Вы находитесь на странице: 1из 45

USA Bio Olympiad 2004 Study Questions

The USABO Open Exam is a 45-minute multiple choice exam focusing on theoretical
knowledge of biology. The following are 16 Sets of Study Questions that you may use for
students for practice and drill, as well as some of the study ideas mentioned in the
Teacher Resource Center.

The answer key page is on the next page, followed by the Study Questions (2 pages per
set).

Practicing with these Study Questions:


A. Whole Class review
Have the entire class practice by scheduling Quiz Time at the beginning or end of
class. Each set of Study Questions (10 questions per set) should take approx. 15
minutes. As with the USABO, there is no pass or fail with these quizzes. Students
should simply try to answer correctly as many questions as they can.

B. Homework Assignments
Give the study questions to the students as homework assignments. Using
textbooks, have them research and identify the correct answers on the forms. In
this way, it can become a learning experience for all students, even if it is new
material with some/all of the questions.

C. Individual Study
Have one or more students study these questions, individually or in small groups.
As an incentive to study, perhaps use this as make-up study for missed days, or as
extra credit opportunities.

About the Study Questions

The Study Questions are taken from a variety of souces, internal and external. Some of
the questions are taken from the following sources, with the remainder from USABO
documents. They may not be sold or used for any other purposes than helping students
study biology in preparation for the USABO.

British Biology Olympiad 2001 Archived Exam


Questions: http://www.iob.org/downloads/Part%20Awebsite.pdf
Answers: http://www.iob.org/downloads/Part%20AAwebsite.pdf

International Biology Olympiad Archived Questions


http://www.ibo-info.org/questions.htm

USABO 2004 Study Questions


USABO Study Questions Answer Key
Set 1 Set 2 Set 3 Set 4
1. B 11. D 21. D 31. D
2. E 12. D 22. B 32. B
3. B 13. C 23. B 33. E
4. A 14. A 24. C 34. D
5. C 15. C 25. B 35. D
6. D 16. A 26. D 36. A
7. C 17. B 27. D 37. E
8. B 18. B 28. D 38. B
9. C 19. C 29. A 39. C
10. A 20. E 30. B 40. A
Set 5 Set 6 Set 7 Set 8
41. B 51. D 61. D 71. B
42. B 52. E 62. B 72. D
43. A 53. C 63. A 73. A
44. E 54. B 64. B 74. D
45. C 55. C 65. A 75. B
46. D 56. A 66. D 76. C
47. A 57. C 67. A 77. E
48. E 58. D 68. B 78. D
49. C 59. D 69. A 79. A
50. D 60. D 70. C 80. C
Set 9 Set 10 Set 11 Set 12
81. C 91. B 101. D 111. E
82. C 92. B 102. B 112. C
83. B 93. D 103. E 113. B
84. C 94. A 104. B 114. A
85. C 95. D 105. D 115. B
86. D 96. B 106. A 116. D
87. C 97. B 107. A 117. C
88. A 98. C 108. B 118. B
89. D 99. B 109. D 119. N
90. C 100. B 110. B 120. C
Set 13 Set 14 Set 15 Set 16
121. A 131. C 141. D 151. A
122. A 132. D 142. E 152. D
123. C 133. D 143. D 153. C
124. A 134. E 144. A 154. B
125. C 135. C 145. D 155. C
126. D 136. D 146. A 156. A
127. C 137. B 147. A 157. B

USABO 2004 Study Questions


128. A 138. A 148. E 158. A
129. C 139. B 149. D 159. A
130. A 140. D 150. A 160. E

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 1

1. Proteinsynthesisoccursin/onthe
[]A. nucleus
[]B. ribosome
[]C. smoothendoplasmicreticulum
[]D. lysosome

2. Whichofthefollowingbiomeshasthegreatestspeciesdiversity?
[]A. TemperateRainForest
[]B. Savannah
[]C. Grassland
[]D. Temperatedeciduousforest
[]E. CoralReef

3. Thegeneticbalanceofapopulationinthesequenceofgenerationsisexpressedbythe
HardyWeinbergLaw,whichexpressedmathematicallyis:
[]A. H=2pq
[]B. p2+2pq+q2=1
[]C. (p+q)=(pq)
[]D. (p+q)x(pq)=p2+q2
[]E. p2+pq+q2=0

4. Inafoodchainisolatedfromothers,whichofthefollowing(measuredinkJm 2)is
numericallythegreatest?
[]A. Netprimaryproductioninplants
[]B. Firstcarnivoreconsumption
[]C. Herbivoreassimilation
[]D. Herbivorerespiration
[]E. Plantbiomassincrease.

5. Tissuesthatformlong,toughstrands,asintheleafstalkofcelery,are:
[]A. epidermis
[]B. collenchyma
[]C. sclerenchyma
[]D. parenchyma

6. Duringmigrations,somebirdsusewhichofthefollowingasreferenceframeworks?
I. Thesun
II. Constellations
III. Earth'smagneticfield
[ ] A. I only
[ ] B.I and II only
[ ] C. I and III only
[ ] D. I, II, and III

7. WhenthebasecompositionofDNAfrombacteriumMycobacteriumtuberculosiswas
determined,18%ofthebaseswerefoundtobeadenine.Whatisthe[G]+[C]
content?

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 1
[]A. 32%
[]B. 36%
[]C. 64%
[]D. 18%

8. ThepHofthelysosomeismostnearly
[]A. 1.0
[]B. 5.0
[]C. 7.0
[]D. 11.0

9. Whichofthefollowingisanexampleofhabituation?
[ ] A. Chickadees learning new songs when they shift to living in large
winter flocks from small family groups.
[ ] B.Stalking and attacking litter mates by lion cubs.
[ ] C. Hydra initially contract when gently touched, but soon stop
responding.
[ ] D. Yearly migration of golden plovers from Arctic breeding grounds to
southeastern South America.

10. Energyistransferredbetweentrophiclevelsinafoodchain.Whichofthefollowing
stagesrepresentstheleastefficienttransferofenergy?
[]A. Suntoprimaryproducer
[]B. Primaryproducertoprimaryconsumer
[]C. Primaryconsumertosecondaryconsumer
[]D. Secondaryconsumertotertiaryconsumer
[]E. Tertiaryconsumertodecomposer.

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 2

11. Thefinalsereduringsuccessionistermedthe:
[]A. niche
[]B. bioticpotential
[]C. carryingcapacity
[]D. climax
[]E. seralcommunity

12. Brownalgaedifferfromthegreenalgaeandredalgaeinhaving:
[]A. chlorophylla
[]B. differentiatedcells
[]C. phycocyaninwithintheircells
[]D. Fucoxanthinwithintheircells

13. Whichtwofunctionalgroupsarealwaysfoundinaminoacids?
[ ] A. Amine and sulfhydryl
[ ] B.Sulfhydryl and carboxyl
[ ] C. Carboxyl and amine
[ ] D. Alcohol and aldehyde

14. Woodlicenormallyliveindamphabitats.Thisistopreventdesiccationandto
facilitategaseousexchange.Inregionsoflowhumiditytheymoveaboutquite
rapidlybutinarandommanner.Whentheyfindanareaofhighhumiditythey
slowdownandeventuallybecomestationary.Thisisanexampleof:
[]A. akinesis
[]B. ataxis
[]C. areflexaction
[]D. habituation
[]E. operantlearning

15. Sexlinkedrecessiveallelesareusuallycarriedon:
[]A. ThehomologouspartoftheXchromosome
[]B. AnextraYchromosome
[]C. ThenonhomologouspartoftheXchromosome
[]D. ThehomologouspartoftheYchromosome
[]E. AnextraXchromosome

16. Populationsthatarelikelytobelivingatadensitynearthelimitimposedbytheir
resources,arecharacterizedas
[ ] A. K-selected
[ ] B.p-selected
[ ] C. Q-selected
[ ] D. r-selected

17. Whichofthefollowingisresponsiblefortranscription?
[]A. spliceosome
[]B. RNApolymerase

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 2
[]C. DNApolymerase
[]D. Ribosome

18. Dichlorophenolindophenol(DCPIP)isabluedyethatisdecolorizedwhenreduced.
AfterbeingmixedwithDCPIPwhichoneofthefollowingwouldshowthegreatest
changeincolor?
[]A. Isolatedchloroplastsinthedark;
[]B. Isolatedchloroplastsinthelight;
[]C. Chlorophyllextractinthedark;
[]D. Boiledchloroplastsinthedark;
[]E. Boiledchloroplastsinthelight.

19. Insituationthatconflictbetweenattackandflightanimalshavebeennotedtobehave
inamostpeculiarfashione.g.thebehaviouroffightingcocksinterruptingtheir
fighttopeckatthegroundforfood.Whatisthiskindofbehaviorcalled?
[]A. Feeding
[]B. Ritualisation
[]C. DisplacementActivity
[]D. AggressiveBehaviour

20. Thepedigree(seefigure)showsaninheritanceofarareformofmusculardystrophy.

Thediseaseisprobablycausedbyamutationononelocuswhichis:
[]A. recessive,autosomal
[]B. dominant,autosomal
[]C. recessive,relatedtotheXchromosome
[]D. relatedtotheYchromosome
[]E. situatedinthemitochondrialgenome

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 3

21. Whyisahighmoorboganextremehabitat?
1becauseitisoligotrophicandpermanentlycold
2becauseitallowsextremesituationsconcerningclimateonthesurface.
3becauseitisoligotrophicandhasalowpHvalue
[]A. Allthreeexplanationsarecorrect
[]B. Onlyexplanation1iscorrect
[]C. Onlyexplanations1and2arecorrect
[]D. Onlyexplanations2and3arecorrect
[]E. Onlyexplanation3iscorrect.

22. Whichofthefollowingsituationsisinoperationwhenbloodisbeingpumpedintothe
aorta?
[]A. leftventriclecontracted,bicuspidvalveopen,semilunarvalveshut
[]B. leftventriclecontracted,bicuspidvalveshut,semilunarvalveopen
[]C. leftventriclecontracted,bicuspidvalveopen,semilunarvalveopen
[]D. leftventriclerelaxed,bicuspidvalveshut,semilunarvalveopen
[]E. leftventriclerelaxed,bicuspidvalveopen,semilunarvalveshut.

23. OnlyoneofthefollowingfeaturesofthephylumoftheChordataalsoispresentin
adultTunicata(=Urochordata).Whichfeature?
[]A. possessionofachorda
[]B. possessionofvisceralslits(=pharyngealslits)
[]C. possessionofatail
[]D. possessionofadorsaltubularnervoussystem

24. Whichofthefollowingistruefortransportinxylem?
[ ] A. The primary force involved is osmotic pressure
[ ] B.Xylem is the primary site for transport of sucrose
[ ] C. Movement through xylem depends mainly on transpiration
[ ] D. All of the above

25. Whichofthegivenactionsarepartofthelightstageofphotosynthesis?

[]A. 1,3,6
[]B. 1,4,6
[]C. 2,3,6
[]D. 2,4,5
[]E. 1,3,5

26. Animalbehaviourpatterns,inwhichanindividualendangersitslifetobenefitother
membersofthegroup,arecalledaltruistic.Itisbelievedthataltruisticbehaviour

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 3
wasfavouredbykinselection.WhichiftheexamplesgivenbelowCANNOTbe
explainedaskinselectionfavoured?
[]A. suicidalattackbyaworkerbeeguardingitshive
[]B. protectionofthequeenofanantspeciesby"soldierants"
[]C. protectionoflioncubsbyalionessNOTbeingtheirmother
[]D. warningcriesofabirdwarningotherindividualsaboutapproachingdanger

27. Inagrazedfieldthenetprimaryproductionislessthanthegrossprimary
production.Whichoffollowingcouldaccountforthisdifference?
1.Plantsuseenergyintranslocation.
2.Plantsuseenergyinactivelytransportingionsacrossmembranes.
3.Hydrolyticenzymesinplantsuseenergyinbreakingdownfoodreserves.
4.Plantsuseenergywhenwatervapourislostviathestomata.
5.Grazingbyherbivores.

[]A. 1&2
[]B. 2&3
[]C. 3&4
[]D. 1,2&3
[]E. 2,3&4

28. Whichofthefollowinghormonesismostelevatedafteralarge,carbohydraterich
meal?
[]A. glucagon
[]B. glucose
[]C. GnRH
[]D. insulin

29. Whichofthefollowinganimaltaxaonlyoccurinthesea?
1.starfishandseaurchins(Stellaroidea,Echinoidea)
2.jellyfish(Cnidaria)
3.sponges(Porifera)
4.squids(Cephalopoda)
5.highlydevelopedcrustacea(MalacostracaCrustacea,Astacus)

[]A. 1&4
[]B. 2&3
[]C. only5
[]D. 1,2&3
[]E. 2,4&5

30. HowmanydifferentphenotypescanbeexpectedintheF2ofthecrossing:AABB*aa
bbwhen:
I the genes are completely coupled and,
II the genes inherit independently:
I II
[_] A 3 4

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 3

[_] B 3 9
[_] C 4 9
[_] D 4 16
[_] E 9 16

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 4

31. Whichhypothesisseekstoexplainwhyaplantauxinproducesdifferenteffectsonthe
growthofarootandofashoot?
[]A. Gravityaffectstheactionoftheauxin.
[]B. Thegrowthratesofrootsandshootsdiffer.
[]C. Theauxintravelsfasterdownwardstowardstheroot.
[]D. Therootandshootresponddifferentlytosimilarauxinconcentrations.
[]E. Lightaffectstheactionoftheauxin.

32. Potatoesarestoredforoneweekinpureair,thenforoneweekinpurenitrogenand
theninpureairagain.DuringtheexperimenttheexcretionofCO2ismeasured.
Thediagramshowstheresults.

TheextraamountofCO2producedandexcretedduringthethirdweekprobablycamefrom

[]A. ethanol
[]B. ethanal
[]C. lacticacid
[]D. NADH2
[]E. NADPH2

33. WhopresentedamanuscriptofatheoryofevolutionidenticaltoDarwinsoneyear
beforethepublicationofTheOriginofSpecies?
[]A. Hutton
[]B. Gould
[]C. Malthus
[]D. Cuvier
[]E. Wallace

34. Generally,therearemorespeciespersquarekilometerinwhichofthefollowingtypes
ofecosystem?
[ ] A. Temperate grassland
[ ] B.Arctic tundra
[ ] C. Boreal forest
[ ] D. Coral reef

35. Whichofthefollowingcontributetophenotypicvariationinapopulation?
I. Mutations
II. Crossingover
III. Constancyoftheenvironment
IV. Independentassortment.

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 4
[]A. I&IIonly
[]B. II&IIIonly
[]C. III&IVonly
[]D. I,II&IV

36. WhichofthefollowingisNOTacharacteristicofallchordates?
[ ] A. vertebrae
[ ] B.notochord
[ ] C. pharyngeal slits
[ ] D. postanal tail

37. Inaparticularbreedofcattle,thealleleforthepolledcondition(nohorns)is
dominanttothehornedcondition.Coatcolourisdeterminedbyanothergene
whichhastwoallelessothattheanimalscanbehomozygousredandhomozygous
white,whilsttheheterozygousconditioniscalledroan(redwithwhitepatches).A
crosswasmadebetweenahornedredcowandahornedwhitebull.Assumingthat
neitherofthesecharacteristicsissexlinked,whichofthefollowingstatements
abouttheoffspringfromthiscrossaretrue?

I. Theoffspringwillshowequalnumbersofhornedroanandpolledroanindividuals.
II. Alloffspringwillbehorned,butcoatcolourwillhavered,whiteandroanindividuals.
III. Alloffspringwillbehomozygousforthehornedconditionandheterozygousforcoat
colour.
IV. Alltheoffspringwillbehornedandroan
V. Noneoftheoffspringwillbepolled.

[]A. I&II
[]B. II&III
[]C. III&IV
[]D. I,II&III
[]E. III,IV&V

38. Thevitellinesac(=yolksac)isexpectedtobeverysmallinoneofthefollowing
groups.Inwhichone?
[]A. ingroupsthatfertilizeexternally
[]B. ingroupswithembryosthatarefedfrommaternalblood
[]C. ingroupsthatfertilizeinternally
[]D. ingroupsthathaveanallantoicmembrane

39. C4plantscanstartphotosynthesiswithalowerconcentrationofCO2inthe
atmospherethanC3plants.Thisisbecause:
[]A. respirationofC4plantsishigher
[]B. respirationofC4plantsislower
[]C. C4plantsdonothavephotorespiration
[]D. C4plantsdohavephotorespiration

40. Whichoneofthefollowingisthesiteoftheinfluxofsodiumionsduringthepassage
ofanactionpotentialalongamyelinatedaxon?

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 4
[]A. thenodesofRanvier
[]B. thewholeoftheaxonmembrane
[]C. thesodiumpumpareaoftheaxonmembrane
[]D. thechemicalsynapse
[]E. themyelinsheath

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 5

41. Thetransferofenergythroughaterrestrialecosystemisoftendepictedbyenergy
pyramids.Whichofthefollowingstatementsistrue?
[]A. Ecologicalefficiencyishighestfortopconsumers
[]B. About10%oftheenergyfromonetrophiclevelisincorporatedintobiomassofthe
nextlevel
[]C. Theenergylostasheatorincellularrespirationis10%oftheavailableenergyof
eachtrophiclevel
[]D. Only25%oftheenergyinonetrophiclevelispassedontothenextlevel

42. Inmanytypesofcancer,thefunctionofthep53geneislost.Wildtypep53isMOST
likelytobea
[ ] A. proto-oncogene
[ ] B.tumor suppressor
[ ] C. positive regulator of cell cycle progression
[ ] D. gene required for DNA replication

43. WhichofthefollowingMendelianlawsdoestheconceptoflinkageviolate?
[]A. independentassortment
[]B. segregation
[]C. nonrandommating
[]D. Noneoftheabove

44. Whichofthefollowingmoleculesareinvolvedintheproductionofproteininthecell?
I. MessengerRNA
II. RibosomalRNA
III. TransferRNA
IV. ATP
V. Aminoacids

[]A. I,II,&IIIonly
[]B. I,II,III&IVonly
[]C. III,IV&Vonly
[]D. II,III,IV&Vonly
[]E. allofthem

45. Inthedomesticcat,theautosomallocusWhiteisdominantandepistatic;thelocus
OrangeissexlinkedwithalleleOtabbyandalleleored,whiletheheterozygousis
tortoise.Awhitefemalemateswithatabbytomcat.Thekittensturnouttobe:
1redmale
1tortoisefemale
1tabbyfemale
1whitemale
1whitefemale
Whatisthegenotypeofthemother?

[]A. WWOo
[]B. WwOO

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 5
[]C. WwOo
[]D. Wwoo

46. ConsiderapopulationinHardyWeinbergequilibrium.Whichofthefollowing
assumptionsmustbemet?
[]A. Nonrandommating
[]B. Geneticmutation
[]C. Sexualselection
[]D. Nonaturalselection

47. Underconditionsofahighatmospherichumidityhardlyanycalcium(Ca)is
transportedtodevelopingfruits.Thisiscausedby:
[]A. calciumonlybeingtransportedthroughthexylemandthistransportnottakingplace
anymore
[]B. calciumonlybeingtransportedthroughthephloemandthistransportnottaking
placeanymore
[]C. transpirationstoppingand,asaresultbothxylemandphloemtransportstopping
[]D. thestomataclosingandtransporttothefruitstopping

48. Whichofthefollowingprocessesoccurduringthenitrogencycle?
I. Theoxidationofnitritestonitratesbyrootnodulebacteria.
II. Consumptionofplantproteinbyherbivores.
III. Theconversionofdeadorganismsintoammoniabydecomposers.
IV. Conversionofammoniumcompoundsintonitratesbydenitrifyingbacteria.
V. Theoxidationofammoniumcompoundsintonitritesbynitrifyingbacteria.

[]A. I&II
[]B. II&III
[]C. III&IV
[]D. I,II,&III
[]E. II,III,&V

49. Supposethatthefrequencyofhomozygousdominantgenotype(AA)inapopulation
obeyingHardyWeinbergequilibriumis0.25.Whatisthehomozygousrecessive
(aa)genotypefrequency?
[]A. 0.05
[]B. 0.10
[]C. 0.25
[]D. 0.50

50. Whichoneofthefollowingsubstancesprovideselectronsforthereductionreactions
inphotosynthesis?
[]A. NADP
[]B. Chlorophyll
[]C. Cytochrome
[]D. Water
[]E. ATP

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 6

51. FourtypesofPhytoplankton(I,II,IIandIV)werecollectedfromdifferentdepthsof
thesea.Foreachofthesetypes,thephotosynthesiswasmeasured,asrepresented
inthefollowingfigure.WhichtypeofPhytoplanktonwascollectedatthegreatest
depth?

[]A. I
[]B. II
[]C. III
[]D. IV

52. AbacterialmRNAwithalengthof360nucleotidescodesforaproteinof:
[]A. roughly1080aminoacids
[]B. roughly360aminoacids
[]C. between120360aminoacids
[]D. exactly120aminoacids
[]E. lessthan120aminoacids

53. Whichofthefollowingstatementsis/arecorrect?
I. penguinsareanintermediateformbetweenbirdsandmammals
II. penguinsaredenselycoveredwithfeathers
III. penguinsaredenselycoveredwithhair
IV. penguinsaredenselycoveredwithchitinfibres.

[]A. I,II
[]B. I,III
[]C. onlyII
[]D. onlyIII
[]E. onlyIV

54. Anewcharacteristicusuallyappearsinevolutionasaresultof:
[]A. accumulationofpointmutationsinagenewhichoriginallyencodedforsomething
else

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 6
[]B. duplicationofageneandaccumulationofpointmutationsinoneofthecopiescoming
fromthatduplication
[]C. amutationinaregulatorgene
[]D. genotypicalrecordingoffavourablephenotypicaladaptations

55. Themitochondriontakesinandreleasesanumberofmaterialsduringaerobic
respiration.Whichofthefollowingdoesittakeinduringdaylight?
[]A. ATP; PO42; O2; pyruvate.
[]B. ATP; PO42; CO2; succinate.
[]C. ADP; PO42; O2; pyruvate.
[]D. ADP; PO4 ;
2+
CO2; lactate.
[]E. ADP; PO42; O2; lactate.

56. Whichofthefollowingcelltypessecreteantibodies?
[]A. Bcell
[]B. HelperTcell
[]C. CytotoxicTcell
[]D. SuppressorTcell

57. WhichofthefollowingisNOTamodeofnaturalselection?
[]E. stabilizingselection
[]F. directionalselection
[]G. sexualselection
[]H. diversifyingselection

58. Cellsofthepancreaswillincorporateradioactiveaminoacidsintoproteins.This
labelsnewlysynthesizedproteinsandenablestotrackthelocationofthese
proteinsinacell.Inthiscasewearetrackinganenzymethatiseventually
secretedbypancreascells.Whichofthefollowingisthemostlikelypathwayfor
movementofthisproteininthecell?
[]A. endoplasmicreticulumGolgi>nucleus
[]B. Golgiendoplasmicreticulum>lysosome
[]C. nucleusendoplasmicreticulum>Golgi
[]D. endoplasmicreticulumGolgi>vesiclethatfuseswithplasmamembrane
[]E. endoplasmicreticulumlysosome>vesiclesthatfuseswithplasmamembrane

59. ABlymphocyteproducesandsecretesantibodies.Whichstructuresofitsprotoplast
shouldthereforebewelldeveloped?
[]A. onlythesmoothendoplasmicreticulum
[]B. onlythesmoothendoplasmicreticulumandtheGolgiapparatus
[]C. onlytheroughendoplasmicreticulum
[]D. onlytheroughendoplasmicreticulumandtheGolgiapparatus
[]E. theroughendoplasmicreticulum,theGolgiapparatusandthelysosomes.

60. Insuperoxidedismutase1,anenzymeimplicatedinamyotrophiclateralsclerosis
(LouGehrig'sdisease),acopperionisboundtotheactivesiteandisimportantfor
enzymeactivity.Inthisenzyme,coppermostlikelyfunctionsasa(n)

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 6
[ ] A. coenzyme
[ ] B.allosteric activator
[ ] C. allosteric inhibitor
[ ] D. cofactor

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 7

61. Theanimalsattheendofafoodchainaregenerallyfewinnumber;
[]A. Becausetheyarealwaysthelargestorganismsinthefoodchain.
[]B. Becausetheyhavelonggestationperiodsandfewoffspring.
[]C. Becausepredatorshavehighlevelsofintraspecificcompetitionandinfantmortality
ishigh.
[]D. Becauseofenergylossesinthefoodchainthereisinsufficientenergytosupport
largenumbersoftertiaryconsumers.
[]E. Becausetertiaryconsumershavelargeterritories.

62. ThebelongingofahumanerythrocytetoserotypesA,B,0isdeterminedbychemical
markersonitssurface.Thesemarkersare:
[]A. lipidmolecules
[]B. oligosaccharides
[]C. polypeptides
[]D. antibodies
[]E. nucleicacids

63. Nitrogenfertilizationofricefieldscanbelowinthepresenceofoneofthefollowing
typesoforganisms.Whichone?
[]A. Waterfern(Azollaspecies)
[]B. Greenalgae
[]C. Brownalgae
[]D. Mosses

64. Thelightreactioninphotosynthesiscanbemadetooccurexperimentallyinthe
absenceof:
[]A. water
[]B. carbondioxide
[]C. chlorophyll
[]D. ADP
[]E. hydrogencarriers

65. Whichofthefollowingservesastheheartsprimarypacemaker?
[]A. SAnode
[]B. BundleofHis
[]C. Purkinjefibers
[]D. Vagusnerve

66. Intheconversionofglucosetotwomoleculesofpyruvate,whichofthefollowing
occur?
I. HydrolysisofATP
II. Phosphorylationofhexose
III. ReductionofNAD
IV. ReleaseofCO2

[]A. I&II
[]B. II&III

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 7
[]C. III&IV
[]D. I,II&III
[]E. II,III&IV

67. Telomeraseisresponsiblefor_____thesizeoftelomeres,anditsfunctionisoften____
incarcinogenesis.
[ ] A. maintaining ... increased
[ ] B.maintaining ... decreased
[ ] C. decreasing ... decreased
[ ] D. decreasing ... increased

68. ThephylumArthropodaincludeswhichofthefollowingclasses?
I. Crustacea.
II. Polychaeta.
III. Insecta.
IV. Arachnida.
[]A. I,II&III
[]B. I,III&IV
[]C. II,III,&IV
[]D. I,II&IV
[]E. Allofthem

69. Theorderofnormalbloodflowthroughthehumanheartis
[ ] A. right atrium, right ventricle, lungs, left atrium, left ventricle, body
[ ] B.right ventricle, right atrium, lungs, left ventricle, left atrium, body
[ ] C. right ventricle, right atrium, body, left ventricle, left atrium, lungs
[ ] D. right atrium, right ventricle, body, left atrium, left ventricle, lungs

70. Asplitgeneconsistsofcodingregions(exons)andnoncodingregions(introns).The
figureshowshowsuchageneleadstotheproductionofproteinP.Whichofthe
followingstatementsistrue?

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 7

[]A. Thyminecontentof(1)and(2)isequal
[]B. Theprocessoccurringbetween(1)and(2)takesplaceinthecytosol.
[]C. (3)isfunctionalmRNA.
[]D. Thenumberofaminoacidresiduesin(5)mustequalthenumberofnucleotide
residuesin(2).
[]E. Theprocessoccurringbetween(3)and(5)takesplaceinnuclei.

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 8

71. Thepromoterregionofaprokaryoticgeneislocated______tothegeneandisthe
bindingsitefor______.
[ ] A. 3'...DNA polymerase
[ ] B.5'...RNA polymerase
[ ] C. 5'...DNA polymerase
[ ] D. 3'...RNA polymerase

72. AnincreasedconcentrationofNa+inthebloodplasmawouldstimulatethesecretion
ofwhichhormone?
[]A. FSH
[]B. ADH
[]C. GnRH
[]D. Aldosterone

73. Thediagrambelowsummarizesthestagesinvolvedinrespiratorymetabolismof
mammalianskeletalmuscle.Whichoneofthefollowingshowsthestagesinvolved
inglycolysis?

[]A. 1&2only
[]B. 1,2&3only
[]C. 1,2&4only
[]D. 1,2&5only
[]E. 1,2,3&4

74. Theconcentrationofanelectricallyneutralsubstancewithinacertaintypeofblood
cellismuchhigherthanitisinthesurroundingbloodplasma,yetthesubstance
continuestomoveintothecell.Theprocessbywhichthissubstancemovesinto
thecelliscalled:
[]A. osmosis
[]B. simplediffusion
[]C. facilitateddiffusion
[]D. activetransport

75. WhichofthefollowingorganismsisINCORRECTLYpairedwithitstrophiclevel?
[ ] A. Human - tertiary consumer

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 8
[ ] B.Beetle - secondary consumer
[ ] C. Grass - primary producer
[ ] D. Cyanobacteria - primary producer

76. Whichofthefollowingorganismsisusedtotransfergenesintohigherplants?
[]A. Escherichiacoli
[]B. Rhizobiumtrifolii
[]C. Agrobacteriumtumefaciens
[]D. Salmonellatyphimurium
[]E. Bacillusradicicola.

77. Whichofthefollowingecologicalstatementsaretrue?
I. Alltertiaryconsumersarepredators.
II. Detritusismadefromdeadplantsandanimals.
III. Netprimaryproductivityisalwayslowerthangrossprimaryproductivity.
IV. Pyramidsofenergycansometimesbeinverted.
V. Oneanimalcansometimesoccupymorethanonetrophiclevelinafoodweb.
[]A. I&II
[]B. II&III
[]C. III&IV
[]D. I,II&III
[]E. II,III&V

78. Animalandplantcellspossesschannelsdirectlyconnectingthecytoplasmofonecell
tothecytoplasmofanothercell.Whichofthefollowingpairsallowsthis
communication?
[]A. plasmodesmata,desmosomes
[]B. plasmodesmata,Ca2+ATPase
[]C. porin,gapjunction
[]D. gapjunction,plasmodesmata.

79. WhenamusclecellhasashortageofoxygenwillthepHdecreaseorincrease?What
substanceisresponsibleforthischangeinpH?ChangeinpHcausedby
[]A. decreaselactate(lacticacid)
[]B. decreasecarbondioxide
[]C. increaselactate(lacticacid)
[]D. increasecarbondioxide

80. Standingcropis:
I. Thenumberofplantsgrowinginaparticularhabitatataspecifictimeofyear
II. thenumberofstemsstillerectafteraviolentstorm
III. notagoodindicatorofproductivity
IV. thebiomassofaknownsampleinaparticularhabitatataspecifictime
V. notaffectedbyseasonalvariationsinlightandtemperature.

[]A. I&II
[]B. II&III
[]C. III&IV

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 8
[]D. I,II,&III
[]E. II,III&IV

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 9

81. WhatletterindicatesthequantityofDNApercellattheendofmeiosisI(seefigure)?

[]A. A
[]B. B
[]C. C
[]D. D
[]E. E

82. AhusbandandwifehaveachildwithbloodtypeAB.ThewifeisbloodtypeO.Whatis
thebloodtypeofthehusband?
[]A. A
[]B. B
[]C. AB
[]D. O

83. Themaintrendintheevolutionoflandplantwas:
[]A. asharpdemarcationofthephasesofsporophyteandgametophyte
[]B. ashorteningofthehaploidphase
[]C. ashorteningoftheasexualphase
[]D. anincreaseinthecomplexityofthegametophyte

84. Wheredoestranslationoccurinabacteria?
[]A. nucleus
[]B. endoplasmicreticulum
[]C. cytoplasm
[]D. CellMembrane

85. Allopatricspeciationreferstospeciesformedafterwhichtypeofseparation:
[ ] A. niche
[ ] B.temporal
[ ] C. geographic
[ ] D. behavioral

86. AbacterialmRNAwithalengthof360nucleotidesinlengthcodesforaproteinof:
[]A. roughly360aminoacids
[]B. roughly1080aminoacids

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 9
[]C. exactly120aminoacids
[]D. lessthan120aminoacids

87. Unlikemostpolypeptidehormones,steroidhormonesareuniqueinthatthey
[ ] A. Activate gene transcription
[ ] B.Can bind proteins
[ ] C. Diffuse across cell membranes
[ ] D. Can be used as therapeutic drugs

88. Wheninvestigatingenzyme/substrateinteraction,whichofthefollowingwouldbe
expectedtoshowalinearrelationshipunderconstantconditions?
I. rateofreactionagainstenzymeconcentrationinthepresenceofexcesssubstrate.
II. rateofreactionagainstenzymeconcentrationwiththeamountofsubstratelimited
III. amountofproductagainsttime,withtheamountofsubstratelimited
IV. rateofreactionagainstsubstrateconcentration
[]A. Ionly
[]B. I&II
[]C. IIIonly
[]D. II&IV
[]E. IVonly

89. Thefigureshowspossiblepositionsoftheblackheadedgull(Larusmelanocephalus).
Agullhaslandedbyaccidentintheterritoryofanothergullandbothgullsmeet
eachother.Whichpositionwillprobablybeshownbythevisitorgull.

[]A. position1
[]B. position3
[]C. position5
[]D. position7
[]E. position9

90. Whichofthefollowingmoleculesincreasesthebloodscapacitytocarryoxygen?
[]A. albumin
[]B. glucose

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 9
[]C. hemoglobin
[]D. fibrin

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 10

91. Onepollenmothercellmayproducefourgerminatingpollengrains,eachwithtwo
malenucleiandonetubenucleus.Howmanymeioticdivisionsarenecessaryto
bringthisabout?
[]A. none
[]B. one
[]C. three
[]D. four
[]E. twelve

92. IfanorganismhasK+channelsinitsneuronthatclosefasterthanhumanK+
channels,whichofthefollowingperiodswouldyouexpecttobedecreasedinthis
organism?
[]A. absoluterefractoryperiod
[]B. relativerefractoryperiod
[]C. extentofdepolarization
[]D. Noneoftheabove

93. Thepictureshowsaschematicdrawingofthecellcycle.Somebodylikestodetermine
thedurationoftheSphase.Thisisdoneinaddingawithtritiumlabeled
compoundRtothemediumoftheorganismwiththedividingcells.Whichofthe
followingcompoundsismostsuitabletobeR?

[]A. adenine
[]B. cytosine
[]C. guanine
[]D. thymine
[]E. ATP

94. Thegenotypeofanorganism:
[]A. Interactswiththeenvironmenttodeterminethephenotype
[]B. Issolelyresponsiblefordeterminingthephenotype
[]C. Isthesumofalltheallelescarriedontheautosomes
[]D. Includesonlythedominantalleleswhichshowinthephenotype
[]E. Isconstantwithinaspecies.

95. WhatenzymedoesHIVusetoconvertRNAtoDNA?
[ ] A. DNA gyrase
[ ] B.RNA polymerase

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 10
[ ] C. DNA helicase
[ ] D. Reverse transcriptase

96. Whenacellshowsincipientplasmolysis:
[]A. thewaterpotentialwillbeatitsleastnegativevalue
[]B. thepressurepotentialwillbezero
[]C. thesolutepotentialwillbehighandpositive
[]D. thesolutepotentialwillbehighandnegative
[]E. thepressurepotentialwillbehigh

97. Whichgroupofplantshasvasculartissuebutdoesnotproduceseeds?
I.Mosses
II.Ferns
III.Gymnosperms

[ ] A. I
[ ] B.II
[ ] C. III
[ ] D. II & III

98. Xylemvesselscarryliquidwaterfromtherootsofplantstotheleaves,butinthe
processoftranspirationitiswatervapourwhichislostthroughthestomata.The
changeofstatefromliquidtovapouroccursfromthe:
[]A. outersurfaceofthelowerepidermis;
[]B. cellulosewallsoftheguardcells;
[]C. wallsofthespongymesophyllcellsoftheleaf;
[]D. lignifiedwallsofthexylemvessels;
[]E. outersurfaceoftheupperandlowerepidermis.

99. Thegrowthspeedofapopulationcanoftenbedescribedwiththelogisticgrowth
equation:
dN/dt = rN(K-N)/K
In this equation, N is the number of individuals, r is the intrinsic
relative rate, and K is the carrying capacity. According to this
equation, the equilibrium number of individuals in the population is
determined by:
[]A. ronly
[]B. Konly
[]C. randK
[]D. NandK
[]E. randN

100. Wheredobeans(Fabaceae,e.g.soybeanGlycinemax,syn.Sojahispida)store
reservematerialforgermination?
[]A. inthepericarp

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 10
[]B. inthecotyledonsoftheembryo
[]C. inthetriploidnutritivetissue(endosperm)oftheseed
[]D. inthediploidnutritivetissue(perisperm)oftheseed
[]E. inthecotyledonsandtheendosperm.

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 11

101. Astandardnumberofleafdiscsofequalareawereplacedinsealedvessels
containingbicarbonateindicatorsolutionandkeptinthedarkforabout12hours.
Thecontrolvesselcontainednoleafdiscs.Allthevesselswerethenexposedto
lightatdifferentintensitiesand,after2hoursat20 oC,thefollowingresultswere
obtained.

Thebestconclusionfromthesedataisthat
[]A. speciesIisasunplantandspeciesIIisashadeplant
[]B. speciesIIislessefficientatphotosynthesisthanspeciesI
[]C. thetwospecieshavedifferentcompensationpoints
[]D. speciesIIhasahigherrespirationratethanspeciesI
[]E. speciesIhasahigherrespirationratethanspeciesII.

102. Whatnameisgiventotheprocessbywhichaminimalnumberofstimulifroma
presynapticneuronearerequiredtoinitiateanactionpotentialinapostsynaptic
neurone?
[]A. Excitation
[]B. Summation
[]C. Repolarisation
[]D. Depolarisation
[]E. Cumulativestimulation

103. Thesightofcowsgrazinginafieldisacommonoccurrence.Whyisit,whenaherd
ofcowsgrazesacrossafield,thattheyallfaceinthesamedirection?Itisan
exampleof:
[]A. territorialbehaviour
[]B. trialanderrorlearning
[]C. habituation
[]D. reactiontotheprevailingwindconditions,
[]E. reducingheadtoheadconflictsbetweendominantandsubordinateanimals

104. Respiratoryalkalosisresultsfromwhichofthefollowing?
[]A. infrequentbreathing
[]B. rapidbreathing
[]C. largemeals
[]D. Noneoftheabove

105. Inangiospermsthepigmentinvolvedindetectingdaylengthis:
[]A. carotene

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 11
[]B. chlorophyll
[]C. cytochrome
[]D. phytochrome
[]E. auxin

106. Whichclassesoflipidshavenonpolarsidechainsandpolarheadgroups?
[]A. phospholipids
[]B. triglycerides
[]C. cholesterol
[]D. waxes
[]E. glycerol

107. Thecellbodiesofafferent(sensory)nervesinvolvedinsomaticreflexesarelocated
inthe
[ ] A. Dorsal root ganglion
[ ] B.Ventral root ganglion
[ ] C. Spinal nerve
[ ] D. Grey matter of spinal cord

108. Predationisconsidereda_________interaction,whileMutualismisconsidereda
___________interaction.
[ ] A. +/+, +/+
[ ] B.+/-, +/+
[ ] C. +/0, -/-
[ ] D. -/-, +/+

109. PartoftheTCA(Krebs)cycleisrepresentedinthefigurebelow.Iftheenzyme
responsiblefortheconversionofsuccinicacidtofumaricacidbecameinactive,
whichofthefollowingwouldoccur?

I. someaccumulationofsuccinicacid
II. continuedconversionofaketoglutaricacid
III. gradualdisappearanceoffumaricacid
IV. animmediatehaltintheproductionofmalicacid
[]A. I&II
[]B. II&III
[]C. III&IV
[]D. I,II&III
[]E. II,III&IV

110. Amolluscsampleisgiventoabiologist.Afterexaminingthesamplehesaysthatit
belongstoBivalvia.Whichofthefollowingsmaybethekeythatmakeshimto
reachthisconclusion?
[]A. gills
[]B. absenceofradula
[]C. bodysymmetry
[]D. mantle

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 12

111. WhichcomponentofskeletalmusclebindsCa2+ionstoinitiatemusclecontraction?
[]A. ATP
[]B. Myosin
[]C. Tropomyosin
[]D. Actin
[]E. Troponin

112. Whenanewmaletakesoveralionpridetheysometimeskillorevictthecubs
alreadypresent.Thisphenomenacanbeexplainedfrombehavioralecology:
[]A. themaledoesnotlikecubs
[]B. themalecannotaffordtoomuchforcaringthosecubs
[]C. themalebreedhisownoffspring
[]D. degenerationofthemalesparentalbehavior

113. Acultureofyeastcellsgrowingvigorouslyintheabsenceofoxygenconverts
glucosetoethanolandcarbondioxide.Whichofthefollowingstatementsabout
thismetabolicprocessarecorrect?
I. Inthisprocess,pyruvicacidisconvertedtoacetylcoenzymeA.
II. Theprocessinvolvesdecarboxylation.
III. TheprocessproduceslessATPthanituses.
IV. ThereisnonetreductionofNAD.
V. Oxidationsareinvolved,althoughtheprocessisanaerobic.

[]A. I&III
[]B. II&V
[]C. III&IV
[]D. I&IV
[]E. II&IV

114. Integraltransmembraneproteinsareproteinsimbeddedinthecellmembrane.
WhichofthefollowingaminoacidswouldyouMOSTexpecttofindinthe
transmembraneregionofsuchproteins?
[ ] A. Tryptophan
[ ] B.Lysine
[ ] C. Serine
[ ] D. Arginine

115. Pavlovstudiedsalivationindogsinresponsetofood.Dogswillnormallyproduce
salivawhentheysee,smellortastefood.Eachtimehefedthedogsherangabell.
Afterfiveorsixrepetitions,thedogproducedsalivaonhearingthebell,even
thoughitwasnotgivenfood.Thistypeofbehaviouriscalled:
[]A. operantconditioning(trialanderrorlearning)
[]B. classicalconditioning
[]C. latentlearning
[]D. imprinting

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 12
116. Ageofsometreescanbedeterminedduetothepresenceofthe"treerings"(annual
growthrings),whichrepresenttheannualgrowthof:
[]A. primaryphloemandxylem
[]B. secondaryphloemandxylem
[]C. secondaryphloemonly
[]D. secondaryxylemonly

117. IntheEuropeanpopulation,about1in2500peoplesuffersfromCysticFibrosis,a
geneticallydetermined(descared),autosomaldisease.Healthyparentshavea
childsufferingfromCysticFibrosis.Thewomanremarriesahealthyman.Whatis
thechanceofachildfromthissecondmarriagesufferingfromCysticFibrosis:
[]A. 1:25
[]B. 1:50
[]C. 1:100
[]D. 1:625

118. WhenamusclecellhasashortageofoxygenthepHchanges.Whichofthe
followingiscorrect?
pH substance
change
[_] decrease carbon dioxide
A.
[_] decrease lactic acid
B.
[_] increase carbon dioxide
C.
[_] increase lactic acid
D.
[_] decrease pyruvate
E.

119. EcologicalassembliesKthroughQconsistofspeciesdesignatedwithnumbers1
through8,presentavariousdensities.Individualdensitiesofthesespeciesinany
particularassemblyaregiven(asindividualspersquaremeter)inthetable.Which
oftheaboveassembliesistheleastsusceptibletoamassivepestinfection
(gradation)?
assembly [_] K [_] L [_] M [_] N [_] P [_] Q

species 1 50 92 75 0 0 0

species 2 30 4 5 25 2 65

species 3 10 0 5 20 3 20

species 4 10 0 5 20 5 10

species 5 0 1 5 20 40 3

species 6 0 1 5 5 50 2

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 12

species 7 0 1 0 0 0 0

species 8 0 1 0 0 0 0

120. WhichisTRUEofthedarkreaction(Calvincycle)ofphotosynthesis?
[ ] A. It uses oxygen
[ ] B. It produces sucrose
[ ] C. It uses carbon dioxide
[ ] D. Both b and c are correct

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 13

121. Inchemiosmosis,hydrogenions(protons)releasetheirenergytoproduceATPas
theypassacrosstheinnermitochondrialmembrane.Thisprocessinvolvestheuse
of:
[]A. ATPsynthetase
[]B. ATPdehydrogenase
[]C. ATPdecarboxylase
[]D. electroncarriers
[]E. NAD

122. FemaleshavetwoXchromosomes,butoneisinactivated.Whatisthenameforthis
inactivatedXchromosome?
[]A. aBarrbody
[]B. arepressedchromosome
[]C. azygoticbody
[]D. asilentchromosome

123. Toreachtherighthand,thebloodfromthestomachandintestinesmustpass
through:
I. theheart(once)
II. theheart(twice)
III. carotidarteries
IV. thelungs
V. theliver
VI. thebrain
[]A. I,IV,&V
[]B. I&IV
[]C. II,IV&V
[]D. II,IV&VI
[]E. III,IV&V

124. Incardiacmuscle,calciumionscanmovefreelybetweenadjacentcellsthrough
whichofthefollowingstructures?
[ ] A. gap junctions
[ ] B.tight junctions
[ ] C. calcium pumps
[ ] D. plasmodesmata

125. Reflexactionsplayanimportantpartinseveraltypesofinnatebehaviour,suchas
taxesandkineses.Whichofthefollowingcorrectlyidentifiesthesequenceof
eventsinasimplereflexaction?
[]A. receptor,brain,effector,response,stimulus
[]B. stimulus,brain,effector,receptor,response
[]C. stimulus,receptor,brain,effector,response
[]D. receptor,brain,stimulus,effector,response
[]E. stimulus,receptor,effector,brain,response

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 13

126. AmutationinacodingDNAsequencecreatesaprematurestopcodon.Whichof
thefollowingcouldbeapossibleeffectofthismutationonthepolypeptide?
I. Itnolongerfunctionsproperly.
II. Itislongerthanexpected.
III. Itisnotproperlytargetedtothecorrectregionofthecell.
[]A. Ionly
[]B. IIonly
[]C. IIandIIIonly
[]D. IandIIIonly

127. Thevelocityofactionpotentialconductionacrossanerveaxonisincreasedbythe
presenceofthemyelinsheath.Intheperipheralnervoussystem,whatcell
myelinatestheaxon?
[ ] A. Oligodendocyte
[ ] B.Astrocyte
[ ] C. Schwann cell
[ ] D. Microglial cell

128. Crossingoveroccursinwhatphaseofmeiosis?
[]A. ProphaseI
[]B. MetaphaseI
[]C. TelophaseI
[]D. MetaphaseII

129. Whichofthefollowingstatementsonintronsiscorrect?
[]A. Theyarenontranscribedsequences(spacers)betweentwogenes.
[]B. Theyaretranscribedspacersbetweentwogenes.
[]C. Theyarelocatedbetweenthecodingregionsofagene.
[]D. TheyarelocatedbetweenthecodingregionsofamaturemRNA
[]E. TheyarenoncodingregionsofapolycistronicmRNA

130. Inthebloodofanadultmanthetotalcontentofhaemoglobinis,roughly:
[]A. severalhundredgram
[]B. tensofgram(10100g)
[]C. severalgram
[]D. severalhundredmilligram
[]E. tensofmilligram

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 14

131. Thelargestwhitebloodcellinhumanswhichisapartofthebodysmacrophage
defencesystemis:
[]A. neutrophil
[]B. lymphocyte
[]C. monocyte
[]D. eosinophil
[]E. basophil

132. Reproductionisoftenconnectedwithashiftfromhaploidtodiploidortheother
wayround.Pleasereviewthediagramanddecidewithgroupoforganismsshows
thebelowmentionedtypeofshift.

[]A. humans
[]B. angiospermplants
[]C. gymnospermplants
[]D. ferns

133. WhichofthefollowingdoesNOTrepresentanalterationtoachromosome?
[]A. translocation
[]B. inversion
[]C. deletion
[]D. nondisjunction

134. Whichofthefollowingmaypassacrossthemammalianplacenta?
I. maternalantibodies
II. maternallymphocytes
III. alcohol
IV. viruses
V. erythrocytes
[]A. I,II&III
[]B. II,III&IV
[]C. III,IV&V
[]D. I,IV&V
[]E. I,III&IV

135. Whichphylumofinvertebratesischaracterisedbypentamerousradialsymmetry
andpossessionoftubefeet?
[]A. Mollusca

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 14
[]B. Arthropoda
[]C. Echinodermata
[]D. Annelida
[]E. Platyhelminthes

136. Whichofthefollowingalternativesisnotanindicationofannualphotoperiodism?
[]A. swarming
[]B. moulting
[]C. flowering
[]D. sleep

137. WhichofthefollowingisTRUEofprokaryotes?
I.Simultaneoustranscriptionandtranslation
II.Presenceofintronsequences
III.CircularDNA

[ ] A. I and II only
[ ] B.I and III only
[ ] C. II and III only
[ ] D. I, II, and III

138. Inadisputedpaternitycase,thefollowingbloodgroupswereidentified:
Mother GroupA
Baby GroupO
MrRich GroupA
MrFamousGroupB

Whichofthefollowingstatementsistrue?
[]A. Bothmencouldbethefather(eithermancouldbethefather.)
[]B. MrRichcannotbethefather.
[]C. MrFamouscannotbethefather.
[]D. Neithermancouldbethefather.

139. Inthefernlifecycle,thedominantgenerationisthe:
[]E. haploidgametophyte
[]F. diploidsporophyte
[]G. haploidsporophyte
[]H. diploidgametophyte

140. WhichofthefollowingstatementsabouttheworkofGregorMendelarecorrect?
I. Heconcludedthatthecharacteristicsofanorganismaredeterminedbyinternal
factors(genes)whichoccurinpairs.
II. Heconcludedthatonlyoneofapairoffactorscanberepresentedinasinglegamete.
III. Heconcludedthatfactorsarelinkediftheyoccuronthesamechromosome.
IV. Heconcludedthateachmemberofapairoffactorscancombinerandomlywitheither
memberofanotherpair.
V. HeconcludedthatindependentsegregationmustoccurduringmetaphaseIof
meiosis.
[]A. I&II

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 14
[]B. II&III
[]C. III&IV
[]D. I,II&IV
[]E. II,III&V

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 15

141. Whichofthefollowingisnotapartoftheneuron?
[]A. dendrites
[]B. hillock
[]C. soma
[]D. sarcoplasmicreticulum

142. Inrabbits,thedominantallele(B)codesforblackbodycolourandtherecessive
allele(b)codesforwhitebodycolour.Acrossbetweentworabbitsproduced9
blackandthreewhiteoffspring.Whichofthefollowingstatementsaboutthiscross
aremostlikelytobecorrect?
I. Thisisamonohybridcrossshowingsexlinkage.
II. Thisisamonohybridautosomalcrossbetweentwoheterozygotes.
III. Themaleusedinthecrosswashomozygousrecessive.
IV. ThegenotypesoftheoffspringcouldincludeBb,BB,andbbindividuals.
V. Thefemaleusedinthiscrosswashomozygousdominant.
[]A. I&III
[]B. II&V
[]C. III&IV
[]D. I&IV
[]E. II&IV

143. WhenthebasecompositionofDNAfrombacteriumMycobacteriumtuberculosis
wasdetermined,18%ofthebaseswerefoundtobeadenine.WhatistheG+C
contentinM.tuberculosis?
[ ] A. 18%
[ ] B.32%
[ ] C. 36%
[ ] D. 64%

144. Mesodermtissueisabsentin:
[]A. Cnidaria
[]B. Mollusca
[]C. Insecta
[]D. Echinodermata
[]E. Crustacea

145. Byasuitablemethodoflaboratoryculture,asinglecelltakenfromtheinteriorof
aleafofaceleryplantcanbegrownintoanothercompleteceleryplant.Whichtwo
ofthefollowingstatementsaboutthisprocedurearecorrect?

I. Intermsoftheendproductofgrowth,thesingleleafcellisequivalenttoazygote.
II. Cellsofthenewplantareproducedbyacombinationofmitoticandmeioticdivisions.
III. Genesresponsibleforrootdevelopmentareabsentfromthesingleleafcell.
IV. Thephenotypeofthetwoceleryplantswillbeinfluencedbytheirenvironment.
V. Thisisaspecialformofcloninginvolvingtheuseofreversetranscriptaseandthe
replicationofDNAbytheconservativemethod.
[ ] A. I & II

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 15
[ ] B.II & V
[ ] C. III & IV
[ ] D. I & IV
[]E. II&IV

146. Duringhumandevelopment,whichprocessleadstotheformationofthreegerm
layers?
[]F. gastrulation
[]G. neurelation
[]H. morulation
[]I. cephalization

147. DNAsynthesisonthelaggingstrandoccursbytheendtoendligationof
[ ] A. Okasaki fragments
[ ] B.RNA primers
[ ] C. DNA topoisomerases
[ ] D. DNA polymerases

148. Nerveimpulsescantravelinbothdirections.Theseimpulsesareunidirectional
alonganaxonbecause:
[ ]
A. dendrites have a higher threshold than axons
[ ]
B.the axon terminals have a higher threshold than axons
[ ]
C. the myelin sheath directs the flow of ions toward the axon terminals
[ ]
D. the axon terminals contain neurotransmitter receptors and the
dendrites do not
[ ] E. dendrites do not contain neurotransmitter substance

149. WhichofthefollowingcharacterizesDNAsynthesisontheleadingstrand?
I.Itoccursfrom5to3
II.ItrequiresRNApolymerase
III.TheresultingDNAiscomplementarytothetemplate
[ ] A. I only
[ ] B.II only
[ ] C. III only
[ ] D. I and III only

150. Thediagramsshowverticalsectionsofkidneysofcoypu,brownratandkangaroo
rat,showingtherelativesizeofcortexandmedulla.Coypuarefoundinfresh
waterandarenevershortofwatertodrink.Brownratsareabletogosomedays
withoutdrinking.Kangarooratsareabletoliveindesertswithoutdrinkingatall.
Whichkidneybelongstowhichanimal?

USABO 2004 Study Questions


USA Biology Olympiad Study Questions Set 15

1 2 3
[_] A. brown rat coypu kangaroo rat
[_] B. brown rat kangaroo rat coypu
[_] C. kangaroo rat brown rat coypu
[_] D. kangaroo rat coypu brown rat

USABO 2004 Study Questions


151. Oxygencontentreductionmakestheglycolyse(glycogenesis)intensityincreaseddueto:
[ ] A. increase of ADP concentration in cell
[ ] B.increase of NAD+ concentration in cell
[ ] C. increase of ATP concentration in cell
[ ] D. increase of concentration of peroxides and free radicals

152. Protostomeshave_____and_____typesofcleavage.
[ ] A. radial ... indeterminate
[ ] B.radial ... determinate
[ ] C. spiral ... indeterminate
[ ] D. spiral ... determinate

153. Incats,thegeneforcoatcolourisfoundonthenonhomologouspartoftheX
chromosome.Thegenehastwoalleles;Bgivesblackcoat,bgivesyellowcoatandBb
producesamottledcolourcalledtortoiseshell.Incats,femalesarehomogametic(XX)and
malesareheterogametic(XY).Acrosswascarriedoutbetweenafemaletortoiseshelland
ablackmale.Whichofthefollowingstatementscouldbetrueaboutthiscross?
I. Thereisnochanceofproducingblackmaleoffspring.
II. Allfemaleswillbeblack.
III Malescouldbeblackoryellow.
IV. Femalescouldbeblackortortoiseshell.
V. Thereisnochanceofproducingyellowmaleoffspring.
[ ] A. I & II
[ ] B.II & III
[ ] C. III & IV
[ ] D. I, II & III
[ ] E. II, III & V

154. Theecosystemsshowninthetabledifferintheamountoftheirnetprimaryproduction.
Selectthecorrectorder(increasingnetprimaryproduction)oftheecosystemsshownin
thetable.

[ ] A. 3, 6, 2, 5, 4, 1
[ ] B.3, 6, 5, 2, 4, 1
[ ] C. 6, 3, 5, 2, 4, 1
[ ] D. 6, 3, 2, 5, 1, 4

155. Oneofthealternativesbelowdefinesthelayersoftheretinainthecorrectsequence.
Whichone?(N.B!Thefirstlayerineachsequenceissupposedtobelocatednexttothe
jellylikevitreoushumorthatfillstheeyeball.)
[ ] A. pigmented cells-bipolar cells-ganglion cells-photoreceptors
[ ] B.photoreceptors-pigmented cells-ganglion cells-bipolar cells
USABO 2004 Study Questions
[ ] C. ganglion cells-bipolar cells-photoreceptors-pigmented cells
[ ] D. photoreceptors-bipolar cells-ganglion cells-pigmented cells

156. Iftheoperatorofageneregulatedinthesamemannerasthelacoperonismutated,what
wouldyouexpect=wouldhappentothelevelofexpressionofthegene?
[ ] A. It would increase, because the repressor cannot bind the mutant operator as
tightly.
[ ] B.It would increase, because the operator becomes a stronger promoter.
[ ] C. It would decrease, because the activator cannot bind the operator as tightly.
[ ] D. It would decrease, because the operator is not as strong a promoter.

157. Theincreaseincomplexityofthevertebratecirculatorysystemisrepresentedbyoneof
thefollowingcombinations.Whichcombination?
[ ] A. toad-rabbit-alligator-shark
[ ] B.shark-frog-alligator-rabbit
[ ] C. shark-crocodile-rabbit-frog
[ ] D. alligator-dog-shark-toad

158. Supposegene"C"isthegeneforcolor.Itsdominantallelehastheeffectofallowingthe
productionoffurcolorwhileitsrecessivealleleinterruptscolorproduction.Atanother
locus,thereexistsanothergenethatinfluencescolor,atwhichblack(B)isdominantto
brown(b).Whatistherelationshipbetweenthesegenescalled?
[ ] A. Epistatic
[ ] B.Peralogous
[ ] C. Dominant
[ ] D. Antagonistic

159. Aheronstandinginacoldwaterforalongtimedoesntgetitslegsoverchilledbecauseof:
[ ] A. countercirculation in limbs
[ ] B.even thin fat layer under limbsskin
[ ] C. branched blood stream in limbs
[ ] D. intensive metabolism in limbs

160. Whichofthefollowingdefinitionsoftheusesoffieldequipmentarecorrect?Duringfield
workanecologistmightuse:
I. anaugertocollectsoilsamples
II. adendrographtomeasurethediameterofatree
III. akeytoidentifyspecimens
IV. aclinometertomeasureslope

[ ] A. I & II only
[ ] B.II & III only
[ ] C. III & IV only
[ ] D. I, II & III
[ ] E. All of the above

USABO 2004 Study Questions