de veinte lecciones,
agrupadas en tres temas principales: conceptos introductorios, componentes del
comercio electrnico y mensajes clave para el sector empresarial. Cada leccin est
compuesta por una cpsula en video que presenta la teora, ejemplos y reflexiones sobre
el tema, y un archivo descargable que contiene ejercicios de prctica y evaluacin, que
permiten al alumno verificar y reforzar los conocimientos adquiridos. A la vez, existe
material adicional descargable disponible que permite al participante profundizar en los
temas presentados en las cpsulas.
Vista general del curso:

Interiores.indd 429

5/9/13 6:29 PM

Recomendaciones y anlisis sobre la implementacin del mismo


La plataforma en lnea que aloja el curso tiene la particularidad de no tener barreras de
entrada, permitiendo una mayor adopcin del curso por terceros, al estar disponible en
todo momento para quien desee acceder al curso desde la plataforma Mayahii. Su barra
de bsqueda permite al usuario encontrar rpidamente el curso o la leccin de ste que
desee tomar. La implementacin del proyecto requiere la participacin de la Cmara
Nacional de la Industria Electrnica de Telecomunicaciones y Tecnologas de la
Informacin (CANIETI), beneficiario de este proyecto y la Secretara de Economa, a
travs del programa PROSOFT. Para facilitar la difusin del curso y el rpido acceso de
los posibles usuarios se ha creado un iframe que puede ser incorporado a cualquier sitio
web simplemente incorporando la siguiente etiqueta en una pgina del sitio.
<iframe
src="http://CANIETI.mayahii.com/CANIETI"
frameborder="0"
width="100%" height="1250px"></iframe>
<div style="width: 100%; text-align: center; margin: 10px 0px;">
<a href="http://www.mayahii.com" target="_blank" style="text-decoration:
none; font-size: 10px;">
Tecnologia de <br><img src="http://mayahii.com/images/customLogo.png"
width="80px" height="20px" />
A travs del iframe, se podr acceder a los contenidos del curso desde los sitios en los
que est incorporado, permitiendo una mayor adopcin del curso por terceros.
Vista del Iframe:

Interiores.indd 430

5/9/13 6:29 PM

En cuanto a la difusin, tanto CANIETI como PROSOFT se han comprometido a


comunicar a usuarios potenciales la oferta disponible, indicando dnde pueden acceder a
los contenidos e inclusive invitndolos a incorporar el iframe en sus sitios web.
Como parte del Reporte Final se presenta a continuacin el tutorial de uso de la
plataforma educativa Mayahii que contiene recomendaciones sobre el uso de la
herramienta. A travs de este tutorial se pretende brindar un panorama de las principales
funciones de Mayahii. Cabe sealar que el tutorial incluye los pasos para que el usuario se
d de alta en la plataforma, pero los contenidos estn accesibles tanto para aquellos que
creen una cuenta como para los que no.

1. En el navegador de tu preferencia, entra a www.mayahii.com

Interiores.indd 431

5/9/13 6:29 PM

2. Mayahii te permite visualizar los cursos abiertos en lnea sin iniciar una sesin, sin
embargo las funciones de Notas personales,Foro y otras ms estarn deshabilitadas.
Para acceder a la experiencia completa, da clic en el botn Crear cuenta, que se
encuentra en la esquina superior derecha de la pgina.

3. Puedes darte de alta automticamente creando una cuenta a travs de Facebook,


Linkedin o Google, solamente d clic en el botn correspondiente, o bien, crea una cuenta
aparte llenando el formulario, aceptando los Trminos y Condiciones del Aviso de
Privacidad, y dando clic en Continuar.

Interiores.indd 432

5/9/13 6:29 PM

4. En la pgina principal encontrars los cursos Mayahii abiertos a todo el pblico


organizados por Organizacin, Serie (Curso), Profesor y Leccin. En el men lateral
izquierdo encontrars ligas a los cursos a los que te des de alta, al historial de lecciones
que has tomado y a la pgina principal.
5. Supongamos que ests interesado en tomar un curso en Administracin Pblica. Vas al
cuadro de bsqueda y tecleas Administracion. Automticamente aparecen las
organizaciones (el SAT), series (Introduccin a la Administracin Pblica y Conferencias
Foro Mxico 2013) y lecciones (10 de diferentes organizaciones) que contienen tu
bsqueda.

Interiores.indd 433

5/9/13 6:29 PM

6. Puedes acceder directamente a una leccin y empezar tus estudios, o bien, entrar a la
serie completa Introduccin a la Administracin Pblica del CIDE. Da clic en esta serie.

Interiores.indd 434

5/9/13 6:29 PM

7. Vers que en la parte superior aparece el objetivo del curso, su duracin y los
profesores que imparten las lecciones. Da clic en la segunda leccin El Estudio de la
Administracin: Woodrow Wilson para experimentar con las diferentes funciones de la
plataforma.

8. En la pantalla vers el video de la clase que has seleccionado. Justo abajo del video,
vers un men desplegable que dice 1.0x, si lo abres, podrs seleccionar la velocidad
con la que avanza el video (se ofrecen 5 velocidades). A los lados, vers dos flechas
verdes que te permiten regresar a una leccin posterior o avanzar a la siguiente. Tambin
puedes cambiar de leccin en el men desplegable arriba del video. Vers el ttulo de la
leccin y, si abres el men, aparecen todas las lecciones que componen el curso de
Introduccin a la Administracin Pblica. Permanezcamos en la leccin 2.

Interiores.indd 435

5/9/13 6:29 PM

9. Al lado derecho del video vers el espacio para tomar notas personales. Tienes la
opcin de detener el video mientras escribes, o que ste contine. Da play al video de la
leccin y permite que avance la leccin. En tus notas escribe la reforma de servicio civil y
da Enter. Vers que la nota se guarda en el espacio de notas personales, junto con el
segundo del video en que se tom la nota. Vuelve a dejar avanzar el video por unos
segundos. Ahora da clic sobre la nota que tomaste. El video se regresa al segundo en
que tomaste esa nota, permitindote no slo repasar tu nota, sino la explicacin que dio el
maestro sobre el tema. En este espacio tambin est la opcin de hacer bsqueda entre
tus notas para que puedas encontrar los temas especficos de la leccin rpidamente.

Interiores.indd 436

5/9/13 6:29 PM

10. Abajo del espacio de notas personales se encuentra la bsqueda dentro del video.
Supongamos que queremos encontrar las referencias que se hacen en esta leccin a la
democracia. En el espacio de busca dentro del video escribe democracia. Vers que
aparecen tres distintos momentos en los que se menciona la democracia, si das clic a
alguno de ellos, el video se ir a esa parte de la leccin.

Interiores.indd 437

5/9/13 6:29 PM

11. Abajo del video se encuentra el espacio de Foro. Aqu puedes escribir tus
comentarios o dudas sobre la leccin y leer lo que otros usuarios han comentado o
preguntado. A travs de la bsqueda en el foro puedes encontrar si ya se discutieron tus
dudas u opiniones sobre lo presentado en la leccin.

12. En el espacio del foro tambin encontrars la pestaa de Material adicional, da clic
en ella. Vers que para esta leccin est disponible la presentacin con las filminas que
se utilizaron para ella. La puedes descargar dando clic en su nombre.

13. En esta misma pestaa, se encuentra la opcin de agregar archivos. Da clic en el


cono de una hoja blanca con una flecha verde. Aparece una ventana que dice Cargar
material adicional. Selecciona el tipo de archivo que deseas compartir. Da clic en
Choose File y elige el archivo. Si lo deseas, puedes darle un nombre, agregar una
descripcin y definir el idioma. Da clic en Agregar y el archivo se aadir a la lista de
Material adicional de la leccin. Esta opcin permite a la comunidad estudiantil
compartir material relevante, enriqueciendo la experiencia.

Interiores.indd 438

5/9/13 6:29 PM

stas son las funciones bsicas de Mayahii. A travs de ellas el usuario logra personalizar
su experiencia educativa y puede acceder a una gran cantidad de informacin de manera
sencilla.
Indicadores que permitan conocer el nmero de visitas, el cumplimiento y avance
de los usuarios del curso
Mayahii provee una amplia gama de herramientas que permiten al administrador del
curso obtener informacin actualizada sobre el nmero de visitas, cumplimiento y avance
alumno por alumno, minuto a minuto de cada leccin. Con el fin que tanto el beneficiario
como PROSOFT pudieran obtener y analizar la estadstica de este curso introductorio al
comercio electrnico se le ha brindado acceso como administrador a las siguientes
figuras:
Lic. Dafne A. Camacho Garca: Coordinadora de proyectos, Gestin de fondos y
financiamiento, CANIETI
Lic. Elizabeth Argello Maya: Direccin de Economa Digital, PROSOFT
Lic. Julio Csar Tellez Castillo: Enlace de la Direccin General de Innovacin,
Servicios y Comercio Interior de la Secretara de Economa
A continuacin se presentan algunas imgenes que permiten visualizar los indicadores
que estarn disponibles para su anlisis.

Interiores.indd 439

5/9/13 6:29 PM

Visitas al curso:
Nmero total de visitas que ha tenido el curso de usuarios con cuenta en Mayahii y
aquellos no registrados.

Visitas por leccin:


Nmero de visitas que ha tenido cada leccin del curso y el porcentaje en relacin al resto
de lecciones.

Avance por usuario:


Nmero de visitas de los usuarios registrados en Mayahii que han accedido al curso y el
porcentaje de avance del mismo.

Interiores.indd 440

5/9/13 6:29 PM

Visitas a la serie:
Nmero de visitas al curso por da.

Avance del usuario en la serie y visitas del usuario a esta serie:


Permite visualizar el porcentaje de avance por leccin que ha tenido el usuario registrado
y el nmero de visitas por da.

Interiores.indd 441

5/9/13 6:29 PM

Conclusiones
El proyecto Fortalecimiento y desarrollo de capacidades de empresas en materia de
comercio electrnico y las TI contribuye a cubrir los objetivos establecidos por el
PROSOFT 2.0 de acelerar el impacto del desarrollo y crecimientos del sector de las
Tecnologas de la Informacin en Mxico.
La difusin de los contenidos del Curso Bsico de comercio electrnico contribuir a
mejorar el acceso de las empresas mexicanas a los mercados internacionales y fomentar
el enlace con compaas nacionales y globales estableciendo mecanismos de promocin
en Internet y aumentando su nicho de oportunidades.

Interiores.indd 442

5/9/13 6:29 PM

Interiores.indd 5

5/15/13 1:24 PM