Вы находитесь на странице: 1из 643

(VFUHYHQWH7pFQLFR

  -XGLFLiULR7-6
7- 6mR3DXOR 1',&(

3UH]DGR D &DQGLGDWR D 
3UH]DGR D &DQGLGDWR D

(VWDDSRVWLODRUJDQL]DGDFRPWRGDVDVPDWpULDVMXUtGLFDVTXHVHUmRSHUTXLULGDV
(VFUHYHQWH7pFQLFR-XGLFLiULR
(VFUHYHQWH7pFQLFR-XGLFLiULRGR3RGHU-XGLFLiULR
HP&RQFXUVR3~EOLFRSDUDR&DUJRGH(VFUHYHQWH 7pFQLFR-XGLFLiULR
3$8/2('6210$548(6FRPHVSHFLDO
GR(VWDGRGH6mR3DXORIRLHODERUDGDSHOR3URI'U3
FXLGDGRHDWHQomRjVXDGHVWLQDomRHQVLQDUQRo}HVGH'LUHLWRDSHVVRDVVHPIRUPDomR
MXUtGLFD

$JRUD 

  0$5d2
0$5d2   PDLVXPDYH]R3URI'U3
 3$8/2 ('621 0$548(6
DWXDOL]DLQWHLUDPHQWHHVWD$SRVWLODQmRVyHPIXQomRGDDYDODQFKDGHQRYDVOHLV
QRYDVOHLVTXH
QRYDVOHLV
PRGLILFDUDP UHYROXFLRQDULDPHQWH R RUGHQDPHQWR MXUtGLFR H HP HVSHFLDO R VLVWHPD
SURFHVVXDOFLYLOHDGPLQLVWUDWLYRQRWDGDPHQWHDV(PHQGDV&RQVWLWXFLRQDLVQ
       H  H D /HL Q
 1RYR&yGLJRGH3URFHVVR&LYLO HR3URYLPHQWRQEHPFRPRWRGRV
RVSURYLPHQWRVGHHGD&RUUHJHGRULD*HUDOGH-XVWLoDGR7-63
QmRVHSRGHQGRGHVFRQVLGHUDUTXHQHVVHVFHUWDPHVWDLVQRYLGDGHVVHPSUHVmRREMHWRGH
TXHVWLRQDPHQWRHGLIHUHQFLDPRVFDQGLGDWRVDWXDOL]DGRVGRVGHVSUHSDUDGRV

1mRpGHPDVLDGDDOHPEUDQoDGHTXHPDLVXPDYH]D HVFROKHXR3URI
'U 3$8/2 ('621 0$548(6 HP UD]mR GH VXD LQWHQVD YLYrQFLD HP FRQFXUVRV S~EOLFRV
KDYHQGR OHFLRQDGR QXP LQILQGiYHO Q~PHUR GH &XUVRV (VSHFLDOL]DGRV H QR SDVVDGR
SDUWLFLSDGRFRPR3URPRWRUGH-XVWLoDHPYiULDV&RPDUFDVFRPR0HPEURGH%DQFDV
([DPLQDGRUDVRTXHPDUFDVXDYDVWtVVLPDYLVmRGDLPSRUWkQFLDRULHQWDomRILQDOLGDGH
HSHFXOLDULGDGHGDVSURYDVPDWpULDHVHXHQIRTXHQRVFRQFXUVRV

3DUDVXDVHJXUDQoDFXOWXUDOUHJLVWUDPRVDLQGDTXHR3URI'U33$8/2('6210$548(6
WDPEpPQRVFRQFXUVRVGHTXHSDUWLFLSRXFRPRFDQGLGDWRPHUFrGHVHXVFRQKHFLPHQWRV
MXUtGLFRVORJURXDSURYDomRHP OXJDUSDUD0LQLVWpULR3~EOLFRGR(VWDGRGH6mR3DXOR

OXJDUSDUDR0LQLVWpULR3~EOLFRGR'LVWULWR)HGHUDODSURYDomRQRVSULPHLURVOXJDUHV

HPFRQFXUVRSDUD3URFXUDGRUGR(VWDGRHSDUDD0DJLVWUDWXUD)HGHUDOHRFXSRXR
FDUJRGH3URFXUDGRUGH-XVWLoDRPDLVDOWRFDUJRGDFDUUHLUDGR0LQLVWpULR3~EOLFRGR
(VWDGR GH 6mR 3DXOR  H Ki  DQRV YHP VH GHGLFDQGR DR 0DJLVWpULR -XUtGLFR H j
HODERUDomRGDV$SRVWLODV6ROXomR

(VWDVUHIHUrQFLDVVyOKHVmRSDVVDGDVSDUDTXHYRFrSRVVDDYDOLDUDUHVSRQVDELOLGDGH
GH DRUHVROYHUFRQWULEXLUDRVHXHVWXGRHSUHSDURHQRVVDVHULHGDGHDR
TXHUHUDX[LOLiORQRLQJUHVVRQXPDHVSHFLDOFDUUHLUDGRIXQFLRQDOLVPRS~EOLFRHVWDGXDOj
TXDOGHGLFDUiVXDYLGD

FODVVLILFDomR6yRVSULPHLURV
0DVOHPEUHVHVHPSUHQmREDVWDSDVVDU&RQFXUVRpFODVVLILFDomR
FODVVLILFDomR
FODVVLILFDGRVFRQTXLVWDPVHJXUDPHQWHVXDQRPHDomR3RULVVRWRGRHVWXGRpSRXFR
( 7 -
1',&(  VFUHYHQWH pFQLFR XGLFLiULR 7-6
7- 6mR3DXOR

LNGUA PORTUGUESA
Anlise, compreenso e interpretao de diversos tipos de textos verbais, no verbais,
literrios e noliterrios. Informaes literais e inferncias possveis. Ponto de vista
do autor. Estruturao do texto: relaes entre ideias; recursos de coeso . . . . . . . . . . . . . . 

Significao contextual de palavras e expresses. Sinnimos e antnimos.


Sentido prprio e figurado das palavras . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Classes de palavras: emprego e sentido que imprimem s relaes que estabelecem:


substantivo, adjetivo, artigo, numeral, pronome, verbo, advrbio, preposio e conjuno . . . . . . . 

Concordncia verbal e nominal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Regncia verbal e nominal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Colocao pronominal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Crase . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Pontuao . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Exerccios finais . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 

Gabarito . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
(VFUHYHQWH7pFQLFR
  -XGLFLiULR7-6
7- 6mR3DXOR 1',&(

&21+(&,0(1726
(0

',5(,72
',5(,723(1$/
&yGLJR3HQDOFRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO
&yGLJR3HQDO
/&yGLJR3HQDO
DUWLJRVD$&ULPHVFRQWUDD)p3~EOLFD                        
DUWLJRVDDD&ULPHVSUDWLFDGRVSRUFRQWUDD$GPLQLVWUDomR3~EOLFD  
DUWLJRVDH&ULPHVFRQWUDD$GPLQLVWUDomRGD-XVWLoD              

',5(,72352&(668$/3(1$/
&yGLJRGH3URFHVVR3HQDOFRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO
&yGLJRGH3URFHVVR3HQDO
/&yGLJRGH3URFHVVR3HQDO
DUWLJRVD'R-XL]HGR0LQLVWpULR3~EOLFR                                 
DUWLJRVH'R'HIHQVRUHGR&XUDGRUGR5pX0HQRU                           
DUWLJR'RV)XQFLRQiULRVGD-XVWLoD                                         
DUWLJRVD'D&LWDomRHGD,QWLPDomR                                     
DUWLJRVD'R3URFHGLPHQWR&RPXP                                     
DUWLJRVD'R3URFHVVR6XPiULR                                        
DUWLJRVD'R3URFHVVRGH5HVWDXUDomRGH$XWRV([WUDYLDGRVRX'HVWUXtGRV             
DUWLJRVD'RV5HFXUVRV                                            
/HLQGH DUWLJRVDH                            

(VWD$SRVWLODIRLHODERUDGDULJRURVDPHQWHGHDFRUGRFRPR3URJUDPD2ILFLDOGR&RQFXUVR
(VWD$SRVWLODIRLHODERUDGDULJRURVDPHQWH
ULJRURVDPHQWHGHDFRUGRFRPR3URJUDPD2ILFLDOGR&RQFXUVR
'DWDGD(GLomR
2VVtPERORVHPEOHPDVGLVWLQWLYRVHGHQRPLQDo}HVXWLOL]DGRVVmRPHUDPHQWHLOXVWUDWLYRVQmRVLJQLILFDQGR

DSRLRFRODERUDomRDXWRUL]DomRRXDERQRGDUHVSHFWLYD(QWLGDGH
HVyIRUDPHPSUHJDGRVSDUDEHPLGHQWLILFDUR&RQFXUVRDTXHVHUHIHUHHVWD$SRVWLOD
( 7 -
1',&(  VFUHYHQWH pFQLFR XGLFLiULR 7-6
7- 6mR3DXOR
',5(,72352&(668$/&,9,/
&yGLJRGH3URFHVVR&LYLOFRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO
&yGLJRGH3URFHVVR&LYLO
/&yGLJRGH3URFHVVR&LYLO
DUWLJRVD'RV$X[LOLDUHVGD-XVWLoDLPSHGLPHQWRVHVXVSHLomR                   
DUWLJRVD'RV$WRV3URFHVVXDLV                                       
DUWLJRVD'D7XWHOD3URYLVyULD                                        
DUWLJRVD'R3URFHVVRGH&RQKHFLPHQWRHGR&XPSULPHQWRGD6HQWHQoD              
DUWLJRVD'RV5HFXUVRV                                           
/HLQGH DUWLJRVDR                                 
/HLQGH-XL]DGRVGD)D]HQGD3~EOLFD                       

',5(,72&2167,78&,21$/
&RQVWLWXLomR)HGHUDO
&RQVWLWXLomR)HGHUDO FRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO
/&RQVWLWXLomR)HGHUDO
7tWXOR,,'RV'LUHLWRVH*DUDQWLDV)XQGDPHQWDLV                                   
&DStWXOR,DUWLJRGLUHLWRVHGHYHUHVLQGLYLGXDLVHFROHWLYRV                         
&DStWXOR,,DUWLJRVDGLUHLWRVVRFLDLV                                    
&DStWXOR,,,DUWLJRHQDFLRQDOLGDGH                                     
7tWXOR,,,&DStWXOR9,,
6HomR,DUWLJRVHDGPLQLVWUDomRS~EOLFDGLVSRVLo}HVJHUDLV                      
6HomR,,DUWLJRVDVHUYLGRUHVS~EOLFRV                                   
$UWLJR'R3RGHU-XGLFLiULRGLVSRVLo}HVJHUDLV                                  

',5(,72$'0,1,675$7,92
(VWDWXWRGRV)XQFLRQiULRV3~EOLFRV&LYLVGR(VWDGRGH6mR3DXOR /HLQ 
(VWDWXWRGRV)XQFLRQiULRV3~EOLFRV&LYLVGR(VWDGRGH6mR3DXOR
/(VWDWXWRGRV)XQFLRQiULRV3~EOLFRV&LYLVGR(VWDGRGH6mR3DXOR
DUWLJRVD'R5HJLPH'LVFLSOLQDUH3URFHVVR$GPLQLVWUDWLYR'LVFLSOLQDU               
/HL)HGHUDOQ /HLGH,PSURELGDGH$GPLQLVWUDWLYD
/HL)HGHUDOQ
//HL)HGHUDOQ                    
FRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO

1250$6'$&255(*('25,$*(5$/'(-867,d$
FRPDVDOWHUDo}HVYLJHQWHVDWpDSXEOLFDomRGR(GLWDO
7RPR,&DStWXOR,,6HomR,VXEVHo}HV,H,,
7RPR,&DStWXOR,,
/7RPR,&DStWXOR,, 'D)XQomR&RUUHFLRQDO                 
7RPR,&DStWXOR,,,'RV2ItFLRVGH-XVWLoDHP*HUDO
/7RPR,&DStWXOR,,,  
6Ho}HV,,,99,9,,                                                   
6HomR9,,,VXEVHo}HV,,,H,,,                                           
6Ho}HV,;D;9;9,,D;,;                                               
7RPR,&DStWXOR;,'R3URFHVVR(OHWU{QLFR
/7RPR,&DStWXOR;, 
6Ho}HV,,9H9                                                       
6HomR9,VXEVHo}HV,,,,9H;,,,                                        

37(67(6FRP  


(VFUHYHQWH7pFQLFR
  -XGLFLiULR7-6
7- 6mR3DXOR 1',&(

INFORMTICA
MS-Windows 10: conceito de pastas, diretrios, arquivos e atalhos, rea de trabalho,
rea de transferncia, manipulao de arquivos e pastas, uso dos menus, programas
e aplicativos, interao com o conjunto de aplicativos MS-Office 2016 . . . . . . . . . . . . . . . . . 01

MS-Word 2016: estrutura bsica dos documentos, edio e formatao de textos,


cabealhos, pargrafos, fontes, colunas, marcadores simblicos e numricos, tabelas,
impresso, controle de quebras e numerao de pginas, legendas, ndices,
insero de objetos, campos predefinidos, caixas de texto. . . . . . . . . . . . . . . . . . . . . . . . . . . . 11

MS-Excel 2016: estrutura bsica das planilhas, conceitos de clulas, linhas, colunas,
pastas e grficos, elaborao de tabelas e grficos, uso de frmulas, funes e macros,
impresso, insero de objetos, campos predefinidos, controle de quebras e
numerao de pginas, obteno de dados externos, classificao de dados. . . . . . . . . . . . . 20

Correio Eletrnico: uso de correio eletrnico, preparo e envio de mensagens,


anexao de arquivos. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34

Internet: navegao internet, conceitos de URL, links, sites, busca e impresso de pginas.. . . . 45

Bateria de Testes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61

Gabarito . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64

ATUALIDADES
Questes relacionadas a fatos polticos, econmicos, sociais e culturais, nacionais e
internacionais,ocorridos a partir do 2. semestre de 2016, divulgados na mdia local
e/ou nacional.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1
Questes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
( 7 -
1',&(  VFUHYHQWH pFQLFR XGLFLiULR 7-6
7- 6mR3DXOR

MATEMTICA
Operaes com nmeros reais. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 01
Mnimo mltiplo comum e mximo divisor comum. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Razo e proporo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41
Porcentagem. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
Regra de trs simples e composta. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
Mdia aritmtica simples e ponderada.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
Juro simples. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59
Equao do 1. e 2. graus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47
Sistema de equaes do 1. grau. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62
Relao entre grandezas: tabelas e grficos. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66
Sistemas de medidas usuais., Noes de geometria: forma, permetro, rea, volume. . . . . . . 28
ngulos; Teorema de Pitgoras.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77
Resoluo de situaes-problema.. . . . . . . . . . . . . . . . . . . . . . . . (no trmino de cada item)
100 questes de provas anteriores . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82

RACIOCNIO LGICO
Visa a avaliar a habilidade do candidato em entender a estrutura lgica das relaes
arbitrrias entre pessoas, lugares, coisas, eventos fictcios; deduzir novas informaes
das relaes fornecidas e avaliar as condies usadas para estabelecer a estrutura
daquelas relaes. Visa tambm avaliar se o candidato identifica as regularidades
de uma sequncia, numrica ou Figural, de modo a indicar qual o elemento
de uma dada posio. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 a 109

As questes desta prova podero tratar das seguintes reas:

Estruturas Lgicas; . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90

Lgicas de Argumentao; . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94

Diagramas Lgicos; . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100

Sequncias. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102
Lngua Portuguesa
Aquela frustrao nasce dessa atitude que Lorenz cha-
LNGUA PORTUGUESA ma de "muro de borracha" dbil, indefinida e acovardada do
adulto diante do jovem, to nociva quanto a ao punitiva
sistemtica de antigamente.

ANLISE, COMPREENSO E INTERPRETAO Educar tornou-se, h muito tempo, uma arte esquecida.
DE DIVERSOS TIPOS DE TEXTOS VERBAIS, No contato com o adolescente, o pai ou aquele que estima
NO VERBAIS, LITERRIOS E NO LITERRIOS. algum como se pode estimar um filho - no projeta apenas
INFORMAES LITERAIS E INFERNCIAS uma imagem, mas ele mesmo. Por obra do amor, verda-
POSSVEIS. PONTO DE VISTA DO AUTOR. deiro, atento, esquecido de si, profundamente interessado.
ESTRUTURAO DO TEXTO: RELAES
ENTRE IDEIAS; RECURSOS DE COESO Sendo isso, apenas isso, torna-se inevitvel a reciproci-
dade do amor.

Entendemos por texto, um conjunto de ideias expressas A solido do jovem , apesar do que se pensa em contr-
atravs de frases, oraes, pargrafos; com um estilo prprio rio, real e frequente. Embora acompanhado sempre e em
e com uma estrutura prpria produzido por um certo sujeito. A constante movimentao, o adolescente cr que o mundo
estrutura de um texto varia de acordo com sua natureza. H o dos adultos; e esses esto ocupados demais para ouvir os
texto literrio e o no literrio. seus pequenos devaneios. H uma busca disfarada de a-
teno e apoio, que s uns poucos percebem, e rarssimos
TEXTO se apressam em atender. A condio do homem , em si
mesma, de confronto com a solido, de que ele est, do ber-
Denotao Conotao o sepultura, sempre cercado.

Texto no literrio Texto-literrio A descoberta dessa realidade que no triste ou alegre,
 mas simplesmente um fato ocorre na puberdade, e nem
Claro, objetivo Figurado, subjetivo, sempre pacfica. Esse contato pode deixar um travo de
 melancolia, quando no h apoio compreensivo de um adulto
informativo pessoal que se estima e no qual se confia e que d a entender que
j passou por isso e sabe do que se trata, embora no tenha
uma resposta definitiva para os mistrios da vida. (Luiz Carlos
O texto literrio expressa a opinio pessoal do autor que Lisboa - Jornal da Tarde)
tambm transmitida atravs de figuras, impregnado de
subjetivismo. J o texto no literrio preocupa-se em transmi- O texto de Luiz Carlos Lisboa um texto no literrio,
tir uma mensagem da forma mais clara e objetiva possvel. porque disserta sobre um certo tema: a descoberta da solido
Como exemplo, podemos citar uma notcia de jornal como de forma objetiva, informativa, etc. Se tivesse dado ao tema
texto no literrio e um romance de Ea de Queirs ou Jos um tratamento potico, musical, lrico, por exemplo, seria um
de Alencar como exemplo de texto literrio. texto literrio, pois usaria recursos literrios, tais como a rima,
as figuras de linguagem, a fico para expressar sua opinio
Compreender um texto globalmente levar em conta os sobre a descoberta da solido.
vrios aspectos que ele possui, por exemplo, um texto ter
aspecto moral, social, econmico, conforme a inteno do A compreenso do texto pode ser feita da seguinte for-
autor; para ratificar esses aspectos o autor se utiliza de um ma, chamada objetiva:
vocabulrio condizente com sua inteno. Ento ... como
compreender textos em prova, se cada pessoa possui um
modo especfico de ver os fatos? 1) Segundo o texto, os jovens:

A resposta no simples. No obstante o valor subjetivo a) So autossuficientes.


do texto, ele possui uma estrutura interna que bsica e a b) Vivem no mundo da lua.
qual garantir uma compreenso objetiva. c) Necessitam de apoio e compreenso.
d) Esto sempre muito ocupados.
Compreender um texto no literrio perceber no texto a
opinio, a inteno do autor, onde ele pretende chegar com
aquele texto. 2) De acordo com o texto, pode-se afirmar que o ho-
mem:
Se o autor contra ou a favor de um certo tema, quais os
aspectos que o autor levanta. Nossa compreenso ser sem- a) Sente solido durante toda a vida.
pre a partir das informaes que o texto nos oferece. b) Est sozinho apenas no momento da morte.
c) Est sozinho apenas no momento do nascimento.
Observe o texto a seguir: d) Nunca est completamente sozinho.

ainda Lorenz, na mesma obra, quem identifica a frustra-


o dos jovens face a uma educao que, em nome da com- 3) Com relao solido, o texto afirma que:
preenso, baniu a firmeza e a liberdade com responsabilida-
de. Noes confusas de psicanlise, vagos anseios libert- a) O homem fica triste ao descobri-la.
rios, muita teoria e pouco conhecimento serviram para refor- b) O homem a descobre durante a adolescncia.
ar uma tolerncia preguiosa que passou a se constituir em c) O jovem a encontra por falta de apoio e compreen-
padro de comportamento para pais e educadores. so.
d) O jovem a encontra porque no confia nos adultos.

1
Lngua Portuguesa
4) Segundo o texto, o amor: guir o desdobramento dessa ideia nos pargrafos subsequen-
tes a fim de discutir, aprofundar o assunto.
a) um problema irrelevante na vida agitada do jo-
vem. J no texto-exemplo de Luiz Carlos Lisboa vemos que ele
b) E uma expresso romntica, uma frase fora de mo- vai preparando a introduo da ideia bsica com as ideias
da. acessrias, como se estivesse criando um ambiente propcio,
c) uma atitude hbil e simptica em relao ao jo- numa preparao textual onde o clmax seria a ideia bsica: a
vem. descoberta da solido. E um crescer de expectativas at
d) um meio pelo qual os adultos podem compreen- chegar ao cerne da questo.
der as atitudes dos jovens.
1) Sentido oposto: significa a ideia contrria de uma pala-
vra em relao a outra.
5) O texto afirma que:
2) Anlogo ou Equivalente: dizer que uma palavra anlo-
a) As geraes mais velhas s se preocupam em ga outra, significa dizer que ambas tm semelhanas de
transmitir os seus valores aos mais jovens. significados, so equivalentes.
b) Os jovens acham que o mundo est errado e que-
rem destru-lo. Num texto, palavras, oraes, frases, expresses so jus-
c) A energia e a generosidade dos jovens os levam a tapostas, colocadas lado a lado visando a uma inteno do
querer reformar o mundo. autor que produz o texto. Por vezes, usa palavras de signifi-
d) normalmente uma hipocrisia o fato de os jovens cado equivalente; de outra feita, utiliza-se de expresses,
quererem reformar o mundo. palavras com significados opostos, contudo todos esses
recursos tm uma inteno, usar o texto como veculo ou de
emoo, ou de crtica, de revelao, informao, etc.
6) "... dbil, indefinida e acovardada do adulto diante
do jovem." As palavras sublinhadas podem ser substi- Peguemos como exemplo o texto de Luiz Carlos Lisboa.
tudas, sem modificar o significado do texto, por:
No texto, h blocos de significados que se equivalem e
a) maluco, incoerente, medroso. que tm um certo significado luz do contexto dado.
b) fraco, indeterminado, medroso.
c) idiota, indeterminado, inseguro. Exemplos:
d) alegre, estpido, nervoso.
1 Atitude dbil (= louca) indefinida, acovardada equivale a
ao primitiva, sistemtica.
7) No pargrafo "A solido do jovem , apesar do que 2 Muita teoria equivale a pouco conhecimento.
se pensa em contrrio, real e frequente.", a frase 3 Solido real e frequente anloga acompanhado, cons-
sublinhada d uma ideia de tante movimentao.
4 Bero anlogo sepultura.
a) concluso. c) concesso.
b) condio. d) indefinio. O autor, no primeiro bloco de ideias, torna equivalente a
atitude dbil, indefinida e acovardada diante do jovem ao
punitiva. Em um outro contexto tal equivalncia seria impos-
RESPOSTAS svel, pois a atitude de liberdade total, num primeiro momento
1-C 2- A 3- B 4- D 5- A 6- B 7- C no tem relao alguma punio sistemtica. Contudo, num
certo contexto, as palavras assumem significados equivalen-
tes ou no.
COMPREENSO GLOBAL DO TEXTO
No segundo bloco, muita teoria equivale a pouco conhe-
Para compreendermos o texto preciso descobrir sua cimento, em outro contexto tais afirmaes seriam opostas,
estrutura interna. Nela, encontraremos ideias bsicas e aces- contraditrias, contudo no texto-exemplo so equivalentes,
srias e precisamos descobrir como essas ideias se relacio- pois assumem um significado de "coisas vazias" diante da
nam. As ideias bsicas giram em torno do tema central, de descoberta da solido, ento mais uma vez temos um termo
uma ideia ncleo contida no texto, a ela somam-se as ideias com um significado especfico num dado contexto.
acessrias, que s so importantes, enquanto corroboradoras
da ideia central. No terceiro bloco, solido real e frequente esto lado a
lado das palavras acompanhando em constante movimenta-
Por exemplo, a ideia bsica do texto a presena da o. No contexto, elas so compreendidas como anlogas,
solido em nossas vidas, na opinio de Luiz Carlos Lisboa, a equivalentes, mas j sabemos que num outro contexto so
ela somam-se outras ideias sobre a educao dos jovens, palavras que se opem. S assumem sentido anlogo devido
sobre a psicanlise, sobre o amor que so acessrias, por- ideia do autor, sua inteno de reforar a contradio, a
que no tratam diretamente do assunto da solido, mas so confuso em que vive o adolescente.
acessrias, pois colaboram para a compreenso da ideia
bsica, central. No quarto bloco, bero anlogo sepultura, luz da
compreenso do texto so palavras que se equivalem, que
Geralmente, um texto trata de uma ideia bsica acompa- esto lado a lado equiparadas a lugares que contm a soli-
nhada de vrias ideias acessrias. Se h ideias bsicas e do que cerca a vida das pessoas. Em outros contextos so
ideias acessrias como ocorre a inter-relao dessas ideias? palavras opostas, pois significam vida e morte, mas no texto-
exemplo tudo uma coisa s: lugar de solido.
Muitas vezes, a tcnica usada a de explanao de idei-
as "em cadeia", ocorre a explanao da ideia bsica e a se- A oposio bsica do texto :

2
Lngua Portuguesa
O Mundo dos adultos ocupados oposto busca dis- O TEXTO NARRATIVO
farada de ateno e apoio.
Leia este trecho de um texto narrativo:
Onde adultos se ocupam com um mundo parte dos
anseios, carncias, dvidas dos adolescentes cercados de A escrava pegou a filhinha
solido. Nas costas
E se atirou no Paraba
importante ressaltar que as oposies, as equivaln- Para que a criana no fosse judiada.
cias, a compreenso de certos termos s acontecem em (Oswald de Andrade. Poesias Reunidas.
contextos determinados, pois dependendo da inteno do Rio de Janeiro, Civilizao Brasileira, 1972.)
autor as palavras podero se opor, equivaler-se, assumir
significados especficos, ainda como exemplo, recorremos Nesse texto, o importante o fato, a ao, o acontecimen-
expresso "muro de borracha" que poderia significar at um to: a escrava se mata junto com a filhinha recm-nascida,
brinquedo em risco para o fsico da criana, contudo no texto- para salv-la da escravido.
exemplo significa a atitude dos pais diante dos filhos "dbil,
indefinida e acovardada" sem limites, sem a educao que Releia o texto e repare que no sabemos como era a
norteia a vida. escrava, nem como era sua filha, nem como era o rio. Esse
trecho s atribui importncia ao acontecimento em si.
O texto poder utilizar diversos recursos, tudo, no entanto,
estar subordinado ideia do seu autor. Narrar, portanto, consiste em construir o conjunto de
aes que constituem a histria o enredo e relacion-las
s personagens seres que praticam atos ou sofrem os
ESTRUTURA E ORGANIZAO DO TEXTO fatos.

DEFINIO DE TEXTO Vejamos mais um exemplo de narrao:

O texto uma mensagem, isto , um fato do discurso: O bicho


uma passagem falada ou escrita que forma um todo significa- Vi ontem um bicho
tivo independentemente da sua extenso. Na imundcie do ptio
Catando comida entre os detritos
O texto forma um todo, que pode ser: Quando achava alguma coisa,
No examinava nem cheirava:
uma palavra: No, talvez, sim ... Engolia com voracidade.
uma frase: Antes tarde do que nunca. O bicho no era um co,
algumas ou centenas de pginas: um livro, um relatrio, um No era um gato,
ofcio, etc. No era um rato.
O bicho, meu Deus, era um homem.
(Manuel Bandeira. Estrela da vida inteira.
Rio de Janeiro, Jos Olympio, 1973.)
A ESTRUTURAO TEXTUAL

Um texto se realiza por meio de uma seleo de seu


Toda a narrativa tem um narrador: aquele que conta a
material lingustico, a compreendidas a seleo vocabular, a
histria. Mas o narrador pode ser de dois tipos, conforme a
seleo da frase e a seleo do modo de organizao discur-
sua perspectiva em relao aos fatos narrados: 1 ou 3 pes-
siva, ou seja, a narrao, a descrio e a argumentao.
soa.
Cada um desses modos de organizao possui determi-
No texto acima, a histria contada em 1 pessoa (eu):
nadas regularidades que lhe so prprias, alm daquelas
9LRQWHPXPELFKR
regularidades que esto acima dessas gramticas particula-
res, ou seja, as regularidades gerais do texto.
O narrador relata um acontecimento que o impressionou:
um bicho catando restos de comida. Note que, no desenvol-
A estruturao de um texto se faz exatamente entre o
vimento do enredo, no sabemos de que animal se trata. S
esperado, ou seja, o respeito quelas regularidades do modo
no desfecho o narrador nos revela que o bicho um ser hu-
de organizao a que pertence e a criatividade do autor.
mano.
Portanto, escrever sempre um processo de seleo:
A narrao, alm de ser uma das mais importantes possi-
seleo de vocbulos, seleo de estruturas sintticas, sele-
bilidades da linguagem, tambm uma das prticas mais
o de organizao das frases na composio do texto, sele-
comuns de nossa vida. A narrao associa nossa observao
o de um modo de organizao discursiva... tudo em busca
do mundo com nossa existncia, nossa memria e nossa
do que parece mais adequado s finalidades do autor do
imaginao.
texto.

Estrutura do texto narrativo:


TIPOLOGIA TEXTUAL
1) ENREDO
Os textos variam conforme as intenes do autor, poden-
do ser narrativos, descritivos, dissertativos. Porm, raramente
a narrativa propriamente dita, que pode ser linear ou
um texto construdo com as caractersticas de um s tipo.
retrospectiva, cuja trama mantm o interesse do leitor, que
espera por um desfecho. Chama-se simplesmente de ao.
O mais comum encontrarmos os vrios tipos em um s
texto.

3
Lngua Portuguesa
2) PERSONAGEM A fala nos quadrinhos normalmente apresentada de
forma direta, nos bales, sem interferncia de narrador. No
a pessoa que atua na narrativa. Pode ser principal ou caso desta tira, Mnica e Cebolinha estabelecem um dilogo.
secundria, tpica ou caricatural.
x Discurso indireto: caracterizado pelo fato de o narra-
dor se apropriar da fala do personagem, ou seja, a fala
3) NARRADOR (PONTO DE VISTA) do outro vem pelas palavras do narrador. No discurso
indireto, observamos a seguinte estrutura: verbo de
Geralmente, classifica-se em: elocuo (que o ncleo do predicado da orao
principal), seguido da orao subordinada (a fala do
a) narrador-observador: o autor conta a histria como personagem complementa o significado do verbo de
observador que sabe tudo. Usa a terceira pessoa. elocuo: disse que...; pensou que...; desempenhando
b) narrador personagem: o autor conta encarnando-se a funo de objeto direto ou indireto), introduzida por
numa personagem, principal ou secundria. Usa a primeira uma conjuno integrante (que, se).
pessoa.

Observe o exemplo:
4) AMBIENTE
O detento disse que (ele) no confiava mais na Justia.
o meio fsico e social onde se desenvolve a ao das Logo depois, perguntou ao delegado se (ele) iria prend-lo.
personagens. Trata-se do pano de fundo ou do cenrio da
histria. x indireto-livre: consiste na fuso entre narrador e per-
sonagem, isto , a fala da personagem insere-se no
discurso do narrador, sem o emprego dos verbos de
5) TEMPO elocuo (como dizer, afirmar, perguntar, responder,
pedir e exclamar).
o elemento fortemente ligado ao enredo numa sequn-
cia linear ou retrospectiva, ao passado, presente e futuro,
com seus recuos e avanos. Pode ser cronolgico (quando Observe o exemplo:
avana no sentido do relgio) ou psicolgico (quando medi-
do pela repercusso emocional, esttica e psicolgica nas Agora (Fabiano) queria entender-se com Sinh Vitria a
personagens). respeito da educao dos pequenos. E eles estavam pergun-
tadores, insuportveis. Fabiano dava-se bem com a ignorn-
cia. Tinha o direito de saber? tinha? No tinha.
6) DISCURSO

o procedimento do narrador ao reproduzir as falas ou o A ORDEM DA NARRATIVA


pensamento das personagens.
Entende-se por ordem o registro de um fato ou detalhe de
H trs tipos de discurso: cada vez. Vejamos um exemplo:

x Discurso direto: caracterizado pela reproduo fiel Chega a polcia.


da fala do personagem. As falas so reproduzidas E os invasores saem.
integralmente e, via de regra, introduzidas por tra- A polcia se vai.
vesso. Numa estrutura tradicional de discurso dire- Os invasores voltam. (Jornal da Tarde)
to, a fala do personagem acompanhada por um
verbo de elocuo (verbo que indica a fala do per- Nesta pequena narrativa, que serve de ttulo para uma
sonagem: dizer, falar, responder, indagar, perguntar, reportagem, o jornalista registrou fatos na ordem em que
retrucar, afirmar, etc.), seguido de dois-pontos. aconteceram, ou seja, em sequncia cronolgica ou linear:
comeo, meio e fim.
Alguns autores modernos dispensam o emprego dos
verbos de elocuo em favor de um ritmo mais veloz Muitas vezes, o autor pode fugir do convencional, alteran-
da narrativa, assim como tambm os sinais de pon- do essa linearidade. Isso ocorre com mais frequncia no texto
tuao que introduzem e delimitam as falas (dois- literrio, em que se trabalha artisticamente a lngua com a
pontos, travesso, aspas, etc.). finalidade de provocar emoes no leitor.

Observe o exemplo:
Vejamos alguns exemplos:

1) O narrador antecipa o final da narrativa:

No dia em que o matariam, Santiago Nassar levantou-se


s 5h30 da manh para esperar o navio em que chegava o
bispo. (Gabriel Garcia Mrquez)

No primeiro pargrafo, o narrador j conta o que aconte-


ceu personagem.

(Maurcio de Sousa)

4
Lngua Portuguesa
2) O narrador faz referncia a um fato anterior, que o leitor Alice no Pas das Maravilhas
no conhece, procurando criar suspense. Leia a primeira Lewis Carrol
linha de um conto:
Captulo 1
Ento a mosca voltou a atacar. Ningum dava nada por Para baixo na toca do coelho
ela. Se no mundo dos insetos j seria presa fcil, o que dir
na longa noite dos brontossauros. (Chacal)

Fazendo referncia a um fato que o leitor desconhece, o


narrador desperta a curiosidade de saber como e por que a
tal mosca atacava e voltou a atacar.

3) Antes de comear a contar a histria propriamente dita,


o narrador inicia o texto com uma fala da personagem, mos-
trando que ela est mesmo em desequilbrio com o meio:
Alice estava comeando a ficar muito cansada de estar
Que peixe esse? Perguntou a moa com afetada sentada ao lado de sua irm e no ter nada para fazer: uma
admirao. Foi na cidade de Curupuru, no Maranho. A moa vez ou duas ela dava uma olhadinha no livro que a irm lia,
nascera ali mesmo, crescera ali mesmo mas voltara semana mas no havia fLJXUDVRXGLiORJRVQHOHHSDUDque serve um
passada de uma temporada de um ano, na capital do estado. OLYUR penVRX$OLFHVHPILJXUDVQHPGLiORJRV"
Ela agora moa de cidade, no conhece mais peixe, nem
bicho do mato, nem farinha de pau. Evoluiu. Ento, ela pensava consigo mesma (to bem quanto era
possvel naquele dia quente que a deixava sonolenta e est-
Que peixe esse? pida) se o prazer de fazer um colar de margaridas era mais
forte do que o esforo de ter de levantar e colher as margari-
Os homens e as mulheres no responderam nada. Olha- das, quando subitamente um Coelho Branco com olhos cor-
ram-se uns aos outros com ar de enfado.(Ferreira Gullar) de-rosa passou correndo perto dela.

No havia nada de muito especial nisso, tambm Alice


O CICLO NARRATIVO no achou muito fora do normal ouvir o Coelho dizer para si
PHVPR 2K Suxa! Oh puxa! Eu devo estar muito DWUDVDGR
Nos textos essencialmente narrativos, predominam as (quando ela pensou nisso depois, ocorreu-lhe que deveria ter
frases verbais, que indicam um processo, uma ao. achado estranho, mas na hora tudo parecia muito natural);
mas, quando o Coelho tirou um relgio do bolso do colete, e
A narrativa tem como ponto de partida uma situao inici- olhou para ele, apressando-se a seguir, Alice ps-se em p e
al, que se desenvolve numa para chegar a uma situao final, lhe passou a ideia pela mente como um relmpago, que ela
diferente da inicial: nunca vira antes um coelho com um bolso no colete e menos
ainda com um relgio para tirar dele. Ardendo de curiosidade,
 VLWXDomR LQLFLDO - o personagem est apresentado numa ela correu pelo campo atrs dele, a tempo de v-lo saltar
determinada situao temporal e espacial; para dentro de uma grande toca de coelho embaixo da cerca.
GHVHQYROYLPHQWR - apresenta-se o conflito, e a ao se de-
senvolve at chegar ao clmax e, em seguida, a um desfecho; No mesmo instante, Alice entrou atrs dele, sem pensar
VLWXDomRILQDO- passado o conflito, o personagem apresen- como faria para sair dali. A toca do coelho dava diretamente
tado em uma nova situao h claros indcios de transfor- em um tnel, e ento se aprofundava repentinamente. To
mao, de mudana em relao ao incio da narrativa. repentinamente que Alice no teve um momento sequer para
pensar antes de j se encontrar caindo no que parecia ser
bastante fundo.
NARRATIVA FICCIONAL (...)

A palavra fico vem do latim fictio, que deriva do verbo O TEXTO DESCRITIVO
fingere: modelar, criar, inventar. Quando identificamos uma
narrativa como ficcional, observamos nela uma realidade Leia este trecho descritivo de Guimares Rosa:
criada, imaginria, no real.
6XD FDVD ILFDYD SDUD WUiV GD 6HUUD GR 0LP quase no
A narrativa ficcional fruto da imaginao criadora. Sem- meio de um brejo de gua limpa, lugar chamado o Temor-de-
pre mantendo pontos de contato com o real, recria a realida- Deus. O Pai, pequeno sitiante, lidava com vacas e arroz; a
de. Baseando-se nela ou dela se distanciando. Me, urucuiana, nunca tirava o tero da mo, mesmo quando
matando galinhas ou passando descompostura em algum. E
Se os acontecimentos narrados, se os personagens apre- ela, menininha, por nome Maria, Nhinhinha dita, nascera j
sentados aproximarem-se muito da realidade a ponto de nos muito para mida, cabeudota e com olhos eQRUPHV
confundir, falamos que a narrativa verossmil (semelhante
verdade), se os acontecimentos e personagens se mostrarem Voc observou que o trecho acima, apresenta caracters-
absurdos, absolutamente improvveis, falamos que a narrati- ticas de ambiente e de personagens. Essa caracterizao
va inverossmil (que no semelhante verdade). obtida por meio da descrio.

O texto a seguir XPWUHFKRGH$OLFHQR3DtVGDVMaravi- Descrever detalhar uma cena, objeto, sentimento, per-
OKDVGH/HZLV&DUUROXPH[HPSORGHQDUUDWLYDGH fico em sonagens, destacando-lhe caractersticas peculiares, de
que podemos observar um universo imaginrio. modo a passar ao leitor/ouvinte uma imagem o mais prxima
possvel daquela que temos em mente.

5
Lngua Portuguesa
H duas maneiras bsicas de descrever: objetiva ou sub- a) Do particular para o geral
jetivamente.
Vejamos um exemplo:
Na descrio objetiva, a realidade retratada com a
maior fidelidade possvel, no se emitindo qualquer opinio $SHOHGDJDURWDHUDGHVVHPRUHQRHQ[XWRH parelho das
ou julgamento. Leia, agora, as seguintes descries objeti- chinesas. Tinha uns olhos grados, lustrosos e negros como
vas: os cabelos lisos, e um sorriso suave e limpo a animar-lhe o
2VDQWLFRUSRVVmRPROpFXODVGHSURWHtQDVTXHSRssuem rosto oval, de feies GHOLFDGDV(rico Verssimo)
dois stios especficos de combinao com os antgenos.
Existem, em cada molcula de anticorpo, duas cadeias poli- b) Do geral para o particular
peptdicas leves e duas cadeias pesadas, ligadas entre si por
SRQWHVGHHQ[RIUH Vejamos um exemplo:
(Amabis e Martho)
$ UXD HVWDYD GH QRYR TXDVH PRUWD MDQHODV fechadas. A
2DSDUWDPHQWRTXHFRPSUHLWHPWUrVGRUPLWyULRV sendo valsa acabara o bis. Sem ningum. S o violinista estava ali,
uma sute XPDVDODHP/GRLVEDQKHLURVFR]LQKDiUHD fumando, fumegando muito, olhando sem ver, totalmente
de servio e dependncias de empregaGD desamparado, sem nenhum sono, agarrado a no sei que
esperana de que algum, uma garota linda, um fotgrafo,
Na descrio subjetiva, a realidade retratada de acor- um milionrio disfarado lhe pedisse pra tocar mais uma YH]
do com o ponto de vista do emissor, que pode opinar e ex-
pressar seus sentimentos. Leia, agora, os seguintes trechos
descritivos: DESCRIO POTICA

(VWH 4XLQFDV %RUED VH DFDVR PH IL]HVWH R Iavor de ler Na poesia, a descrio est marcada pela funo ftica,
as Memrias pstumas de Brs Cubas, aquele mesmo apresentando imagens inusitadas que recriam seres e/ou
nufrago da existncia, que ali aparece, mendigo, herdeiro ambientes. Dificilmente encontraremos objetividade nas des-
inopinado, e inventor de uma filosofia. Aqui o tens agora em cries poticas, pois, a poesia est marcada pelo subjeti-
Barbacena. Logo que chegou, enamorou-se de uma viva, vismo. Observe o exemplo:
senhora de condio mediana e parcos meios de vida, to
acanhada, que os suspiros do namoraGRILFDYDPVHPHFR Retrato
(Machado de Assis)
Eu no tinha este rosto de hoje
2VHQKRUVDEHVHUWmRpRQGHPDQGDTXHPp forte, com assim calmo, assim triste, assim magro,
as astcias. Deus mesmo, quando vier, que venha armado! E nem estes olhos to vazios,
bala um pedaozinho de metal ... serto onde o pensa- nem o lbio amargo.
mento da gente se forma mais forte do que o poder do lugar. Eu no tinha estas mos sem fora,
Viver PXLWRSHULJRVR to paradas e frias e mortas;
(Guimares Rosa) eu no tinha este corao
que nem se mostra.
CARACTERSTICAS DA DESCRIO
Eu no dei por esta mudana,
to simples, to certa, to fcil:
caracteriza, por meio de imagens ou de palavras, seres e
- Em que espelho ficou perdida
lugares;
a minha face?
(Ceclia Meireles - Obra potica.
emprega adjetivos, locues adjetivas, verbos de estado e Rio de Janeiro: Nova Aguilar, 1985.)
oraes adjetivas;

emprega geralmente verbos de estado, normalmente no DESCRIO TCNICA


presente e no imperfeito do indicativo;
Na descrio tcnica procura-se transmitir a imagem do
estabelece comparaes; objeto atravs de uma linguagem tcnica, com vocabulrio
preciso, normalmente ligado a uma rea da cincia ou da
faz referncias s impresses sensitivas: cores, formas, tecnologia.
cheiros, gostos, impresses tteis, sons.
o caso da descrio de peas e aparelhos, de experin-
cias e fenmenos, do funcionamento de mecanismos, da
A ORDEM NA DESCRIO redao de manuais de instruo e artigos cientficos.

$ GHVFULomR p XP YHUGDGHLUR UHWUDWR FRP palavras. Na


descrio literria, o escritor procura ordenar as frases de O TEXTO DISSERTATIVO
modo a obter um texto que prenda a ateno do leitor.
Leia este trecho de um texto dissertativo:
Os textos descritivos dificilmente aparecem isolados.
Geralmente, fazem parte de um texto maior, do tipo narrativo. $ ILP GH DSUHHQGHU D ILQDOLGDGH H R VHQWLGR GD vida
preciso amar a vida por ela mesma, inteiramente; mergulhar,
H vrias maneiras de montar a descrio, dependendo por assim dizer, no redemoinho da vida; somente ento apre-
da posio (ponto de vista) do observador em relao quilo ender-se- o sentido da vida, compreender-se- para que se
que est sendo observado. As principais so: vive. A vida algo que, ao contrrio de tudo criado pelo ho-

6
Lngua Portuguesa
mem, no necessita de teoria, quem apreende a prtica da coincide com sua produo, tanto com o que produzem como
vida tambm assimiODDVXDWHRULD com o modo como produzem.
(Wilhelm Reich. A revoluo sexual. Rio de Janeiro, Zahar, 1974)
O que os indivduos so, portanto, depende das condi-
O texto expe um ponto de vista (a finalidade da vida es materiais de sua produo.
viver) sobre um assunto-tema (no caso, o sentido e a finali- (MARX, Karl. In: ARANHA, Maria Lcia de Arruda & MARTINS, Maria
dade da vida). Alm de apresentar o ponto de vista do autor, Helena. Temas de filosofia. So Paulo, Moderna, 1992.)
o texto faz tambm a defesa desse ponto de vista: os por-
qus, os motivos que fundamentam a opinio de que a prti- A estrutura desse texto bem definida: introduo (pri-
ca intensa de viver que revela o sentido da vida; de que a meiro pargrafo), desenvolvimento (segundo pargrafo),
vida no precisa de teoria e que se identifica com o prprio concluso (ltimo pargrafo).
processo de viver intensamente.

defesa do ponto de vista, organizao dos motivos A ORDEM NA DISSERTAO


que o justificam, exposio dos fundamentos em que uma
posio est baseada, chamamos argumentao. Assim como na descrio podemos partir do geral para o
particular e vice-versa, a exposio de ideias na dissertao
Defender uma opinio com argumentos coerentes e ade- admite o mesmo caminho.
quados o aspecto mais importante do texto dissertativo.
Alm da argumentao articulada, a dissertao deve apre- Nesse caso, estaremos trabalhando com dois mtodos
sentar tambm uma linguagem clara e uma estruturao bsicos de raciocnio: a induo e a deduo.
lgica (com introduo, desenvolvimento e concluso).
Chama-se induo ao raciocnio que se baseia na obser-
Dissertar , atravs da organizao de palavras, frases e vao e elementos conhecidos, concretos (o particular), para,
textos, apresentar ideias, desenvolver raciocnio, analisar por meio deles, chegar a uma concluso ou a uma hiptese
contextos, dados e fatos. possvel sobre uma determinada ideia ou fato (o geral).

Observe como o jornalista Gilberto Dimenstein escreveu a


A ESTRUTURA DO TEXTO DISSERTATIVO respeito dos jovens brasileiros vtimas de assassinato.

A dissertao obedece seguinte estrutura:


VIOLNCIA MATA MAIS ENTRE OS JOVENS
Introduo
De cada 10 jovens brasileiros entre 15 e 18 anos mortos
a parte na qual se apresenta a ideia central do texto e o no ano de 1993, 6 deles foram assassinados. A pesquisa
enfoque que se pretende abordar. revela que, atualmente, o homicdio est em primeiro lugar
entre as causas da morte a juventude. A pesquisa foi feita
Desenvolvimento pelo CBIA (Centro Brasileiro para Infncia e Adolescncia),
rgo vinculado ao Ministrio do Bem-Estar Social.
O desenvolvimento da dissertao apresenta os diferen-
tes aspectos da ideia exposta na introduo. Alm disso, Apesar da fragilidade estatstica e o aumento da consci-
nessa parte que ser feita a fundamentao da ideia que se ncia dos governantes sobre a situao da infncia, os ndi-
pretende discutir, atravs de exemplos, argumentos, dados ces de violncia continuam crescendo.
estatsticos, fatos histricos, causas e consequncias etc. (Folha de So Paulo, 26 jun 1994. Caderno Especial: Brasil 95)

Concluso Particular: dados da pesquisa feita pelo CBIA.

a retomada da ideia apresentada na introduo, s que Geral: os ndices de violncia continuam aumentando apesar
enriquecida pela fundamentao dada no desenvolvimento. A do aumento da conscincia dos governantes sobre o proble-
concluso sintetiza a ideia central do texto e pode acrescen- ma.
tar sugestes, ampliando a discusso do tema.
O tipo de raciocnio conhecido como deduo segue o
Veja como est estruturado o texto que segue: caminho inverso ao da induo. Portanto, no raciocnio dedu-
tivo partimos do geral para o particular, do desconhecido para
Pode-se distinguir os homens dos animais pela conscin- o conhecido. Obedecemos, geralmente, aos seguintes pas-
cia, pela religio ou por tudo que se queira. Mas eles prprios sos:
comeam a se diferenciar dos animais to logo comeam a
produzir seus meios de vida, passo este que condicionado 1) formulamos uma hiptese abstrata, de carter geral;
por sua organizao temporal. Produzindo seus meios de 2) fazemos uma relao de fatos e provas (elementos
vida, os homens produzem, indiretamente, sua prpria vida concretos, conhecidos, observveis): o particular;
material. 3) podemos ou no colocar uma concluso que confirme
O modo pelo qual os homens produzem seus meios de a hiptese geral.
vida depende, antes de tudo, da natureza dos meios de vidas
j encontrados e que tm de reproduzir. No se deve consi- Observe como a autora organizou o texto dedutivamente:
derar tal modo de produo de um nico ponto de vista, a
saber: a reproduo da existncia fsica dos indivduos. Tra- As expectativas num namoro so, na maioria das vezes,
ta-se, muito mais, de uma determinada forma de atividade muito diferentes para meninos e meninas. (hiptese geral)
dos indivduos, determinada forma de manifestar sua vida,
determinado modo de vida dos mesmos. Tal como os indiv- Enquanto a maioria dos rapazes est doida para beijar,
duos manifestam sua vida, assim so eles. O que eles so tocar a menina e ter o mximo de intimidade sexual que pu-

7
Lngua Portuguesa
der, ela geralmente est interessada em sair com ele, namo- Perceba que o texto foi organizado pelo processo de
r-lo, apreciar sua companhia. (fatos particulares que exem- enumerao. Primeiro temos os elementos de um lado e,
plificam a hiptese geral) depois, os elementos do outro.
(SUPLICY, Marta. Sexo para adolescentes. FTD, 1988. p. 82)
RECONHECIMENTO DA ESTRUTURA

A ENUMERAO PARA ORGANIZAR O TEXTO Para continuar trabalhando a estrutura e organizao do


texto, vamos exercitar a leitura com o objetivo de identificar o
Leia o texto seguinte: modo como ele foi ordenado.

PRAZERES No se trata de entender o contedo, mas reconhecer a


estrutura, a arquitetao do texto. O que podemos perceber a
O primeiro olhar da janela de manh respeito da estrutura do texto abaixo?
O velho livro de novo encontrado
Rostos animados O amor finalmente
Neve, o mudar das estaes um embarao de pernas,
O jornal uma unio de barrigas,
O co um breve tremor de artrias.
A dialtica Uma confuso de bocas,
Tomar ducha, nadar uma batalha de veias,
Velha msica um rebolio de ancas,
Sapatos cmodos quem diz outra coisa besta.
Compreender (Gregrio de Matos. Poemas escolhidos. So Paulo, Cultrix)
Msica nova
Escrever, plantar O texto apresenta uma enumerao de definies de
Viajar, cantar amor. Cada uma destas definies est organizada de modo
Ser amvel a apresentar uma parte do corpo. No final, um comentrio
(Bertolt Brecht. Poemas e canes. Coimbra, 1975) jocoso encerra a sequncia.

Como foi organizado esse poema? Qual a sequncia de


ideias? Observe que o texto no buscou desenvolver o con- RELAO ENTRE IDIAS:
ceito de felicidade, mas apresenta os elementos capazes de PONTO DE VISTA OU IDIA CENTRAL
representar a felicidade.
O ponto de vista a posio que escolhemos, enquanto
Pela enumerao de acontecimentos, objetos, pessoas, escritores, para melhor observar o ser ou o objeto que vamos
descrever. No entanto, nas descries, alm da posio fsi-
sensaes, sentimentos, atividades, o autor diz o que felici- ca, fundamental a atitude, ou seja, a predisposio psicol-
dade. gica que temos com relao quilo que vamos descrever. O
ponto de vista (fsico e psicolgico) que adotarmos acabar
A enumerao uma tcnica das mais ricas para escre- determinando os recursos expressivos (vocabulrio, figuras,
ver livremente e constitui um dos importantes recursos utili- tipo de frase) que utilizaremos na descrio.
zados na literatura, principalmente na poesia moderna. No
texto enumerativo empregam-se elementos que dificilmente Os textos narrativos, descritivos ou dissertativos so es-
aparecem em redaes tradicionais: WRPDUGXFKD Vapatos truturados em unidades menores, os pargrafos. Essa unida-
F{PRGRVSRUH[HPSORA enumerao uma forma concreta de mnima de significao do texto apresenta uma ideia cen-
tral, qual se agregam outras ideias subsidirias, relaciona-
de escrever: consiste em listar coisas, fatos, lembranas, das pelo sentido.
emoes, desejos, sensaes de nossa vida, do dia-a-dia, da
nossa histria. Observe outro texto em que se emprega o Um texto deve sempre abordar um mesmo assunto.
processo de enumerao: Quando se muda de pargrafo, portanto, no se muda de
assunto, mas sim de argumentos, aspectos de abordagem,
focos de enunciao (narrao) etc. Para cumprir essa exi-
OS DOIS LADOS gncia da comunicao verbal, o pargrafo deve apresentar
quatro condies bsicas:
Deste lado tem meu corpo
Unidade: manuteno de apenas uma ideia principal
tem o sonho as ideias subsidirias devem girar em torno dela.
tem minha namorada na janela
tem as ruas gritando de luzes e movimentos Coerncia: relao de sentido entre a ideia principal e
tem meu amor to lento as subsidirias.
tem o mundo batendo na minha memria
tem o caminho pro trabalho. Conciso: apresentao das ideias sem estender
demasiadamente o pargrafo.
Do outro lado tem outras vidas vivendo da minha vida tem
pensamentos srios me esperando na sala de visitas Clareza: apresentao clara dos argumentos (escolha
de palavras, construo sinttica).
tem minha noiva definitiva me esperando com flores na
mo, O texto se organiza em torno de um elemento de refern-
tem a morte, as colunas da ordem e da desordem. cia. A partir dele todo o resto se posiciona. Uma ideia deve
(Murilo Mendes. Poesia completa e prosa, Nova Aguilar, 1994) levar outra, sem sobressaltos. Um pargrafo deve ter rela-
o com o anterior e o prximo.
Esse poema uma espcie de autorretrato, que enumera
elementos de dois lados diferentes da personalidade e da Nas narraes, a ideia central do pargrafo um inciden-
vida do eu lrico. te, isto , um episdio curto. H o predomnio dos verbos de

8
Lngua Portuguesa
ao que se referem a personagens, alm de indicaes de - inicialmente (comeo, introduo)
circunstncias relativas ao fato: onde ele ocorreu, quando - primeiramente (comeo, introduo)
ocorreu, por que ocorreu, etc. - antes de tudo (comeo, introduo)
- desde j (comeo, introduo)
A ideia central do pargrafo descritivo um quadro, ou - alm disso (continuao)
seja, um fragmento daquilo que est sendo descrito (uma - do mesmo modo (continuao)
pessoa, uma paisagem, um ambiente, etc.), visto sob deter- - bem como (continuao)
minada perspectiva, num determinado momento. Alterado - enfim (concluso)
esse quadro, teremos novo pargrafo. - nesse sentido (concluso)
- portanto (concluso)
Nas dissertaes, os pargrafos so estruturados a partir - afinal (concluso)
de uma ideia que normalmente apresentada em sua intro- - logo aps (tempo)
duo, desenvolvida e reforada por uma concluso. A ideia - ocasionalmente (tempo)
central desenvolvida por ideias subsidirias. - posteriormente (tempo)
- atualmente (tempo)
COESO - enquanto isso (tempo)
- imediatamente (tempo)
Coeso a conexo, ligao, harmonia entre os elemen- - no raro (tempo)
tos de um texto. Percebemos tal definio quando lemos um - concomitantemente (tempo)
texto e verificamos que as palavras, as frases e os pargrafos - igualmente (semelhana, conformidade)
esto entrelaados, um dando continuidade ao outro. - segundo (semelhana, conformidade)
- conforme (semelhana, conformidade)
- assim tambm (semelhana, conformidade)
Os elementos de coeso determinam a transio de idei- - de acordo com (semelhana, conformidade)
as entre as frases e os pargrafos. - da (causa e consequncia)
- por isso (causa e consequncia)
Observe a coeso presente no texto a seguir: - de fato (causa e consequncia)
- em virtude de (causa e consequncia)
2V VHP-terra fizeram um protesto em Braslia contra a - ento (exemplificao, esclarecimento)
poltica agrria do pas, porque consideram injusta a atual - por exemplo (exemplificao, esclarecimento)
distribuio de terras. Porm o ministro da Agricultura consi- - isto (exemplificao, esclarecimento)
- a saber (exemplificao, esclarecimento)
derou a manifestao um ato de rebeldia, uma vez que o - em outras palavras (exemplificao, esclarecimento)
projeto de Reforma Agrria pretende assentar milhares de - ou seja (exemplificao, esclarecimento)
sem-WHUUD
JORDO, R., BELLEZI C. Linguagens. So Paulo: Escala Coeso por referncia: existem palavras que tm a
Educacional, 2007, 566 p. funo de fazer referncia, so elas:

As palavras destacadas no texto tm o papel de ligar as - pronomes pessoais: eu, tu, ele, me, te, os...
partes do texto, podemos dizer que elas so responsveis - pronomes possessivos: meu, teu, seu, nosso...
pela coeso do texto. - pronomes demonstrativos: este, esse, aquele...
- pronomes indefinidos: algum, nenhum, todo...
- pronomes relativos: que, o qual, onde...
ELEMENTOS DE COESO - advrbios de lugar: aqui, a, l...

Existem inumerveis modos de organizar a sequncia do Coeso por substituio: substituio de um nome
texto. Muitas maneiras diferentes de fazer a introduo, o (pessoa, objeto, lugar etc.), verbos, perodos ou trechos do
desenvolvimento e a concluso. texto por uma palavra ou expresso que tenha sentido prxi-
Vamos sugerir um modelo que nos parece altamente mo, evitando a repetio no corpo do texto. Ex: So Paulo
funcional: SRGH VHU VXEVWLWXtGR SRU  D  WHUUD GD JDURD &DVWUR $OYHV
pode ser subsWLWXtGRSRUR3RHWDGRV(VFUDYRV
Na introduo, apresentamos o tema e o ponto de vista.
No desenvolvimento, apresentamos a argumentao (os Assim, a coeso confere textualidade aos enunciados
porqus, os exemplos). agrupados em conjuntos.
Na concluso, apresentamos uma sntese reafirmadora
das ideias (reapresentao, com outras palavras, do ponto de
vista e/ou do argumento principal). COERNCIA TEXTUAL
Relao
Coerncia textual a relao lgica entre as ideias, pois
Num texto coerente, os fatos e conceitos devem estar essas devem se complementar, o resultado da no contra-
relacionados. Essa relao deve ser suficiente para justificar dio entre as partes do texto. A coerncia de um texto inclui
sua incluso num mesmo texto. Para avaliar o grau de rela- fatores como o conhecimento que o produtor e o receptor tm
o dos elementos que vo construir seu texto, importante do assunto abordado no texto, conhecimento de mundo, o
organiz-los esquematicamente antes de escrever. Feito o conhecimento que esses tm da lngua que usam e intertex-
esquema, deve-se verificar se a aproximao de ideias que
se quer fazer realmente eficaz. tualidade. Pode-se concluir que texto coerente aquele do
qual possvel estabelecer sentido, entendido como um
H vrios recursos que respondem pela coeso do texto, princpio de interpretabilidade.
os principais so:
Veja o exemplo:
Palavras de transio: so palavras responsveis pela
coeso do texto, estabelecem a inter-relao entre os enun- $V FULDQoDV HVWmR PRUUHQGR GH IRPH SRU FDXVD GD Ui-
ciados (oraes, frases, pargrafos), so preposies, con- TXH]DGRSDtV
junes, alguns advrbios e locues adverbiais.

Exemplos: $GRURVDQGXtFKHSRUTXHHQJRUGD

9
Lngua Portuguesa
As frases acima so contraditrias, no apresentam in- Veio do oculista e trouxe uma rosa. Acha direito?
formaes claras, portanto, so incoerentes. 3RUTXHQmR"
(Carlos Drummond de Andrade)

EXERCCIOS 5) O texto a seguir apresenta:

1) Observe: (UD GH HVWDWXUD UHJXODU WLQKD DV FRVWDV arqueadas e os


ombros levemente contrados, braos moles, cintura pouco
6HULDPRQ]HKRUDVGDPDQKm. abaixo dos seios, desenhando muito a barriga. Quando an-
dava, principalmente em ocasies de cerimnia, sacudia o
O Campos, segundo o costume, acabava de descer do corpo na cadncia dos passos e bamboleava a cabea com
almoo e, a pena atrs da orelha, o leno por dentro do cola- um movimento que afetava languidez. Muito plida, olhos
rinho, dispunha-se a prosseguir no trabalho interrompido grandes e bonitos, repuxados para os cantos exteriores, em
pouco antes. Entrou no seu escritrio e foi sentar-se secre- um feitio acentuado de folhas de roseira; lbios descorados e
WiULD(Alusio Azevedo) cheios, mas graciosos. Nunca se despregava das lunetas, e a
forte miopia dava-lhe aos olhos uma expresso mida de
O texto acima possui predominncia: FKRUR (Alusio Azevedo)

a) narrativa a) narrao
b) descritiva b) descrio subjetiva
c) dissertativa c) dissertao
d) descrio objetiva
2) Leia o texto a seguir:
6) Assinale a alternativa incorreta quanto dissertao:
'HSRLV TXH WHUPLQHL XP FXUVR GH WpFQLFDV de emergncia
mdica, eu estava ansiosa para colocar prova minhas no- a) formular uma hiptese abstrata, de carter geral;
vas aptides. Um dia, quando ia numa autoestrada, vi um b) fazer uma relao de fatos e provas;
homem deitado no cho ao lado de um carro. Parei imedia- c) colocar ou no uma concluso que confirme a hiptese
tamente, peguei meu estojo de primeiros socorros e corri geral;
para ele. d) detalhar cenas, objetos, sentimentos, personagens, desta-
cando suas caractersticas peculiares.
Sou perita em emergncias disse eu a ele.
O senhor precisa de ajuda? 7) Temos uma dissertao na alternativa:
E preciso mesmo respondeu o homem.
9RFrVDEHWURFDUSQHX" D  1D SODQtFLH DYHUPHOKDGD RV MXD]HLros alargavam duas
(In revista Selees do Readers Digest, n 274. manchas verdes. (...)
Rio de Janeiro, maro de 1994) A caatinga estendia-se, de um vermelho indeciso salpicado
O texto apresentado possui: de manchas brancas que eram ossadas. O voo negro dos
urubus fazia crculos altos em redor de bichos moriEXQGRV
a) narrador-observador (Graciliano Ramos, Vidas Secas)
b) narrador-personagem
E  'H ORQJe via a aleia onde a tarde era clara e redonda.
3) Em qual elemento bsico da narrao possvel obter Mas a penumbra dos ramos cobria o atalho.
uma sequncia linear ou retrospectiva ao passado, presente Ao seu redor havia rudos serenos, cheiro de rvores, peque-
e futuro? nas surpresas entre os cips.
Todo o jardim triturado pelos instantes j mais apressados da
a) enredo tarde. De onde vinha o meio sonho pelo qual estava rodea-
b) personagem da?
c) ambiente Como por um zunido de abelhas e aves. Tudo era estranho,
d) tempo suave demais, JUDQGHGHPDLV
(Clarisse Lispector, Laos de Famlia)
4) Indique a alternativa que possui o discurso indireto-livre:
c  6HPSUH IRPRV H[SORUDGRV 6RPRV oprimidos, mas no
D 4XDQGRPHYLXPedrinho me chamou de lado e perguntou vencidos. Lutamos, pelo elementar direito de a classe traba-
se era verdade que eu sabia fazer milaJUHV lhadora participar da vida poltica, social e econmica de sua
(Fernando Sabino) ptria. Intil tentar nos calar, nos deter, nos abater. Somos
multido. Estamos nas cidades e nos campos. Renascemos
E  No quero discutir com a senhora. Mas tambm no em nossos filhos. Sabemos que, no futuro, estar em nossas
quero ver meu filho GXYLGDQGRGRSUySULRSDL mos a ULTXH]DTXHDJRUDSURGX]LPRV (Panfleto de um Sindi-
(Lus F. Verssimo) cato, maio de 1981)

F  (OD Ve referia a uma misteriosa casa na Avenida Joo d  1D EDL[DGD PDWR H FDPSR HUDP concolores. No alto da
Pinheiro, onde sabamos que no morava ningum havia colina, onde a luz andava roda, debaixo do angelim verde,
anos. (...) amos sempre olh-la durante o dia, fascinados: de vagens verdes, um boi branco, de cauda branca. E, ao
que haveria l dentro? No seria de espantar se de noite os longe, nas prateleiras dos morros cavalgam-se trs qualida-
fantasmas se reunissem ali para celebrar o fato de j have- des de D]XO (Guimares Rosa, Sagarana)
UHPPRUULGR
(Fernando Sabino) RESPOSTAS
1-A 2-B 3- D 4- C 5- B 6- D 7- C
G  Que que tem trazer uma flor para casa?

10
Lngua Portuguesa
INFORMAES LITERAIS E INFERNCIAS POSSVEIS das, existem outras que ficam subentendidas ou pressups
tas. Para realizar uma leitura eficiente, o leitor deve captar
Em um trabalho com leitura preciso levar-se em conta tanto os dados explcitos quantos os implcitos. Leitor perspi-
alguns pressupostos bsicos para se desenvolver esse ato caz aquele que consegue ler nas entrelinhas. Caso contr-
de forma competente. Para isso, nenhuma tarefa de leitura rio, ele pode passar por cima de significados importantes e
deve ser iniciada sem que se encontrem motivos para ela, ou decisivos ou o que pior pode concordar com coisas que
seja, sem que esteja claro o seu sentido. Os objetivos dos rejeitaria se as percebesse.
leitores em relao aos textos podem ser variados e esto
relacionados com a diversidade de textos a que tiverem a- INFERNCIAS POSSVEIS
cesso.
A ativao da inferncia, isto , a leitura do que no est
Quem l deve ser capaz de interrogar-se sobre sua pr- explcito (as entrelinhas, o tom e a intencionalidade do texto),
pria compreenso, estabelecer relaes entre o que l e o acontece ao longo de todo o processo de leitura. Vejamos
que faz parte do seu acervo pessoal, questionar seu conhe- isso na prtica.
cimento e modific-lo, estabelecer generalizaes que permi-
tam transferir o que foi aprendido para outros textos diferen- Cristo chega para dividir
tes etc. Para que a leitura se processe de modo eficaz, duas
condies so essenciais: a qualidade dos conhecimentos Precedido de intensa polmica, estreia hoje em mais de
temticos disponveis pelo leitor e a integridade das vias 500 cinemas de todo o pas o filme A paixo de Cristo, de
fonolgica e lexical, para que as palavras sejam reconhecidas Mel Gibson. Concentrando a ao nas ltimas 12 horas da
com rapidez. Os conhecimentos temticos se referem aos vida de Jesus, o astro da srie Mquina mortfera inicia seu
conhecimentos que o leitor possui a respeito do tema lido. filme com o Cristo fragilizado, que duvida de si mesmo, no
Jardim das Oliveiras, e prossegue com seu suplcio fsico,
Essa quantidade de conhecimentos vai influenciar a com- culminando nas brutais cenas da crucificao, at chegar
preenso de informaes explcitas e implcitas contidas no ressurreio. Os crticos reclamam do excesso de violncia,
texto. Por isso importante fazer um levantamento sobre o a comunidade judaica acusa o diretor de antissemitismo e os
que se conhece do tema e, caso no se tenha muitos conhe- homossexuais lembram que Gibson no deixou de ser o
cimentos, aproximar-se ao mximo do contedo ajudando, homfobo de sempre. A polmica est apenas comeando e
assim, a estabelecer relaes com algum fato que se conhe- A paixo de Cristo estreia com lotao esgotada em muitas
a. Quanto mais o leitor conhecer, mais possibilidades de salas. Com A paixo de Cristo, no se trata de gostar ou no
fazer inferncias ter. gostar, mas ver esse filme uma experincia intensa que
deve ser usufruda por quem leva o cinema a srio.
Em uma anlise textual, geralmente so apresentados os (O Estado de S. Paulo - Caderno 2 19/03/2004)
seguintes tipos de questes:
Podemos tentar ler algumas das entrelinhas do texto com a
Domnio do vocabulrio: as respostas podem ser obtidas ajuda de perguntas como:
mediante deduo, anlise da formao das palavras ou
deduzidas pelo seu contexto. A confirmao pode ser obtida Qual a posio do autor em relao polmica e ao filme?
pelo prprio dicionrio. Por qu? Qual a inteno do artigo? Por qu? Quais os
argumentos utilizados para persuadir o leitor?
Compreenso do texto: questes que envolvam a volta ao
texto, exigindo principalmente a habilidade de localizao das E, no caso, concluir que:
respostas.
A posio do autor em relao polmica neutra, ele s
  Interpretao do texto: perguntas mais abertas que exi- cita os comentrios de grupos especficos sem emitir sua
gem a capacidade de realizar-se inferncias e dedues a opinio a respeito. Quanto ao filme, positiva, pois no faz
partir das informaes fornecidas pelo texto. Trata-se de nenhuma crtica negativa direta e ainda incentiva que seja
desvelar o que est escrito nas entrelinhas, o que no foi dito, visto. A inteno do artigo chamar a ateno para a estreia
o que est implcito nas pistas fornecidas pelo texto. do filme, valendo-se da polmica como chamariz, e incentivar
que seja assistido. Um argumento forte que o filme est
  Extrapolao do texto: permite a extrapolao das res- alm da poOrPLFDHTXHpXPDH[SHULrQFLDLntensa que deve
postas, a partir das informaes do texto. Desenvolve a ca- ser usufruGDSRUTXHPOHYDFLQHPDDVpULR
pacidade crtica e argumentativa, estabelecendo relaes
entre o texto e os prprios conhecimentos prvios sobre o EXERCCIO
contedo em questo. Permite tambm a generalizao de
alguns dos recursos utilizados pelos autores, aplicando-os 1 - Na propaganda a seguir, a afirmao de que Deus fez o
em diferentes contextos (Elody Nunes Moraes) mundo em seis dias e, no stimo, descansou em tal cidade,
leva o leitor mensagem implcita de que o referido lugar :
Informaes explcitas e implcitas (Dirio Catarinense, 23/03/2005)

Observe a seguinte frase: a) um lugar prprio para continuar trabalhando


b) um lugar maravilhoso
Fiz faculdade, mas aprendi algumas coisas. c) um lugar desconhecido
d) um lugar movimentado
Nela, o falante transmite duas informaes de maneira
explcita:

que ele frequentou um curso superior;


que ele aprendeu algumas coisas.

$ROLJDUHVVDVGXDVLQIRUPDo}HVFRPXPPDVFRPXQLFD
tambm de modo implcito sua crtica ao sistema de ensino
superior, pois a frase passa a transmitir a ideia de que nas
faculdades no se aprende nada.
RESPOSTA
Um dos aspectos mais intrigantes da leitura de um texto 1-B
a verificao de que ele pode dizer coisas que parece no
estar dizendo: alm de informaes explicitamente enuncia

11
Lngua Portuguesa
PONTO DE VISTA DO AUTOR que se passa na mente dos outros personagens. Exemplo:
Memorial de Aires, de Machado de Assis; As Aventuras de
O Ponto de Vista o elemento da narrao que compre- Sherlock Holmes, de Sir Arthur Conan Doyle.
ende a perspectiva atravs da qual se conta uma histria. ,
basicamente, a posio a qual o narrador, enquanto instncia 3DUD6KHUORFN+ROPHVHODpVHPSUHDPXOKHU5DUDV
narrante ou voz que articula a narrao, conta a histria. Os vezes o ouvi mencion-la de outra maneira. Para seus
pontos de vista mais conhecidos so dois: Narrador- olhos, ela eclipsava e se sobrepunha s demais mu-
Observador e Narrador-Personagem. lheres. No que ele estivesse apaixonado por Irene
Adler. Todas as emoes, e particularmente essa, a-
O Narrador-Observador aquele que conta a histria borreciam sua mente fria, precisa, mas admiravelmen-
atravs de uma perspectiva de fora da histria, isto , ele no WHHTXLOLEUDGD Um Escndalo na Bomia, de A. Co-
se confunde com nenhum dos personagens. Este foco narra- nan Doyle.
tivo se d, predominantemente, em terceira pessoa e pode
ser dividido em: Uma das caractersticas de ambos o foco narrativo a
possibilidade de o narrador, enquanto relata a histria, co-
-Narrador-Observador Onisciente: o narrador que tudo mentar sobre os mais diversos temas como o prprio enredo,
sabe sobre o enredo, os personagens e seus pensamentos. a sua vida e a vida dos personagens ou sobre o cenrio da
A oniscincia do narrador pode ou no se limitar a apenas um narrativa. O narrador que faz este comentrio chamado de
dos personagens da histria . Exemplos: Fielding, em Tom Intruso; o que no o faz, de Neutro. Nada impede de que,
Jones; Tolstoi, em Guerra e Paz, Perto do corao selvagem, numa mesma histria, exista mais de um foco narrativo. O
de Clarice Lispector. autor deve ter cautela ao executar a mudana do ponto de
vista, evitando possveis confuses no enredo e mau enten-
4XDQGR DFRUGDYD QmR VDELD PDLV TXHP HUD 6y dimento dos leitores.
depois que pensava com satisfao: sou datilgrafa
e virgem, e gosto de coca-FROD A hora da estrela,
de Clarice Lispector. EXERCCIOS

-Narrador-Observador Cmera: Este narrador no tem a 1 Leia o texto:


cincia do que se passa nas mentes dos personagens da
histria, mas conhece tudo sobre o enredo e sobre qualquer Mas Lusa, a Luisinha, saiu muito boa dona de casa;
outra informao que no sejam ntimas da psique dos per- tinha cuidados muito simpticos nos seus arranjos; era
sonagens. Exemplo: Goodbye to Berlin, romance-reportagem asseada, alegre como um passarinho, como um passarinho
de Isherwood. amiga do ninho e das carcias do macho; e aquele serzi-
nho louro e meigo veio dar sua casa um encanto srio.
$OLSHODVRQ]HKRUDVGDPDQKmRYHOKR-RDTXLP3UHs- (...)
tes chegou no pesqueiro. Embora fizesse fora em se Estavam casados havia trs anos. Que bom que tinha
mostrar amvel por causa da visita convidada para a sido! Ele prprio melhorara; achava- se mais inteligente ,
pescaria, vinha mal-humorado daquelas cinco lguas mais alegre . . . E recordando aquela existncia fcil e
cabritando na estrada pssima. Alias o fazendeiro era doce, soprava o fumo do charuto, a perna traada, a alma
de pouco riso mesmo, j endurecido pelos setenta e dilatada, sentindo- se to bem na vida como no seu
cinco anos que o mumificavam naquele esqueleto a- jaqueto de flanela! Ea de Queirs, O primo Baslio
JXGRHWDFLWXUQR- O poo, de Mrio de Andrade.
No texto encontra- se:
O Narrador-Personagem aquele que conta a histria
atravs de uma perspectiva de dentro da histria, isto , ele, a) um narrador de 3 pessoa que, do ponto de vista da figura
de alguma forma participa do enredo, sendo um dos perso- feminina, narra as aventuras de um casal apaixonado.
nagens da histria, usando a Primeira Pessoa para se contar b) um narrador-personagem, identificado como o marido de
historia. Pode-se classificar o Narrador-Personagem em: Lusa, que enaltece os prazeres do amor.
c) um narrador-personagem que descreve a mulher como
-Narrador-Personagem Protagonista: Este narrador a uma dona de casa cuidadosa e inteligente, atributos in-
personagem principal da histria, narrando-a de um ponto de comuns na poca.
vista fixo: o seu. No sabe o que pensam os outros persona- d) um narrador de 1 pessoa que se utiliza do discurso
gens e apenas narra os acontecimentos como os percebe ou direto para dar voz ao marido de Lusa.
lembra. Exemplos: Grande Serto: Vereda, Guimares Rosa; e) um narrador onisciente que, por meio do discurso indire-
Memrias Pstumas de Brs Cubas, de Machado de Assis. to l i v re, desvenda os pensamentos do marido de Lusa.

9DLHQWmRHPSDFRXRMXPHQWRHPTXHHXYLQKDPRn- 2 - Narrador que vive os acontecimentos por ele descritos


tado; fustiguei-o, ele deu dois corcovos, depois mais como personagem secundria.
WUrVHQILPPDLV XPTXHPHVDFXGLX IRUD GDVHOD
PDVXPDOPRFUeve, que ali estava, acudiu a tempo de a) narrador-personagem protagonista
lhe pegar na rdea e det-lo, no sem esforo nem b) narrador-personagem testemunha
perigo. Dominado o bruto, desvencilhei-me do estribo b) narrador-observador onisciente
e pus-PH GH Sp -Memrias Pstuma de Brs Cu- d) narrador-observador cmera
bas,de Machado de Assis.

-Narrador-Personagem Testemunha: o narrador que vive RESPOSTA


os acontecimentos por ele descritos como personagem se- 1-E 2-B
cundria.
um ponto de vista mais limitado, uma vez que ele narra
a periferia dos acontecimentos, sendo incapaz de conhecer o

12
Lngua Portuguesa
SIGNIFICAO E CONTEXTO
SIGNIFICAO CONTEXTUAL DE PALAVRAS
E EXPRESSES. SINNIMOS E ANTNIMOS. Os procedimentos de anlise e interpretao da obra
SENTIDO PRPRIO E FIGURADO DAS PALAVRAS. literria passam sempre por sua semntica e pelas associa-
es, que tambm envolvem os smbolos. Da muito impor-
Sentido literal aquele que pode ser tomado como o tante, no processo de estudo de um texto, fazer associaes
senWLGR EiVLFR XVXDO GD SDODYUD RX H[SUHVVmR HVVH SRGH de palavras e procurar observar que muitas delas possuem
ser compreendido sem ajuda do contexto. Quando uma significados diversos e adquirem novos valores em determi-
palavra ou enunciado se apresenta em seu sentido usual, nados contextos. Para isso, a consulta aos dicionrios qua-
adquire valor denotativo. se indispensvel para os que estudam literatura. Simples
substantivos e adjetivos podem dar uma nova significao
Ganhei uma flor vermelha. aos textos, como o branco pode representar a pureza, o gato
a agilidade ou a sensualidade, o porco a voracidade ou a
Sentido figurado o que as palavras ou expresses
adquirem em situaes particulares de uso. A palavra tem comilana, o co a fidelidade, etc. Em um conto de Osman
valor conotativo quando seu significado ampliado ou altera- Lins, Missa do galo, inspirado no homnimo de Machado de
do no contexto em que empregada, sugerindo ideias que Assis, o narrador conta a noite em que esteve com Concei-
vo alm de seu sentido mais usual. o, mulher casada, momentos antes de ir missa do galo.
Pela leitura do conto de Machado de Assis fica-se sabendo
A menina uma flor. que o jovem tinha dezessete anos, e a mulher, cerca de trin-
ta. Conversam na sala e em determinado momento vo para
Os vocbulos de uma lngua constituem um conjunto o quarto. Eis o trecho:
ordenado, e o que concorre para essa ordenao o fato de
apresentarem semelhanas de forma, de sentido e de funo,
como vimos na introduo. Da poderem ser agrupados ou Resguardada por uma tulipa de cristal azul, e duplicada
classificados levando em conta trs critrios: o formal ou no espelho ante o qual est acesa, uma vela faz levitar um
mrfico, o semntico e o funcional. O critrio formal ou mrfi- cntaro e uma bacia de loua, os santos do oratrio, a cama
co baseia-se nas caractersticas da estrutura do vocbulo; o com seu lenol sem rugas, o tapete roxo, as sombras, d s
semntico baseia-se no seu modo de significao (extralin- paredes consistncia de seda ou de papel, e a prpria Con-
gustico e intralingustico), e o funcional baseia-se na funo ceio parece um ser sem peso, capaz de se mover em to-
ou papel que ele desempenha na orao. dos os sentidos, sereia, anmona, peixe florido. O quadro
trs moas de branco, vagando entre flores suspensas dos
claros e imemoriais chapus tem qualquer coisa de mrbido
CAMPO LEXICAL
e fludico. Mostra-me o lbum de fotografias. Com cuidado,
Lxico: o conjunto de palavras usadas em uma lngua ou evita as mais recentes ou passa-as com excessiva rapidez.
em um texto. Quanto lngua, no existe um falante que nas antigas, de h dez ou doze anos, que prefere deter-se.
domine por completo seu lxico, pois o idioma vivo e voc- Olhamos para elas sem falar, apenas sorrimos uma ou outra
bulos vo desaparecendo, enquanto novos surgem. Quanto vez, como convm. Estamos prximos e seu perfume envol-
ao texto, o lxico corresponde s palavras utilizadas na escri- ve-me, misturado com cheiro da vela e o odor da naftalina
ta do mesmo. As vrias palavras de um texto podem ser ou do tempo - , esse odor sempre existe nos lbuns de foto-
reagrupadas sob um mesmo tema ou sob um mesmo dom- grafias e que substitui os outros, de mulheres, de tardes e
nio de significao. Tem-se assim um campo lexical que pe manhs, ali imveis. Interpondo a mo entre a chama da vela
em evidncia as preocupaes do autor.
e o rosto da mulher, vejo-o sucessivamente brilhar e quase
Campo lexical o conjunto de palavras que, no interior ocultar-se na sombra. Como nessas mensagens secretas,
de um texto ou grupo de textos, exprime a mesma ideia ou redigidas com tinta especial e que, mergulhadas num cido,
descreve uma mesma realidade. Observe alguns campos vo revelando aos poucos, sob o texto inocente, escrito com
lexicais: tinta ordinria, informaes confidenciais, estes mergulhos
na luz e na penumbra dissolvem o rosto habitual, comum,
Escola: professor, caderno, aula, livro, apostila, material inexpressivo, descobrindo o outro, esplendente de vida, in-
escolar, diretor, etc. flamado por uma ardente beleza, que o marido talvez desco-
Internet: web, pgina, link, portal, blog, site, etc. nhea e ela prpria nunca imaginou possuir. No silncio,
Linguagem bblica: mandamentos, Jesus, Novo Testa-
mento, Apocalipse, Cus, Inferno, discpulos, etc. imperturbado mesmo quando nos movemos (deixamos, por
precauo, nossos sapatos juntos, ao p da escada), ouo o
CAMPO SEMNTICO crepitar da vela e, muito longe, o som alegre dos sinos. Deve
estar prxima de mim, menor a sombra da mo na sua
Semntica: o estudo das significaes das palavras, ou face, donde flui no sei que melodia. A sombra espalmada
seja, do significado de cada vocbulo existente na lngua. As desce lentamente sobre as grandes flores do busto, dos qua-
palavras de um texto, devido ao carter polissmico que dris, ambos ficam hirtos.No escutei o carro aproximar-se:
normalmente tm, podem evocar vrias significaes, geran- vinha at ns o rudo imperioso e contnuo do motor, fecha-
do ento um grupo semntico. ram a porta; bateram janela.
Campo semntico o conjunto dos significados, dos - Chegaram seus amigos. V depressa.
(Lins, Osman. Missa do galo. In: Assis, Machado de. et alii. Op. Cit.
conceitos que uma palavra possui. Um mesmo termo tem ou
P. 50-1.)
pode ter vrios sentidos, os quais so escolhidos de acordo
com o contexto abordado. Veja alguns exemplos de campos
semnticos: O narrador parece no querer entrar em detalhes sobre o
que se passou realmente no quarto de Conceio. Teriam
levar: transportar, carregar, retirar, guiar, transmitir, pas- cometido adultrio? Sim. E o narrador, discretamente, relata-
sar, receber. nos isso, ou melhor, apenas para aqueles que sabem ler
natureza: seres que constituem o universo, temperamen- essas mensagens secretas, redigidas com tinta especial e
to, espcie, qualidade. que, mergulhadas num cido, vo revelando aos poucos, sob
nota: anotao, breve comunicao escrita, comunicao o texto inocente, escrito com tina ordinria, informaes con-
escrita e oficial do governo, cdula, som musical, ateno.
fidenciais.

13
Lngua Portuguesa
Se fizermos as associaes necessrias e observarmos Escolha lexical e preciso conceitual
as relaes semnticas, o campo lexical, as palavras de
denominao e caracterizao, vamos descobrir de imediato Por preciso conceitual entende-se a maior aproximao
um texto cheio de smbolos. Conceio parece um ser sem possvel entre a palavra escolhida e o conceito que se pre-
peso (estaria deitada?), uma sereia (mito feminino da seduto- tende transmitir.
ra), anmona (planta que se caracteriza por grandes flores Em outros termos, entre vrias palavras capazes de tra-
variadamente coloridas e que tambm simboliza o efmero). duzir um conceito, existe uma que, por assim dizer, acerta no
No pargrafo seguinte, Conceio, uma mulher com cerca de alvo.
trinta anos (o narrador tinha dezessete, como se sabe pela Outras, no mesmo contexto, ficariam mais prximas ou
leitura do conto original de Machado de Assis), mostra-lhe menos do conceito desejado.
fotos antigas, que estabelecem uma aproximao de idades.
Exemplo desse exerccio da palavra mais precisa encon-
No terceiro e quarto pargrafos, o narrador acaricia o corpo tramos no quotidiano, quando a pessoa percorre a memria
de Conceio, interpondo a mo entre a chama da vela e o busca da melhor opo, como neste dilogo:
rosto da mulher. Segundo o narrador, apenas a sombra de
sua mo que a acaricia. Por que, ento, quando esta sombra
est sobre as grandes flores do busto, dos quadris, ambos - Como mesmo que se diz quando queremos falar de
ficam hirtos? O narrador chega a ouvir o crepitar da vela e o uma pessoa que no tem jeito?
som alegre dos sinos. Dizem que pessoas apaixonadas com - Desajeitada?
um simpleVEHLMRFKHJDPDRXYLUVLQRVO fato, enfim, que - No. Aquela que no tem mais conserto.
no existem segredos para quem sabe ler essas mensagens - Como assim?
secretas, revelada aos poucos, sob o texto inocente..., como - Uma pessoa que m e a gente sabe que nunca vai dei-
o prprio narrador faz questo de dizer, alertando o leitor, xar de ser.
dando-lhe uma pista de leitura. - Ah! Incorrigvel.
(Joo Domingues Maia. Literatura: textos & tcnicas) - Isso. Essa a palavra que eu queria.

ADEQUAO CONCEITUAL
mais ou menos isso que se passa na mente de uma
Em consequncia da complexidade que envolve a enun- pessoa em busca da preciso conceitual.
ciao, ou seja, o ato comunicativo efetivo, os conceitos de
Quando se escreve podendo fazer consulta, o dicionrio
certo ou errado ficam muito superficiais. necessrio consi-
comum ou o dicionrio de sinnimos ajuda.
derar um novo conceito: a adequao. Um enunciado pode
ser considerado adequado quando apropriado aos elemen- Na falta desse recurso, num exame sem consulta, cabe
tos presentes no processo de comunicao. Entende-se que ao redator sempre teimar um pouco, em vez de se entregar
o uso que cada indivduo faz da lngua depende de vrias primeira palavra que lhe vem mente.
circunstncias: do que vai ser falado (assunto), do meio utili-
zado (canal),do contexto (espao ambiente-temporal), do
nvel social e cultural de quem fala e, importantssimo, de EXERCCIOS
quem o interlocutor (ou seja, quem a pessoa para quem
se est falando). Isso significa que a linguagem do texto deve
estar adequada situao, ao interlocutor e intencionali- 1 Para ingls ver
dade do falante. Assim, seria inadequado um professor uni-
versitrio fazer uma palestra para os alunos de primeira a 0XLWDJHQWHXVDDH[SUHVVmRSDUDLQJOrVYHUPDVSRu-
quarta sries do Ensino Fundamental empregando palavras cos conhecem sua origem. Costuma ser associada lei de
eruditas, desenvolvendo argumentos complexos e estruturas 1831, fruto de um tratado de 1826, assinado pelo Brasil e a
sintticas elaboradas ele no seria compreendido por seus Inglaterra por presso desta, que nivelou o trfico negreiro
interlocutores. pirataria. Como a proibio no pegou, o dispositivo foi apeli-
GDGR GH OHL SDUD LQJOrV YHU 2XWUD YHrso diz que a frase
situao enunciado adequao vem do tempo em que D. Joo, recm-chegado ao Brasil,
Texto de um E a, cara? Adequado promoveu uma faustosa recepo aos seus aliados britni-
e-mail envia- Vamos no cinema (O enunciado contradiz cos, totalmente desproporcional aos usos destes tristes trpi-
do por uma noite? algumas regras da FRV 7XGR SDUD LQJOrV YHU malharam os fofoqueiros da
adolescente Me responda logo. gramtica normativa, corte.
a uma amiga. Bj, Ju. mas adequado)
Nossa Histria

Texto de um Professora, Adequado


e-mail envia- Mando-lhe este e-mail (O enunciado ade- Assinale a alternativa correta.
do por uma para justificar minha quado e no contradiz
adolescente ausncia no dia da as regras da gramtica a) pegou empregado no texto em seu sentido literal,
a uma pro- prova. Adoeci de repen- normativa)
fessora. te, mas amanh estarei
j que a lei no permitiu a priso daqueles que prati-
de volta na escola e cavam o trfico de escravos.
levarei o atestado mdi-
co. b) pra ingls ver hoje empregado com o mesmo
Obrigada,
Juliana
sentido com que surgiu e aplicado a situaes que
nos constranjam perante os ingleses.
Fala de um Boa tarde. Como voc Inadequado
adolescente est? (Embora inadequado, o c) faustosa VLJQLILFDEDUXOKHQWDHMXVWLILFDDLQDGHTXa-
ao telefone, Gostaria de saber se enunciado no contra- o da festa ao ambiente recatado da corte brasilei-
direcionada a poderamos ir ao cinema diz as regras da gram- ra.
um amigo. no sbado. Divertiramo- tica normativa)
nos muito.
Fala de um E a, mermo, to te Inadequado d) para ingls ver, pegou e malharam inserem-se em
adolescente ligando pra saber se (O enunciado inade- um mesmo nvel de utilizao da lngua, o informal.
ao telefone, amanh vai ter aula ou quado e contradiz
direcionada no. algumas regras norma- e) o dispositivo refere-se forma de aplicao da lei
secretaria da tivas)
escola. que proibiu a prtica da pirataria.

14
Lngua Portuguesa
2 Nas oraes a seguir, as expresses coloquiais destaca- SENTIDO PRPRIO E SENTIDO FIGURADO
das podem ser substitudas por sinnimas.
Pela prpria definio acima destacada podemos perce-
HEHLMDYDWXGRTXHHUDPXOKHUTXHSDVVD-se dando sopa
ber que a palavra composta por duas partes, uma delas
TXHR3DSDde araque relacionada a sua forma escrita e os seus sons (denominada
significante) e a outra relacionada ao que ela (palavra) ex-
 QXPD KRPHQDJHP WDPEpP DRV VDOJXHLUHQVHV TXH QR pressa, ao conceito que ela traz (denominada significado).
Carnaval de 1967, entraram pelo cano
Indique que opo equivale, do ponto de vista do sentido, a Em relao ao seu SIGNIFICADO as palavras se subdivi-
essas expresses: dem assim:
a) descuidando, falso, deram-se mal. Sentido Prprio - o sentido literal, ou seja, o sentido
b) reclamando, falso, obstruram-se. comum que costumamos dar a uma palavra.
c) descuidando, esperto, saram-se vitoriosos.
d) reclamando, falso, deram-se mal. Sentido Figurado - o sentido "simblico", "figurado",
e) descuidando, esperto, obstruram-se. que podemos dar a uma palavra.

Vamos analisar a palavra cobra utilizada em diferentes


contextos:
3 - Leia o texto a seguir:

Foi ento que aconteceu. De pura afobao a galinha ps 1. A cobra picou o menino. (cobra = tipo de rptil peo-
um ovo. Surpreendida, exausta. Talvez fosse prematuro. Mas nhento)
logo depois, nascida que fora para a maternidade, parecia
2. A sogra dele uma cobra. (cobra = pessoa desagrad-
uma velha me habituada. Sentou-se sobre o ovo e assim vel, que adota condutas pouco apreciveis)
ficou respirando, abotoando e desabotoando os olhos. Seu
corao to pequeno, num prato solevava e abaixava as 3. O cara cobra e computador! (cobra = pessoa que co-
penas enchendo de tepidez aquilo que nunca passaria de um nhece muito sobre alguma coisa, "expert")
ovo. S a menina estava perto e assistiu a tudo estarrecida.
Mal porm conseguiu desvencilhar-se do acontecimento
despregou-se do cho e saiu aos gritos: No item 1 aplica-se o termo cobra em seu sentido comum
(ou literal).
- Mame, mame, no mate mais a galinha, ela ps um
Nos itens 2 e 3 o termo cobra aplicado em sentido figu-
ovo! Ela quer o nosso bem! rado.
Todos correram de novo cozinha e rodearam a jovem Podemos ento concluir que um mesmo significante (par-
parturiente. Esquentando seu filho, esta no era nem suave te concreta) pode ter vrios significados (conceitos).
nem arisca, nem alegre nem triste, no era nada, era uma
galinha. O que no sugeria nenhum sentimento especial. O Quando pensamos nas facetas significativas das pala-
pai, a me e a filha olhavam j h algum tempo, sem propri- vras, inseridas nos mais diferentes contextos, podemos pen-
amente um pensamento qualquer. Nunca ningum acariciou sar naquilo que a semntica chama de DENOTAO e de
uma cabea de galinha. O pai afinal decidiu-se com certa CONOTAO.
brusquido:
Tais conceitos so importantes para voc que se prepara
para prestar uma prova de lngua portuguesa - num concurso,
- Se voc mandar matar esta galinha nunca mais comerei no vestibular, no Enem ou o que quer que seja.
galinha na minha vida!
Para dar aquela ajudinha, vamos falar um pouquinho so-
$PmHFDQVDGDGHXGHRPEURV bre essas duas possibilidades de atribuio do significado ao
(Lispector,Clarice ) significante.

Sentido denotativo (ou "literal", "ao p da letra") aquele


Por que a menina associa o fato de a galinha ter posto um em que a palavra est no seu uso mais comum, real e imedi-
ovo com a ideia de que ela quer o bem da famlia? ato; quando predomina tal uso significativo da palavra, dize-
mos que a linguagem denotativa.
a) Porque assim a galinha estaria ajudando na economia Aquela cobra capturada pelos bombeiros muito veneno-
domstica. sa!

b) Porque pr um ovo trazer vida e para a menina, trazer Agora, quando a palavra no est sendo usada em seu
vida para o seio da famlia trazer o bem, j que a ideia de sentido comum, configurando um pequeno desvio ou acrs-
vida se ope de morte, o mal. cimo em seu sentido original, dizemos que a linguagem
conotativa ou figurada. Observe o exemplo:
c) Porque a menina pde presenciar a galinha botando um
Aquela cobra ainda vai dizer o que no deve. (cobra =
ovo.
pessoa ruim, venenosa).
d) Porque seria divertido ver outras vezes a galinha pr Assim, se voc conseguiu entender bem o que so a co-
ovos. notao e a denotao, vai perceber que, no uso cotidiano da
lngua, no poderamos dizer, por exemplo:
e) Nenhuma das alternativas.
"O caminho que levava as frutas tombou; o povo o sa-
queou e fez, literalmente, a feira."
RESPOSTAS
"O preo dos alimentos subiu de modo considervel; est
1-D 2-A 3-B nas nuvens, literalmente."

15
Lngua Portuguesa
"Quando o namorado de Sueli partiu, ela, literalmente, SINNIMOS E ANTNIMOS
rastejou nos telefonemas, suplicando a sua volta."
Sinonmia ou sinnimos so palavras que possuem
Fica claro que, nos exemplos dados acima, houve apenas significados iguais ou semelhantes.
situaes de nfase; em nenhuma situao a palavra literal-
mente, portanto, est adequadamente empregada.
Aquela garota veloz.
conveniente que voc atente para a construo do sen- Aquela garota rpida.
tido no texto para saber como interpretar as informaes
codificadas pelo autor da maneira mais fiel possvel. Entre os sinnimos, h sempre um que se destaca por ser
mais expressivo, assim, no dicionrio, aparecem vrios signi-
Vale lembrar que, hoje em dia, as provas de lngua portu- ficados de cada palavra, cabe ao escritor achar a mais apro-
guesa exigem muita interpretao e identificao correta da priada ao seu contexto.
inteno por trs das palavras, o que faz com que, necessa-
riamente, voc mantenha os dois olhos bem abertos para os
ANTNIMOS OU ANTONMIA
chamados fenmenos semnticos.

Buscar o sentido das coisas mais importantes na leitura Antonmia ou antnimos so palavras que possuem
que fazemos dos mais variados textos a nossa volta. significados opostos.

Seu cabelo est muito comprido.


EXERCCIOS Seu cabelo est muito curto.
1 - Assinale a alternativa cujo termo grifado NO linguagem Algumas palavras opostas se originam de um prefixo de
conotativa:
sentido negativo ou oposto.
D PDVXPGHIXQWRDXWRUSDUDTXHPDFDPSDIRLRXWUR
bero feliz infeliz
E $FUHVFHTXHFKRYLD- peneirava - uma chuvinha mida, agradvel desagradvel
WULVWH bendizer maldizer
F $QDWXUH]DSDUHFHHVWDU chorando a perda irreparvel
 PARNIMOS
G QRGLVFXUVRTXHSURIHULX beira da minha cova
Paronmia ou parnimos so palavras que possuem
2 - O item em que o termo sublinhado est empregado no significados diferentes, mas so muito parecidas no som e na
sentido denotativo : escrita.
O garotinho gosta de brincar de pio.
D  $OpP GRV JDQKRV HFRQ{PLFRV D QRYD UHDOLGDGH UHn- O garoto sonha em ser peo de boiadeiro.
deu frutos SROtWLFRV
E FRPSHUFHQWXDLVFDSD]HVGHFDXVDULnveja ao presi- Veja, a seguir, a relao de alguns parnimos:
GHQWH
F 2VJHQpUicos esto abrindo as portas GRPHUFDGR absolver - perdoar
G DLQG~VWULDdisparou JRUGRVLQYHVWLPHQWRV
absorver - sorver
acostumar - contrair hbito
3 - Assinale o segmento em que NO foram usadas palavras costumar - ter por hbito
em sentido figurado: amoral - indiferente moral
imoral - contra a moral
a) Lendo o futuro no passado dos polticos (...)
b) As fontes que iam beber em seus ouvidos. apstrofe - figura de linguagem
c) Eram 75 linhas que jorravam na mquina de escrever apstrofo - sinal grfico
com regularidade mecnica. aprender - instituir-se
d) Antes do meio-dia, a coluna estava pronta. apreender - assimilar
e) (...) capaz de cortar com a elegncia de um golpe de
florete. arrear - pr arreios
arriar - descer, baixar
cavaleiro - aquele que anda a cavalo
4 - O item em que o termo sublinhado est empregado no cavalheiro - homem educado
sentido denotativo : comprimento - extenso
D  $OpP GRV JDQKRV HFRQ{PLFRV D QRYD UHDOLGDGH UHn- cumprimento - saudao
deu frutos SROtWLFRV deferir - conceder, atender
E FRPSHUFHQWXDLVFDSD]HVGHFDXVDUinveja ao presi- diferir - ser diferente, adiar
GHQWH delatar - denunciar
F 2VJHQpULFRVHVWmRabrindo as portas GRPHUFDGR dilatar - alargar
G DLQG~VWULDGLVSDURXgordos LQYHVWLPHQWRV
H Colheu XPDUHYHODomRVXUSUHHQGHQWH descrio - ato de descrever
discrio - ser discreto
descriminar - inocentar
discriminar - distinguir
RESPOSTAS despensa - lugar onde se guardam mantimentos
1-D 2-B 3-D 4-B dispensa - licena
destratar - insultar
distratar - desfazer
emergir - vir tona

16
Lngua Portuguesa
imergir - mergulhar
CLASSES DE PALAVRAS: EMPREGO E SENTIDO
emigrar - sair da ptria
QUE IMPRIMEM S RELAES QUE ESTABELECEM:
imigrar - entrar num pas estranho para nele morar SUBSTANTIVO, ADJETIVO, ARTIGO, NUMERAL,
eminente - notvel, clebre PRONOME, VERBO, ADVRBIO,
iminente - prestes a acontecer PREPOSIO E CONJUNO
estdio - praa de esportes
estgio - preparao, perodo
Palavra varivel a palavra que altera sua forma para in-
flagrante - evidente dicar um acidente gramatical. Palavra invarivel a palavra
fragrante - perfumado de forma fixa.
incidente - episdio
acidente - desastre As palavras agrupam-se em dez classes gramaticais. E-
xistem classes gramaticais de palavras variveis e classes
inflao - desvalorizao (dinheiro) gramaticais de palavras invariveis
infrao - violao
infligir - aplicar castigo SUBSTANTIVO
infringir - no respeitar
tico - relativo ao ouvido Substantivo a palavra que d nome s pessoas, ani-
ptico - relativo viso mais, lugares, coisas ou seres em geral. Divide-se em:
peo - amansador de cavalos, pea no jogo de xadrez
pio - brinquedo 1) Comum: o substantivo que d nome a todos os seres da
pequenez - relativo a pequeno mesma espcie: aluno, animal, vegetal, homem.
pequins - originrio de Pequim, raa de ces
2) Prprio: o substantivo que d nome a um ser da mesma
plaga - regio, pas
praga - maldio espcie: Jlia, Brasil, Copacabana, Tatuap.
pleito - disputa eleitoral 3) Concreto: o substantivo que designa seres de existncia
preito - homenagem
real ou que a imaginao representa: mulher, pedra, Deus,
precedente - antecedente fada, lobisomem.
procedente - proveniente
ratificar - confirmar 4) Abstrato: o substantivo que designa qualidade ou sen-
retificar - corrigir timento, ao e estado dos seres, dos quais se podem abs-
reboco - argamassa de cal e areia trair (separar) e sem os quais no poderiam existir: beleza,
reboque - cabo que prende um veculo a outro coragem, brancura (qualidades), viagem, estudo, doao,
soar- produzir som esforo, fuga (aes), amor, saudade, alegria, dor, fome
suar verter suor pelos poros (sentimentos, sensaes), vida, morte, cegueira, doena
(estados).

EXERCCIOS 5) Simples: o substantivo formado por um s elemento


(radical): discos, flor, vitrola, couve.
1) Assinale o sinnimo da palavra destacada na seguinte
IUDVH(ORJLRXRGHSXWDGRHWRGRVRVVHXVsequazes 6) Composto: o substantivo formado por mais de um ele-
a) inimigos mento: couve-flor, guarda-chuva, pingue-pongue, p de mo-
b) parentes leque, passatempo.
c) partidrios
d) adversrios 7) Primitivo: o substantivo que foi criado antes de outros
e) alunos no uso corrente da lngua: livro, pedra, dente, flor.

2) Assinale o antnimo da palavra destacada na seguinte 8) Derivado: o substantivo que foi criado depois de outro
IUDVH 2 prolixo professor Pinheiro discursava sobre a gra- no uso corrente da lngua: livreiro, pedreiro, dentista, florista.
PiWLFDQRUPDWLYD
a) sensual 9) Coletivo: o substantivo que representa um conjunto de
b) lacnico seres da mesma espcie: lbum, esquadrilha.
c) insolente
d) fatdico Alguns coletivos mais comuns:
e) trgicos
Grupos de pessoas
3) Os significados das palavras parnimas: imergir, eminn-
cia, descrio so, respectivamente: assembleia: de pessoas reunidas, de parlamentares
a) afundar, proximidade de ocorrncia, reserva associao: de scios
auditrio: de ouvintes
b) subir, proximidade de ocorrncia, exposio
banca: de examinadores
c) afundar, excelncia, reserva banda: de msicos
d) subir, excelncia, reserva bando: de desordeiros, malfeitores
e) afundar, excelncia, exposio batalho: de soldados
cabido: de cnegos
cmara: de vereadores, parlamentares (oficialmente reuni-
dos)
RESPOSTAS cambada: de desordeiros
1-C 2-B 3-E caravana: de viajantes, peregrinos
caterva: de desordeiros, malfeitores
choldra: assassinos, malfeitores

17
Lngua Portuguesa
chusma: de pessoas em geral, de criados biblioteca: de livros catalogados
claque: de pessoas pagas para aplaudir cinemateca: de filmes
clero: de religiosos constelao: de estrelas
colnia: de imigrantes, migrantes cordilheira: de montanhas
comitiva: de acompanhantes enxoval: de roupas
corja: de ladres, malfeitores esquadra: de navios de guerra
corpo: de eleitores, alunos, jurados esquadrilha: de avies
corpo docente: de professores federao: de estados
coro: de cantores frota: de navios, avies, veculos
elenco: de atores de uma pea, filme etc. galeria: de esttuas, quadros
exrcito: de soldados molho: de chaves
falange: tropas, anjos, heris pinacoteca: de quadros
filarmnica: de msicos (sociedade musical) trouxa: de roupas
grmio: de estudantes vocabulrio: de palavras
guarnio: de soldados (que guarnecem um lugar)
irmandade: de membros de associao religiosa GNERO DOS SUBSTANTIVOS
junta: de mdicos, examinadores
jri: de jurados Gnero a propriedade que as palavras tm de indicar o
legio: de soldados, anjos, demnios
sexo real ou fictcio dos seres. Na lngua portuguesa so dois
leva: de presos, recrutas
malta: de malfeitores, desordeiros os gneros: o masculino e o feminino.
multido: de pessoas em geral
orquestra: de msicos FORMAO DO FEMININO
peloto: de soldados
piquete: de grevistas De modo geral, forma-se o feminino substituindo-se a
plantel: de atletas desinncia "o" pela desinncia "a": menino, menina; gato,
plateia: de espectadores gata.
pliade: de poetas, artistas
populao: de habitantes Todavia, os processos de formao so bem variados:
prole: de filhos
quadrilha: ladres, malfeitores
romaria: de peregrinos Masculino Feminino Masculino Feminino
tribo (nao): de ndios alfaiate costureira doutor doutora
tripulao: de marinheiros, aerovirios ano an cavaleiro amazona
tropa: de soldados, pessoas aviador aviadora cavalheiro dama
turma: de estudantes, trabalhadores, pessoas em geral av av compadre comadre
bode cabra cnsul consulesa
Grupos de animais ou vegetais frade freira hspede hspeda
frei sror oficial oficiala
alcateia: de lobos genro nora judeu judia
bando: de aves gigante giganta ateu ateia
boiada: de bois heri herona hebreu hebreia
cacho: de uvas, bananas juiz juza profeta profetisa
cfila: de camelos maestro maestrina ru r
cardume: de peixes
colmeia: de abelhas
colnia: de bactrias, formigas, cupins Substantivos que merecem destaque quanto ao gnero:
enxame: de abelhas, insetos
fato: de cabras Masculino Feminino
fauna: de animais prprios de uma regio
feixe: de lenha, capim o apndice a aguardente
flora: de vegetais prprios de uma regio o blido a alface
junta: de bois o champanha a apendicite
manada: de animais de grande porte
matilha: de ces o cl a aluvio
ninhada: de filhotes de animais o d a blide
nuvem: de insetos (gafanhotos, mosquitos, etc) o eclipse a cal
rebanho: de gado o eczema a cataplasma
rcua: animais de carga
rstia: de alho ou cebola o estratagema a clera
revoada: de pssaros o formicida a comicho
tropilha: de cavalos
o gengibre a derme
vara: de porcos
o guaran a dinamite
Outros grupos o lana-perfume a elipse
o magma a entorse
acervo: de obras de arte o milhar a gnese
alameda: de rvores (em linha) o proclama a libido
alfabeto: de letras o saca-rolhas a matin
antologia: de textos literrios ou cientficos o ssia a omelete
armada: de navios de guerra
arquiplago: de ilhas o teorema a omoplata
arsenal: de armas, munies o trema a sentinela
atlas: de mapas
baixela: de objetos de mesa Substantivos que admitem os dois gneros
bateria: peas de guerra ou de cozinha; instrumentos de
percusso o gape ou a gape

18
Lngua Portuguesa
o caudal ou a caudal 3) Os substantivos terminados em "al", "el", "ol", "ul" plu-
o diabete(s) ou a diabete(s) ralizam-se trocando o "l" final por "is": jornal, jornais; anel,
o laringe ou a laringe anis; anzol, anzis; azul , azuis; lcool, alcois.
o personagem ou a personagem 4) Os terminados em "il" admitem duas formas:
o usucapio ou a usucapio

Substantivos com mudana de sentido na mudana os oxtonos mudam "il" em "is": barril, barris; funil, funis;
de gnero
os paroxtonos mudam "il" para "eis": fssil, fsseis; rptil,
H substantivos que so masculinos ou femininos, con- rpteis.
forme o sentido com que se achem empregados.
5) Os terminados em "m" trocam esta letra por "ns": nuvem,
Masculino Feminino nuvens; fim, fins.
o guia: pessoa de grande a guia: ave de rapina
inteligncia ou sutileza. 6) Os terminados em "s" monosslabos ou oxtonos formam
o cabea: chefe, lder a cabea: parte do corpo o plural acrescentando-se "es": ingls, ingleses; lils, lilases;
o capital: dinheiro a capital: cidade principal gs, gases.
o caixa: pessoa que trabalha em a caixa: objeto
tal seo.
7) Os terminados em "s" paroxtonos ou proparoxtonos so
o cisma: separao a cisma: ideia fixa, des-
confiana invariveis: o lpis, os lpis; o atlas, os atlas; o nibus, os
o cura: padre a cura: restabelecimento nibus.
o estepe: pneu reserva a estepe: plancie de ve-
getao herbcea. 8) Os terminados em "x" so invariveis: o trax, os trax; o
o grama: unidade de massa a grama: relva fnix, os fnix.
o guarda: vigilante a guarda: vigilncia
o guia: pessoa que orienta a guia: documento 9) Os terminados em "o" admitem trs hipteses:
o lente: professor a lente: o disco de vidro
o lotao: veculo a lotao: capacidade a) uns formam o plural com o acrscimo de "s": mo, mos;
o moral: nimo a moral:tica bno, bnos; rgo, rgos; irmo, irmos.
o rdio: aparelho a rdio: estao
b) outros, mais numerosos, mudam "o" em "es": limo,
SUBSTANTIVOS UNIFORMES limes; porto, portes; balo, bales; melo, meles.

So aqueles que apresentam uma nica forma para o c) outros, enfim, trocam "o" por "es": po, pes; co,
masculino e feminino. ces; aldeo, aldees; sacristo, sacristes.

1) Epicenos: designam o sexo de certos animais com o aux- PLURAL DOS SUBSTANTIVOS COMPOSTOS
lio dos adjetivos macho e fmea: o jacar (macho ou fmea);
o tigre (macho ou fmea); a pulga (macho ou fmea). Existem quatro hipteses:

2) Sobrecomuns: designam pessoas com uma forma nica 1) Pluralizam-se os dois elementos formados por:
para o masculino e feminino:
substantivo + substantivo: couve-flor, couves-flores.
o cadver (homem ou mulher); a vtima (homem ou mulher);
o cnjuge (homem ou mulher); a criana (menino ou menina). substantivo + adjetivo: amor-perfeito, amores-perfeitos.

3) Comuns de dois gneros: sob uma s forma designam adjetivo + substantivo: bom-dia, bons-dias.
os indivduos dos dois sexos, sendo auxiliados pelo artigo,
adjetivo ou pronome: numeral + substantivo: segunda-feira, segundas-feiras.

o colega, a colega; artista famoso, artista famosa; 2) Apenas o segundo elemento varia:
esse pianista, essa pianista; o reprter, a reprter.
verbo + substantivo: guarda-roupa, guarda-roupas.
NMERO DOS SUBSTANTIVOS
palavra invarivel ou prefixo + palavra invarivel:
Em portugus, h dois nmeros gramaticais: o singular, sempre-viva, sempre-vivas; ex-diretor, ex-diretores.
que indica um ser ou um grupo de seres: ave, bando; e o
plural, que indica mais de um ser ou um grupo de seres: palavras repetidas: reco-reco, reco-recos.
aves, bandos.
3) Apenas o primeiro elemento varia:
Os substantivos flexionam-se no plural conforme as re-
gras: com preposio expressa: p de moleque, ps de moleque;
mo de obra, mos de obra.
1) Pelo acrscimo no plural de "s", o que se d se o subs-
tantivo terminar em vogal ou ditongo oral: asa, asas; txi, quando o segundo elemento indica finalidade ou semelhan-
txis; tubo, tubos; ba, bas; vu, vus. a do primeiro: sof-cama, sofs-cama; peixe-boi, peixes-boi.

2) Pelo acrscimo de "es" ao singular nos terminados em 4) Os dois elementos ficam invariveis:
"r" ou "z": colher, colheres; dlar, dlares; amor, amores;
cruz, cruzes; giz, gizes. verbo + advrbio: o bota-fora, os bota-fora.

19
Lngua Portuguesa
verbo + substantivo no plural: o saca-rolhas, os saca-rolhas. Pode ser formado sinttica ou analiticamente.

OBSERVAES: 1) Aumentativo sinttico: forma-se com sufixos especiais:


a) A palavra "guarda" pode ser substantivo ou verbo: quando copzio (copo), barcaa (barca), muralha (muro).
verbo (verbo guardar), fica invarivel; quando substantivo 2) Aumentativo analtico: forma-se com o auxlio do adjeti-
(o homem que guarda), vai para o plural. vo grande, e de outros do mesmo sentido: letra grande, pe-
dra enorme, esttua colossal.
verbo substantivo
os guarda chuvas O grau diminutivo exprime um ser com seu tamanho nor-
os guarda comidas mal diminudo. Pode ser formado sinttica ou analiticamente.
os guarda sis
1) Diminutivo sinttico: forma-se com sufixos especiais:
substantivo adjetivo casebre (casa), livreco (livro), saleta (sala).
os guardas florestais
os guardas civis 2) Diminutivo analtico: forma-se com o adjetivo pequeno,
os guardas noturnos ou outros equivalentes: chave pequena, casa pequenina,
semente minscula.
b) Palavras compostas com a palavra "gro"

a palavra "gro" vai para o plural quando indica grnulo, a EXERCCIOS


unidade: gros de bico.
1) Assinale a alternativa que apresenta os substantivos clas-
a palavra "gro" fica no singular quando significa grande: sificados como comuns de dois gneros.
os gro-duques, as gr-duquesas.
a) o lojista, o herege, o mrtir, o intrprete
c) Plural de substantivos diminutivos: b) o apstolo, o carrasco, o cnjuge, a criana
c) o tatu, a girafa, a tainha, a avestruz
O plural dos terminados em "zinho" ou em "zito" se faz d) o patriarca, o frade, o confrade, o carneiro
flexionando-se o substantivo primitivo, retirando-se o "s" final e) o ente, a testemunha, o cnjuge, a testemunha
e acrescentando-se "zinhos" ou "zitos".
2) Assinale a alternativa em que as formas do plural de todos
Exemplos: papelzinho / papi(s) / papeizinhos; os substantivos se apresentam de maneira correta:
limozito / lime(s) / limezitos.
a) alto-falantes, coraozinhos, afazeres, vveres.
Os substantivos terminados em "r" fazem o plural de duas b) espadas, frutas-po, p de moleques, peixe-boi.
maneiras: c) vai-volta, animaizinhos, beija-flores, salvo-condutos.
d) animalzinhos, vai-voltas, vai-vns, salvos-condutos.
florzinha / flore(s) / florezinhas; e) bates-bolas, cavalos-vapores, bens-te-vis, vices-reis.
florzinha / florzinhas.
3) A alternativa em que o plural dos nomes compostos est
empregado corretamente :
GRAU DOS SUBSTANTIVOS
a) p de moleques/ beija-flores/ obras-primas/ navios-escolas.
Grau dos substantivos a propriedade que essas pala- b) ps de moleques/ beija-flores/ obras-primas/ navios-escolas.
vras tm de exprimir as variaes de tamanho dos seres. c) ps de moleque/ beija-flores/ obras-primas/ navios-escola.
d) p de moleques/ beijas-flores/ obras-primas/ navios-escola.
e) ps de moleque/ beijas-flores/ obra-primas/ navio-escolas.
So dois os graus do substantivo: aumentativo e diminuti-
vo.
4) O plural dos nomes compostos est correto em todas as
1) Aumentativo: forma-se com os sufixos ao, alha, arra, alternativas, exceto em:
zio, ona, o, az, etc.: garrafo, papelo, cartaz (carta), la-
dravaz (ladro), lobaz (lobo), ricao, balao, barcaa, mulhe- a) Ela gosta de amores-perfeitos e cultiva-os.
raa, vidraa, dramalho (drama), vagalho (vaga), balzio b) Os vice-diretores reunir-se-o na prxima semana.
(bala), copzio (copo), pratzio (prato), beiorra (beio), ca- c) As aulas sero dadas s segundas-feiras.
d) H muitos beijas-flores no meu quintal.
beorra (cabea), manzorra (mo), vozeiro (voz), homenzar-
ro, canzarro, bocarra (boca), naviarra (navio). e) H vrios cafs-concerto nesta avenida.

2) Diminutivo: forma-se com os sufixos acho, ebre, eco, 5) Assinale a alternativa em que o substantivo composto no
ico, inho, ito, ejo, etc.: mosquito, cabrito, senhorita, fogacho esteja corretamente flexionado no plural.
(fogo), riacho, populacho, penacho (pena), animlculo (ani-
mal), febrola (febre), gotcula (gota), versculo (verso), mont- a) Aqui, os ps de vento levantam telhados.
culo (monte), partcula (parte), radcula (raiz), glbulo (globo), b) H tempo eu no via bem-te-vis de pele e osso.
c) Dois tecos-tecos sobrevoam o local do acidente.
clula (cela), animalejo, lugarejo, vilarejo, ilhota, fortim (forte),
d) Nos vaivns da burocracia, foi-se o meu precioso tempo.
espadim (espada), camarim (cmara), casebre (casa).
Observao: O diminutivo pode exprimir carinho ou despre- e) No aguento mais os entra e sai nesta casa.
zo. (carinho: filhinho, mezinha. desprezo: padreco, jorna-
leco, lugarejo)
RESPOSTAS
1-A 2-C 3-C 4-D 5-C
O grau aumentativo exprime um aumento do ser relativa-
mente ao seu tamanho normal.

20
Lngua Portuguesa
ADJETIVO FORMAO DO ADJETIVO

So palavras que indicam qualidade, propriedade ou Quanto formao, o adjetivo pode ser:
estado do ser.
1) Primitivo (o que no deriva de outra palavra): bom, forte,
Exemplo: Meu caderno novo j est sujo. feliz.

2DGMHWLYRSHUWHQFHDXPLQYHQWiULRDEHUWRVHPSUHVXs- 2) Derivado (o que deriva de substantivos ou verbos): famo-


cetvel de ser aumentado. A estrutura interna ou constitucio- so, carnavalesco.
nal do adjetivo consiste nas lnguas flexveis, na combinao
de um signo lexical expresso pelo radical com signos morfo- 3) Simples: brasileiro, escuro, etc.
lgicos expressos por desinncias e alternncias, ambas
destitudas de existncia prpria fora dessas combinaes. 4) Composto: castanho-claro, azul-marinho.
No portugus, entre as desinncias est a marca da grada-
o, isto , o grau absoluto ou relativo da parte, ou aspecto FLEXO DO ADJETIVO
TXDOLGDGH  VLJQLILFDGD QR UDGLcal. (belo-belssimo), bem
como afixos de gnero e de nmero. A relao gramatical O adjetivo varia em gnero, nmero e grau.
instaurada entre o signo delimitador e o signo delimitado
JHUDOPHQWHH[SUHVVDSHODFRQFRUGkQFLDEvanildo Bechara GNERO DO ADJETIVO

O adjetivo pode ser expresso atravs de duas palavras: Quanto ao gnero, dividem-se os adjetivos em:
o que se chama de locuo adjetiva.
1) Uniformes: aqueles que tm uma s forma para os dois
Locuo adjetiva Adjetivo gneros: mesa azul, olho azul.
de abdmen abdominal
de abelha apcola 2) Biformes: apresentam duas formas, uma para o masculi-
de acar sacarino no, outra para o feminino: mau m, esperto esperta, ativo
de agricultor agrcola
ativa, ateu ateia.
de gua aqutico, hidrulico
de aluno discente
de anjo angelical NMERO DO ADJETIVO
de bexiga cstico, vesical
de cabea ceflico Os adjetivos simples seguem as mesmas regras de flexo
de calor trmico numrica dos substantivos: igual - iguais, azul - azuis, feroz -
de cnjuge conjugal ferozes.
de corpo corporal, corpreo
de costas dorsal
PLURAL DOS ADJETIVOS COMPOSTOS
de ensino didtico
de estmago estomacal, gstrico
de febre febril 1) Os componentes sendo adjetivos, somente o ltimo toma
de filho filial a flexo do plural: tecido verde-claro, tecidos verde-claros;
de gelo glacial cabelo castanho-escuro, cabelos castanho-escuros.
de homem humano
de irmo fraternal, fraterno 2) Os componentes sendo palavra invarivel + adjetivo,
de lago lacustre somente este ltimo se flexionar: menino mal-educado,
de leite lcteo, lctico
meninos mal-educados.
de me materno, maternal
de pele cutneo
de sangue hemtico, sanguneo 3) Os compostos de adjetivo + substantivo so invariveis:
de trax torcico farda verde-oliva, fardas verde-oliva; terno amarelo-canrio,
de voz vocal ternos amarelo-canrio.

ADJETIVOS PTRIOS 4) Invariveis ficam tambm as locues adjetivas formadas


de cor + substantivo:
Designam nacionalidade ou lugar de origem de algum ou vestido cor-de-rosa, vestidos cor-de-rosa.
de alguma coisa:
GRAU DO ADJETIVO
Brasil - brasileiro
Acre - acriano O grau do adjetivo exprime a intensidade das qualidades
Alagoas - alagoano dos seres. So dois os graus do adjetivo: o comparativo e o
Amazonas - amazonense superlativo.
Bahia - baiano
Esprito Santo - esprito-santense O grau comparativo pode ser:
Rio Grande do Norte - norte-rio-grandense
Joo Pessoa - pessoense 1) De Igualdade:
Salvador - soteropolitano ou salvadorense A casa to antiga quanto o homem.
Belo Horizonte - belorizontino
Niteri - niteroiense 2) De Superioridade:
So Paulo (capital) paulistano A casa mais antiga do que o homem.
So Paulo (estado) paulista
Rio de Janeiro (capital) carioca 3) De Inferioridade:
Rio de Janeiro (estado) fluminense A casa menos antiga do que o homem.

21
Lngua Portuguesa
Alguns adjetivos possuem, para o comparativo de superi- legal. . . . . . . . . . . . . . . . . . . . . . . .legalssimo
oridade, formas sintticas, herdadas do latim. So elas: bom - livre . . . . . . . . . . . . . . . . . . . . . . . . . librrimo
melhor, mau - pior, grande - maior, pequeno - menor. magro . . . . . . . . . . . . . . . . . . . . . macrrimo
mal. . . . . . . . . . . . . . . . . .malssimo, pssimo
O grau superlativo divide-se em: negro . . . . . . . . . . . . . . . . . . . . . . . . nigrrimo
nobre . . . . . . . . . . . . . . . . . . . . . . nobilssimo
1) Absoluto: pequeno . . . . . . . . . . . . . . . . . . . . . . mnimo
pobre . . . . . . . . . . . . . . . . . . . . . . pauprrimo
a) Analtico: provvel . . . . . . . . . . . . . . . . . probabilssimo
A menina muito bela. sbio . . . . . . . . . . . . . . . . . . . . sapientssimo
sagrado . . . . . . . . . . . . . . . . . . . sacratssimo
b) Sinttico: simples . . . . . . . . . . . . . . . . . . simplicssimo
A menina belssima. terrvel . . . . . . . . . . . . . . . . . . . . terribilssimo
veloz . . . . . . . . . . . . . . . . . . . . . .velocssimo
2) Relativo:
EXERCCIOS
a) De Superioridade:
1) Analise o grau do adjetivo grifado nas frases que seguem,
Analtico: de acordo com o seguinte cdigo:
Joo o mais alto de todos.
1 - comparativo de igualdade
Sinttico: 2 - comparativo de superioridade
Este monte o maior de todos. 3 - comparativo de inferioridade
4 - superlativo absoluto
b) De Inferioridade: 5 - superlativo relativo
Joo o menos rpido de todos.
a) ( ) E a vida seguia muito calma.
O grau superlativo exprime uma qualidade no mais alto b) ( ) Foi a mais alta demonstrao de amor.
grau de intensidade possvel. Pode ser relativo ou absoluto. c) ( ) Livre-nos Deus dessa misrrima condio.
d) ( ) A vida mais breve do que a morte.
O superlativo relativo indica que entre os seres que pos- e) ( ) O lazer to importante quanto o trabalho.
suem determinada qualidade, h um que a possui num grau f) ( ) Ele foi menos delicado do que eu.
inexcedvel.
2) Assinale a orao em que o termo cego(s) um adjetivo.
O superlativo absoluto isola o ser qualificado no seu mais
alto e intenso grau possvel, podendo assumir a forma sintti- a) "Os cegos, habitantes de um mundo esquemtico, sabem
ca ou analtica. aonde ir..."
b) "O cego de Ipanema representava naquele momento todas
O superlativo absoluto sinttico d-se por meio dos se- as alegorias da noite escura da alma..."
guintes sufixos: ssimo, imo e rimo. c) "Todos os clculos do cego se desfaziam na turbulncia do
lcool."
O superlativo absoluto analtico d-se por meio de advr- d) "Naquele instante era s um pobre cego."
bios de intensidade que precedem o adjetivo. e) "... da Terra que um globo cego girando no caos."

Alguns adjetivos possuem formas literrias, cultas, de 3) No se flexionam os compostos abaixo, em qualquer de
superlativo absoluto sinttico: seus elementos, exceto:

acre . . . . . . . . . . . . . . . . . . . . . . . . . acrrimo a) azul-claro


agudo . . . . . . . . . . . . . . . . . . . . . acutssimo b) verde-alface
amargo . . . . . . . . . . . . . . . . . . . . amarssimo c) amarelo-laranja
amigo . . . . . . . . . . . . . . . . . . . . . amicssimo d) castanho-avel
spero . . . . . . . . . . . . . . . . . . . . . . asprrimo e) verde-garrafa
clebre . . . . . . . . . . . . . . . . . . . . . celebrrimo
comum . . . . . . . . . . . . . . . . . . . comunssimo 4) O adjetivo est mal flexionado em grau em:
cristo . . . . . . . . . . . . . . . . . . . . cristianssimo
cruel . . . . . . . . . . . . . . . . . . . . . . crudelssimo a) livre: librrimo
difcil . . . . . . . . . . . . . . . . . . . . . . . . dificlimo b) magro: macrrimo
doce . . . . . . . . . . . . . . . . . . . . . . . .dulcssimo c) doce: doclimo
dcil . . . . . . . . . . . . . . . . . . . . . . . . . doclimo d) triste: tristssimo
fcil . . . . . . . . . . . . . . . . . . . . . . . . . . faclimo e) fcil: faclimo
feio. . . . . . . . . . . . . . . . . . . . . . . . . . fessimo
feliz . . . . . . . . . . . . . . . . . . . . . . . . felicssimo 5) Assinale a nica alternativa em que se encontram as for-
feroz. . . . . . . . . . . . . . . . . . . . . . . .ferocssimo mas corretas do superlativo erudito dos adjetivos soberbo,
fiel . . . . . . . . . . . . . . . . . . . . . . . . . fidelssimo malvolo e magro.
frgil. . . . . . . . . . . . . . .. .fraglimo, fragilssimo
frio . . . . . . . . . . . . . . . . . . . . . . . . frigidssimo a) soberbssimo / malevolssimo / magrrimo
grande . . . . . . . . . . . . . . . . . . . . . . . . mximo b) magrssimo / maleovolrrimo / soberblimo
humilde . . . . . . . . . . . . . . . . . . . . . . humlimo c) superbssimo / malevolentssimo / macrrimo
incrvel . . . . . . . . . . . . . . . . . . incredibilssimo d) soberbrrimo / magrlimo / malevolentrrimo
inimigo. . . . . . . . . . . . . . . . . . . . .inimicssimo e) magrrimo / superbrrimo / malevolentssimo

22
Lngua Portuguesa
6) Marque: ARTIGO

a) se I e II forem verdadeiras. Artigo uma palavra que antepomos aos substantivos


b) se I e III forem verdadeiras. para determin-los; indica-se ao mesmo tempo gnero e
c) se II e III forem verdadeiras. nmero.
d) se todas forem falsas.
Dividem-se os artigos em:
"... eu no sou propriamente um autor defunto, mas um de-
funto autor." definidos: o, a, os, as
indefinidos: um, uma, uns, umas.
I. no primeiro caso, autor substantivo; defunto adjetivo.
II. no segundo caso, defunto substantivo; autor adjetivo. Os definidos determinam os substantivos de modo preci-
III. em ambos os casos, tem-se um substantivo composto. so, particular: Viajei com o mdico.

7) Substitua as locues adjetivas pelo adjetivo correspon- Os indefinidos determinam os substantivos de modo
dente. vago, impreciso, geral: Viajei com um mdico.

a) chuvas de vero FLEXO DO ARTIGO


b) voz de prata
c) hbitos contra a moral O artigo se flexiona em gnero e nmero:
d) questo sem dvida
e) plantas do lago Combinaes dos artigos:
f) regime de chuva
g) astcia de raposa artigo preposies
h) congresso de bispos definido a de em por(per)
i) cor de chumbo o ao do no pelo
a da na pela
8) A locuo adjetiva correspondente a cstico : os aos dos nos pelos
as s das nas pelas
a) de cabea artigo preposies
b) de estmago indefinido em de
c) de acar um num dum
d) de bexiga uma numa duma
uns nuns duns
umas numas dumas
9) Aponte a alternativa que possua um adjetivo biforme e um
adjetivo uniforme respectivamente: Particularidades

a) interior - hipcrita O artigo transforma qualquer palavra em substantivo.


b) cru - europeu
c) so - audaz o pobre (adjetivo = pobre)
d) paulista - mau
palavra substantivada

10) Assinale a alternativa incorreta quanto formao do o sim (advrbio = sim)


plural dos adjetivos compostos:
palavra substantivada
a) moas surdas-mudas
b) saias azuis-celestes 2DUWLJRGLVWLQJXHRVKRP{QLPRVHdefine o seu significado:
c) ternos verde-oliva
d) tecidos furta-cor o caixa (pessoa) a caixa (objeto)

11) Aponte a alternativa correta:


EMPREGO DO ARTIGO
a) O adjetivo formado por cor + de + substantivo no recebe
s no plural. 1) Ambas as mos.
b) A palavra ultravioleta varivel.
c) O plural de azul-marinho azul-marinhos. Usa-se o artigo entre o numeral ambas e o substantivo.
d) O adjetivo marrom-caf varivel, acrescentasse s nos
dois elementos. Exemplo: Ambas as mos so perfeitas.

2) Estou em Paris / Estou na famosa Paris.


RESPOSTAS
1 a) 4; b) 5; c) 4; d) 2; e) 1; f) 3 No se usa artigo antes dos nomes de cidades, a menos
2-E 3-A 4-C 5-C 6-A que venham determinados por adjetivos ou locues adjeti-
7 a) estivais; b) argntea; c) imorais; vas.
d) indubitveis; e) lacustres; f) pluvial;
g) vulpina; h) episcopal; i) plmbea. Exemplo: Vim de Paris. Vim da luminosa Paris.
8-D 9-C 10 - B 11 - A Mas com alguns nomes de cidades conservamos
o artigo.

23
Lngua Portuguesa
Exemplos: As formas de + um e em + um podem-se usar contradas
O Rio de Janeiro, O Cairo, O Porto. (dum e num) ou separadas (de um, em um).
Exemplos: Estava em uma cidade grande. ou Estava numa
Obs.: Pode ou no ocorrer crase antes dos nomes de cidade, cidade grande.
conforme venham ou no precedidos de artigo.
EXERCCIOS
Exemplo: Vou a Paris.
Vou Paris dos museus. 1) Coloque o artigo nos espaos vazios conforme o termo
subsequente o aceite ou no. Quando necessrio, faa a
3) Toda cidade / toda a cidade. contrao de preposio com o artigo.

7RGRWRGDGHVLJQDPqualquer, cada. a) Afinal, estamos em .......... Brasil ou em .......... Portugal?


b) Viajamos para .......... Estados Unidos, fora isso nunca
Exemplo: Toda cidade pode concorrer (qualquer cidade). samos de .......... casa.
c) Todos .......... casos esto sob controle.
7RGRRWRGDDGHVLJQDPtotalidade, inteireza. d) Toda .......... famlia estrangeira que vem para o Brasil
procura logo seus parentes.
Exemplo: Conheci toda a cidade (a cidade inteira). e) Todos .......... vinte jogadores esto gripados.
f) Todos .......... quatro saram.
No plural, usa-VH WRGRV RV WRGDV DV H[FHWR Dntes de
numeral no seguido de substantivo. 2) Nas frases que seguem, h um artigo (definido ou indefini-
do) grifado. Indique o seu valor, de acordo com o cdigo que
Exemplos: segue.

Todas as cidades vieram. 1 - O artigo est especificando o substantivo.


Todos os cinco clubes disputaro o ttulo. 2 - O artigo est generalizando o substantivo.
Todos cinco so concorrentes. 3 - O artigo est intensificando o substantivo.
4 - O artigo est designando a espcie toda do substantivo.
4) Tua deciso / a tua deciso. 5 - O artigo est conferindo maior familiaridade ao substanti-
vo.
De maneira geral, facultativo o uso do artigo antes dos 6 - O artigo est designando quantidade aproximada.
possessivos.
a) ( ) Afinal, todos sabiam que o Joo no seria capaz disso.
Exemplos: Aplaudimos tua deciso. b) ( ) Anchieta catequizou o ndio brasileiro e lhe ensinou os
Aplaudimos a tua deciso. rudimentos da f catlica.
c) ( ) Respondeu as perguntas com uma convico, que no
Se o possessivo no vier seguido de substantivo explcito deixou dvida em ningum.
obrigatria a ocorrncia do artigo. d) ( ) No vamos discutir uma deciso qualquer, mas a deci-
so que desencadeou todos esses acontecimentos.
Exemplo: Aplaudiram a tua deciso e no a minha. e) ( ) Tomemos ao acaso um objeto do mundo fsico e obser-
vemos a sua forma.
5) Decises as mais oportunas / as mais oportunas deci- f) ( ) Durante uns cinco dias frequentou minha casa, depois
ses. desapareceu.

No superlativo relativo, no se usa o artigo antes e depois 3) Procure e assinale a nica alternativa em que h erro,
do substantivo. quanto ao emprego do artigo.

Exemplos: Tomou decises as mais oportunas. a) Nem todas as opinies so valiosas.


Tomou as decises mais oportunas. b) Disse-me que conhece todo o Brasil.
c) Leu todos os dez romances do escritor.
errado: Tomou as decises as mais oportunas. d) Andou por todo Portugal.
e) Todas cinco, menos uma, esto corretas.
6) Faz uns dez anos.
4) Em todas as alternativas abaixo, h artigos definidos ou
O artigo indefinido, posto antes de um numeral, designa indefinidos, exceto em:
quantidade aproximada.
a) Ele passou uns dez dias na fazenda.
Exemplo: Faz uns dez anos que sa de l. b) Em certos momentos, vejo-me pensando em ti.
c) Viajarei terra de meus avs.
7) Em um / num. d) Votarei num deputado que seja honesto e trabalhador.

Exemplos:
RESPOSTAS
Estava em uma cidade grande. 1) a) no, ; b) os, ; c) os; d) ; e) os; f)
ou 2) a) 5; b) 4; c) 3; d) 1; e) 2; f) 6
Estava numa cidade grande. 3) A 4) B

Os artigos definidos e indefinidos contraem-se com pre-


posies: de + o = do, de + a = da, etc.

24
Lngua Portuguesa
NUMERAL EMPREGO DOS NUMERAIS

Numeral uma palavra que exprime nmero de ordem, 1) Na designao de papas, reis, sculos, captulos, tomos
mltiplo ou frao. ou partes de obras, usam-se os ordinais para a srie de 1 a
10; da em diante, usam-se os cardinais, desde que o nume-
CLASSIFICAO DO NUMERAL ral venha depois do substantivo.

De acordo com o que indica, o numeral pode ser classifi- Exemplos: D. Pedro II (segundo),
cado em: Lus XV (quinze),
D. Joo VI (sexto),
a) cardinal: indica quantidade exata de seres: um, dois, trs, Joo XXIII (vinte e trs),
quatro, cinco . . . Pio X (dcimo),
Captulo XX (vinte).
b) ordinal: indica a ordem dos seres numa determinada
srie: primeiro, segundo, terceiro, quarto, quinto ... 2) Quando o substantivo vier depois do numeral, usam-se
sempre os ordinais.
c) multiplicativo: indica uma quantidade multiplicada do
mesmo ser: dobro, triplo, qudruplo, quntuplo ... Exemplos: primeira parte, dcimo quinto captulo, vigsimo
sculo.
d) fracionrio: indica em quantas partes a quantidade foi
dividida: meio, tero, quarto, quinto. . . 3) Na numerao de artigos, leis, decretos, portarias e outros
textos legais, usa-se o ordinal at 9 e da em diante o cardi-
QUADRO DOS NUMERAIS nal.

cardinais ordinais multipli- fracionrios Exemplos: artigo 1 (primeiro), artigo 12 (doze).


cativos
um primeiro - - 4) Aos numerais que designam um conjunto determinado de
dois segundo dobro meio seres d-se o nome de numerais coletivos.
trs terceiro triplo tero
quatro quarto qudruplo quarto
cinco quinto quntuplo quinto Exemplos: dzia, centena.
seis sexto sxtuplo sexto
sete stimo stuplo stimo 5) A leitura e escrita por extenso dos cardinais compostos
oito oitavo ctuplo oitavo deve ser feita da seguinte forma:
nove nono nnuplo nono
dez dcimo dcuplo dcimo a) Se houver dois ou trs algarismos, coloca-se a conjuno
onze dcimo primeiro undcuplo onze avos e entre eles.
doze dcimo segundo duodcu- doze avos
treze dcimo terceiro plo treze avos
catorze ou dcimo quarto - catorze avos Exemplos: 94 = noventa e quatro
quatorze - 743 = setecentos e quarenta e trs.
quinze dcimo quinto - quinze avos
dezesseis dcimo sexto - dezesseis avos b) Se houver quatro algarismos, omite-se a conjuno e entre
dezessete dcimo stimo - dezessete avos o primeiro algarismo e os demais (isto , entre o milhar e a
dezoito dcimo oitavo - dezoito avos centena).
dezenove dcimo nono - dezenove avos
vinte vigsimo - vinte avos
Exemplo: 2438 = dois mil quatrocentos e trinta e oito.
trinta trigsimo - trinta avos
quarenta quadragsimo - quarenta avos
cinquenta quinquagsimo - cinquenta avos Obs.: se a centena comear por zero, o emprego do e
sessenta sexagsimo - sessenta avos obrigatrio.
setenta septuagsimo - setenta avos
oitenta octogsimo - oitenta avos Exemplo: 5062 = cinco mil e sessenta e dois.
noventa nonagsimo - noventa avos
cem centsimo cntuplo centsimo Ser tambm obrigatrio o emprego do e se a centena
duzentos ducentsimo - ducentsimo
trezentos trecentsimo - trecentsimo
terminar por zeros.
quatrocen- quadringentsimo - quadringentsimo
tos - Exemplo: 2300 = dois mil e trezentos.
quinhentos quingentsimo - quingentsimo
seiscentos sexcentsimo ou - sexcentsimo c) Se houver vrios grupos de trs algarismos, omite-se o e
seiscentsimo entre cada um dos grupos.
setecentos septingentsimo - septingentsimo
ou setingentsimo - Exemplo: 5 450 126 230 = cinco bilhes quatrocentos e cin-
oitocentos octingentsimo - octingentsimo
quenta milhes, cento e vinte e seis mil duzentos e trinta.
novecentos nongentsimo ou nongentsimo
noningentsimo -
mil milsimo - milsimo 6) Formas variantes:
milho milionsimo milionsimo
bilho bilionsimo bilionsimo Alguns numerais admitem formas variantes como catorze
/ quatorze, bilho / bilio.

Nota: As formas cincoenta (50) e hum (1) so erradas.

25
Lngua Portuguesa
EXERCCIOS PRONOMES

1) O ordinal trecentsimo septuagsimo corresponde a: Pronomes so palavras que substituem os substantivos


ou os determinam, indicando a pessoa do discurso.
a) 37 b) 360 c) 370
A interpretao de um pronome depende de suas rela-
2) O ordinal nongentsimo quinquagsimo corresponde a: es textuais. De acordo com essas funes de representar,
retomar ou anunciar, o pronome pode ser:
a) 95 b) 950 c) 9050
a) pronome substantivo:
3) O ordinal quingentsimo octogsimo corresponde a:
quando identifica a pessoa gramatical;
a) 58 b) 580 c) 588 quando retoma um substantivo a que j se fez referncia
no contexto lingustico ou antecipa termos a que se far ainda
4) O ordinal quadragsimo oitavo corresponde a: referncia.

a) 480 b) 448 c) 48 As duas funes podem ocorrer ao mesmo tempo.

5) Em todas as frases abaixo, os numerais foram corretamen- )LTXHL PXLWR WHPSR VHP VDEHU TXH HX WLQKD PmH H TXH
te empregados, exceto em: HODHVWDYDPXLWRWHPSRSHUWRGHPLPGL]6DOO\

a) O artigo vinte e cinco deste cdigo foi revogado. No trecho acima, eu remete a Sally, a autora do enuncia-
b) Seu depoimento foi transcrito na pgina duzentos e vinte e do; ela representa ao substantivo me, anteriormente ex-
dois. presso.
c) Ainda no li o capitulo stimo desta obra.
d) Este terremoto ocorreu no sculo dez antes de Cristo. b) pronome adjetivo: quando acompanha um substantivo
explcito no texto. Funciona como um adjetivo, embora no
6) Em todas as frases abaixo, a palavra grifada um nume- atribua qualidade ao ser designado pelo substantivo.
ral, exceto em:
Aquela fazenda fica to longe daqui...
a) Ele s leu um livro este semestre.
b) No preciso mais que uma pessoa para fazer este servi- O pronome destacado um pronome adjetivo, j que
o. acompanha um substantivo.
c) Ontem tarde, um rapaz procurou por voc.
d) Voc quer uma ou mais caixas deste produto? CLASSIFICAO E EMPREGO DOS PRONOMES

7) Assinale os itens em que a correspondncia cardinal / PRONOMES PESSOAIS


ordinal est incorreta; em seguida, faa a devida correo.
So palavras que substituem os substantivos e represen-
a) 907 = nongentsimo stimo tam as pessoas do discurso.
b) 650 = seiscentsimo quingentsimo x As pessoas do discurso so trs:
c) 84 = octingentsimo quadragsimo 1 pessoa a que fala: eu, ns
d) 321 = trigsimo vigsimo primeiro 2 pessoa - a com quem se fala: tu, vs
e) 750 = setingentsimo quinquagsimo 3 pessoa a de que se fala: ele, ela, eles, elas

8) Assinale a incorreta quanto aos numerais empregados: x Os pronomes pessoais se dividem em retos e obl-
quos.
a) Voc deve ler o pargrafo segundo.
b) D. Pedro primeiro foi o prncipe regente. Os pronomes retos funcionam, em regra, como sujeito da
c) Releia o artigo dcimo terceiro. orao, e os oblquos, como objetos ou complementos.
d) Cludia encenar o captulo quinto. Exemplos:

9) Aponte a alternativa correta: sujeito objeto verbo


a) 637 seiscentos e trinta e sete Eu te convido.
b) 981 nonagsimo octingentsimo primeiro Ela me chamou.
c) 123 centsimo ducentsimo terceiro
d) 444 quadringentsimo quadragsimo quarto
Quadro dos pronomes pessoais singular e plural
10) As palavras quntuplo e quinto so respectivamente:
a) ambos multiplicativos pessoas do
b) multiplicativo e fracionrio discurso retos oblquos
c) ambos fracionrios
1 pessoa eu me, mim, comigo
d) fracionrio e multiplicativo 2 pessoa tu te, ti, contigo
3 pessoa ele / ela o, a, lhe, se, si, consigo
RESPOSTAS
1-C 2-B 3-B 4-C 5-D 6-C 1 pessoa ns nos, conosco
7 b) seiscentsimo quinquagsimo 2 pessoa vs vos, convosco
c) octogsimo quarto 3 pessoa eles / elas os, as, lhes, se, si, consi-
d) trecentsimo vigsimo primeiro go
8-C 9-D 10 - B

26
Lngua Portuguesa
x Quanto acentuao, os pronomes oblquos monossi- x Os possessivos devem ser usados com critrio. Subs-
lbicos dividem-se em: titu-los pelos pronomes oblquos comunica frase
desenvoltura e elegncia
a) tnicos: mim, ti, si
b) tonos: me, te, se, lhe, lhes, o, a, os, as, nos, vos O vento vindo do mar acariciava-lhe os cabelos.

x Associados a verbos terminados em r, -s ou z e x Alm da ideia de posse, podem ainda os possessivos


palavra eis, os pronomes o, a, os, as assumem anti- exprimir:
gas formas lo, la, los, las, caindo aquelas consoan-
tes. Exemplos: 1) clculo aproximado, estimativa:

Mandaram prend-lo. Ele poder ter seus quarenta e cinco anos.


Ei-lo aqui!
2) familiaridade ou ironia, aludindo-se personagem de uma
Associados a verbos terminados em ditongo nasal (-am, - histria:
em, -o, -e), os ditos pronomes tomam a forma no, na, nos,
nas: O nosso homem no se deu por vencido.

Trazem-no. 3) o mesmo que os indefinidos certo, algum:


Do-nos de graa.
Cornlio, como sabemos, teve suas horas amargas.
x Pronomes oblquos reflexivos so os que se referem
ao sujeito da orao, sendo da mesma pessoa que 4) afetividade, cortesia:
este. Exemplos:
Como vai, meu menino?
Alexandre s pensa em si.
Eu me machuquei na escada. x No plural se usam os possessivos substantivados no
sentido de parentes, famlia:
Com exceo de o, a, os, as, lhe, lhes, os demais prono-
mes oblquos podem ser reflexivos. assim que um moo deve zelar o nome dos seus?

x Os pronomes migo, tigo, sigo, nosco, vosco, do portu- Podem os possessivos serem modificados por um advr-
gus antigo, se combinaram com a preposio com, bio de intensidade:
dando as formas atuais: comigo, contigo, conosco,
convosco. Levaria a mo ao colar de prolas, com aquele gesto to
seu, quando no sabia o que dizer.
PRONOMES POSSESSIVOS
x Quando desnecessrios, omitem-se os pronomes
Os pronomes possessivos referem-se s pessoas do possessivos, principalmente antes de nomes de par-
discurso, atribuindo-lhes a posse de alguma coisa. Por e- tes do corpo:
xemplo, na frase:
Estendi o brao para apanhar a flor.
Meu palet azul-marinho.
PRONOMES DEMONSTRATIVOS
A palavra meu informa que o palet pertence 1 pessoa
(eu). Meu, portanto, um pronome possessivo. Pronomes demonstrativos so os que indicam o lugar, a
posio ou a identidade dos seres, relativamente s pessoas
Quadro dos pronomes possessivos do discurso. Exemplos:

pronomes possessivos Situao no espao

1 pessoa meu, minha, meus minhas Vou fechar esta porta.


singular 2 pessoa teu, tua, teus, tuas (A porta est perto do falante.)
3 pessoa seu, sua, seus, suas
1 pessoa nosso, nossa, nossos, nossas Por favor, feche essa porta!
plural 2 pessoa vosso, vossa, vossos, vossas (A porta est perto do ouvinte.)
3 pessoa seu, sua, seus, suas
Quem poderia fechar aquela porta?
Emprego (A porta est afastada do falante e dos ouvintes.)

x Os possessivos seu(s), sua(s) tanto podem referir-se Situao no tempo


3 pessoa (seu pai = o pai dele), como 2 pessoa, do
discurso (seu pai = o pai de voc). Neste momento, todos os bares esto repletos.
(tempo presente em relao ao falante.)
Por isso toda vez que os ditos possessivos derem mar-
gem ambiguidade, devem ser substitudos pelas expres- Essa noite eu o procurei e contei a verdade.
ses dele(s), dela(s). (tempo passado pouco distante em relao ao falante.)

Voc sabe bem que eu no sigo a opinio dele. Naquele tempo ainda no havia microcomputadores.
(tempo distante em relao ao falante.)

27
Lngua Portuguesa
Situao no contexto lingustico Ter sede e no poder beber, isso que atroz!

- O Sr. casado h 69 anos. Como essa experincia? 4 O pronome demonstrativo neutro o pode representar um
(a experincia de ser casado h 69 anos) termo ou contedo de uma orao inteira, caso em que apa-
rece geralmente, como objeto direto, predicativo ou aposto.
O pronome situa a palavra no contexto lingustico, ou Exemplos:
seja, retoma uma informao previamente fornecida.
Ia dizer-lhe umas palavras duras, mas no o fiz.
No caso seguinte, diferente dos anteriores, o pronome Quiseram gratificar-me, o que me deixou constrangido.
introduz um elemento novo no enunciado: 1LQJXpPWHYHFRUDJHPGHIDODUDQWHVTXHHODRIL]HVVH
(Jos Conde)
Creio que o grande desafio justamente este, tornar feliz
a infncia. (UDXPDEHODSRQWHHOHSUySULRRUHFRQKHFLD
(Anbal Machado)
Neste caso, o pronome antecede a nova informao.
(UDPHXRXQLYHUVRPDVDLWULVWHQmRRHUDGHJUDoD
Quadro dos pronomes demonstrativos (Machado de Assis)

pronomes demonstrativos 6HODJRDH[LVWLXSRXFDFRLVDRLQGLFD


(Carlos Povina Cavalcanti)
1 pessoa este, esta, estes, estas, isto
2 pessoa esse, essa, esses, essas, isso 'LUiVTXHVRXDPELFLRVR"6RXERGHYHUDVPDV
(Machado de Assis)
3 pessoa aquele, aquela, aqueles, aquelas, aquilo
2MDQWDULDVHUXPGHVDVWUH7RGRVRSUHVVHQWLDP
Emprego dos pronomes demonstrativos (Fernando Namora)

1 De modo geral, os demonstrativos este(s), esta(s), isto Para evitar a repetio de um verbo anteriormente ex-
se aplicam a pessoas ou coisas que se acham perto da pes- presso, comum empregar-se, em tais casos, o verbo fazer,
soa que fala ou lhe dizem respeito; ao passo que esse(s), chamado, ento, verbo vicrio (= que substitui, que faz as
essa(s), isso aludem a coisas que ficam prximas da pessoa vezes de). Exemplos:
com quem se fala ou a ela se referem.
Ia dizer-lhe umas palavras duras, mas no o fiz.
Exemplos: Ele ajudava os pobres e o fazia sem alarde.
2MRUQDOLQIRUPDHRID]FRUUHWDPHQWHDILUPDYDYLWRULRVR
Leve este livro para voc. RHGLWRULDO -RUJH$PDGR
Esta a minha opinio.
No sei onde andas com essa cabea. 5 Em frases como a seguinte, este refere-se pessoa
3UD[LQRD HVVH WHX YHVWLGRGH SUHJDV WH YDLPXLWR EHP mencionada em ltimo lugar, aquele mencionada em pri-
(Ceclia Meireles) meiro lugar:

Isto (que eu tenho) o que h de melhor. 2 UHIHULGR DGYRJDGR H R 'U 7DQFUHGR/RSHV HUDPDPi-
Isso (que dizes) no me parece certo. JRV tQWLPRV DTXHOH FDVDGR  VROWHLUR HVWH 9DOHQWLP 0DJa-
&DPSDQKDV GH YDFLQDomR VHPSUH SURYRFDUDP UHVLVWrn- lhes)
FLDPDVLVVRHUDDQWLJDPHQWH
(Joo Ubaldo Ribeiro) PRONOMES RELATIVOS

2 Usa-se nisto adverbialmente, como sinnimo de nesse Pronomes relativos so palavras que representam subs-
momento, nesse entretempo. tantivos j referidos, com os quais esto relacionadas. Da
denominarmos relativos.
1LVWRGHXXPYHQWRHXPDIROKDFDLX 0RQWeiro Lobato)
Antecedente
No raro os demonstrativos aparecem na frase, em cons-
trues redundantes, com finalidade expressiva, para salien- O termo j referido anteriormente, retomado na nova
tar algum termo anterior: orao pelo pronome relativo, chama-se antecedente.

%HUQDUGLQD HVVD p TXH GHUD HP FKHLR FDVDQGR FRP R As mos que dizem adeus so pssaros...
0DQXHOGD9HQWRVD (Mrio Quintana)
(Alexandre Herculano) (mos =antecedente)
(que = pronome relativo)
$HVWUDGDGRPDUODUJDHRVFLODQWHHVVDVLPRWHQWDYD
(Jorge Amado) O antecedente pode estar expresso ou no na orao.

2UDRSRYRHVVHRTXHSUHFLVDpVDEHUTXHH[LVWH'HXV 1. Antecedente expresso


(Camilo Castelo Branco)
O pssaro legendrio uirapuru, que imita todos os demais,
Subindo pelo Vale do Itaja, alcanamos Brusque e, de- canta para aqueles que amam as aves e a sua msica.
pois, Blumenau, cidades essas que nos impressionaram pela (Luiz Carlos Lisboa)
sua avanada indstria fabril.

28
Lngua Portuguesa
Os italianos dirigem-se principalmente para o Sul da pro- 5 O relativo o qual (e suas flexes), principalmente
vncia, onde se dedicam lavoura de subsistncia e vitivini- quando regido de preposio, pode substituir o pronome que:
cultura. (Almanaque Abril)
um passado extinto e de que (ou do qual) ningum se
uma velha mesa esta sobre a qual bato hoje a minha lembra.
crnica. (Vincius de Moraes) Por amor da clareza usa-se o qual em vez de que, quan-
do este vier distanciado de seu antecedente, ensejando fal-
2. Antecedente no expresso sos sentidos:
Regressando de Ouro Preto, visitei o stio de minha tia, o
Quem no tem co, caa com gato. qual me deixou encantado.
Onde eu nasci passa um rio.
6 As preposies ante, aps, at, desde, durante, entre,
Quadro dos pronomes relativos perante, mediante, segundo (vale dizer, preposies com
duas ou mais slabas), bem como as monosslabas sem e
pronomes relativos sob e todas as locues prepositivas, constroem-se com o
variveis invariveis pronome, o qual e nunca com o pronome relativo que. As
preposies contra, para e sobre usam-se, de preferncia,
o qual, os quais, a qual, as quais que com o pronome o qual. Exemplos:
cujo, cujos, cuja, cujas quem
quanto, quantos, quanta, quantas onde
Perguntei-lhe quantos eram os temas sobre os quais ele
devia falar.
Emprego dos pronomes relativos
7HYHHQWmRLQtFLRXPEUHYHFHULPRQLDOFRQWiELOGXUDQWHR
1 O antecedente do pronome relativo que pode ser TXDOVyVHRXYLDRUXtGRGDSHQDDUUDQKDQGRRSDSHO
nome de coisa ou de pessoa, ou o demonstrativo o, ou outro (Herberto Sales)
pronome. Exemplos:
(/XtVDHVWDULDSUHVHQWH a ltima testemunha perante a
H coisas que aprendemos tarde. TXDOHOHVHULDLQYLVtYHODRYH[DPH
(Fernando Namora)
9L-a falar com desdm, e um pouco de indignao, da
PXOKHUGHTXHVHWUDWDYDDOLiVVXDDPLJD As preposies monossilbicas a, com, de, em e por,
(Machado de Assis) quando iniciam oraes adjetivas restritivas, empregam-se,
de preferncia, com o pronome que:
%HQGLWRRTXHQDWHUUDR IRJRIH]HRWHWR
(Olavo Bilac) A moa [a que me refiro] no desta cidade.
No encontrei os livros [de que precisava].
O relativo que s vezes equivale a o que, coisa que, e se
refere a uma orao: PRONOME INDEFINIDO
1mR FKHJRX D VHU SDGUH PDV QmR GHL[RX GH VHU SRHWD Os pronomes indefinidos so os que se referem terceira
que HUDDVXDYRFDomRQDWXUDO 0DFKDGRGH$VVLV pessoa do discurso, de modo vago ou impreciso.
2 Numa srie de oraes adjetivas coordenadas, pode Algum arrematou a obra de Portinari no leilo.
ocorrer a elipse do relativo que: Todos cumpriram seu dever cvico.
$VDODHVWDYDFKHLDGHJHQWHTXHFRQYHUVDYDULDIXPa- Quadro dos pronomes indefinidos
YD /~FLRGH0HQGRQoD
pronomes indefinidos
variveis invariveis
3 O relativo quem sempre regido de preposio e, na
algum, alguma, alguns, algumas algo
lngua moderna, se refere exclusivamente a pessoas ou coi- nenhum, nenhuma, nenhuns, nenhumas algum
sas personificadas: todo, toda, todos, todas nada
muito, muita, muitos, muitas ningum
O funcionrio por quem fui atendido mostrou-se gentil. pouco, pouca, poucos, poucas tudo
certo, certa, certos, certas cada
Ao encontro malsoante sem quem deve-se preferir sem o outro, outra, outros, outras outrem
qual: quanto, quanta, quantos, quantas quem
Estvamos esperando Otvio, sem o qual no podamos tanto, tanta, tantos, tantas mais
vrio, vria, vrios, vrias menos
sair. diverso, diversa, diversos, diversas demais
qualquer, quaisquer
4 Cujo (e suas flexes) pronome adjetivo e equivale a
do qual, da qual, dos quais, das quais: Locues pronominais indefinidas
O cavalo um animal cujo pelo liso. (= o pelo do qual cada um / cada uma / cada qual
liso) quem quer que / quantos quer que
toda aquela que / todo aquele que
O substantivo determinado por este pronome no vir seja quem for / seja qual for
precedido de artigo: cujo pelo (e no cujo o pelo). qualquer um / qualquer um
um ou outro / uma ou outra
tal e tal / tal qual / tal e qual / tal ou qual

29
Lngua Portuguesa
Emprego dos pronomes indefinidos Usa-se como advrbio, no sentido de completamente,
mas geralmente flexionando-se em gnero e nmero:
1) algum
Os ips estavam todos floridos.
Anteposto ao substantivo, tem significao positiva; pro- A roupa estava toda molhada.
posto, apresenta valor negativo:
10) tudo
Algum amigo os traiu. (= um amigo)
Amigo algum os traiu. (=nenhum amigo) Pode-se dizer, indiferentemente, tudo que ou tudo o que:

2) cada Esquea tudo que ficou atrs.


Esquea tudo o que ficou atrs.
Pode apresentar-se na frase com valor:
PRONOMES INTERROGATIVOS
a) distributivo: Cada livro custou dez dlares!
b) Intensivo: L na cidade tem cada moa bonita! Os pronomes interrogativos so os pronomes indefinidos
usados na formulao de perguntas diretas ou indiretas.
3) demais
Que pas este?
Significa os outros, os restantes: Quem vem l?
Dos quadros que fiz s tenho dois: os demais eu vendi. Quero saber quem vem l

4) menos, mais Quadro dos pronomes interrogativos

Menos invarivel: pronomes interrogativos


preciso gastar menos gua. que qual e quais
Mais significa muitos, uma infinidade, em frases como: quem quanto, quantos, quanta, quantas
Os ndios avanavam, atirando flechas e mais flechas.
Emprego dos pronomes interrogativos
5) nenhum
1) que
Proposto ao substantivo, aviva a negao:
6HX,YRQmRPRUDHPSDUWHQHQKXPD
pronome substantivo quando equivaler a que coisa.
(Graciliano Ramos)
Nesse caso, admite tambm a forma o que.
6) certo
Mas que significa isso? perguntou o moo insatisfeito...
(Carlos Drummond de Andrade)
Antepe-se ao substantivo, podendo, em alguns casos, vir
precedido do artigo um:
2) quem
Tinha certo ar de superioridade.
pronome substantivo e refere-se a pessoas.
Chegamos ao stio de um certo Eufrsio.
- Quem sou eu? ele perguntou num ltimo esforo.
(Otto Lara Resende)
7) qual
3) qual
Como pronome indefinido, tem o sentido de cada qual:
Pode ser pronome adjetivo ou substantivo:
(PVHJXLGDGHVFHUDPHMiQmRHUDPGRLVPDVVLPGH]
meninos, qual mais fagueiro, e todos diziam que iam acabar
- Quais so os smbolos da ptria? (pronome adjetivo)
FRPDUDWD]DQD /XtV+HQULTXH7DYDUHV
- Leve esses livros daqui!! Agora!
- Quais? (pronome substantivo)
8) qualquer
4) quanto
O plural deste pronome quaisquer:
Pode ser pronome substantivo ou pronome adjetivo:
Executamos quaisquer servios.
Perguntei quanto era. (pronome substantivo)
Pode apresentar-se com sentido depreciativo:
- Quanto tempo faz que a gente no se encontra? (pro-
nome adjetivo)
$LQWHQomRGHOHpPRVWUDUTXHQmRpFULDGRGHTXDOTXHU
(Machado de Assis)
5) cad?
9) todo
A expresso que feito de, reduzida para que de, deu
origem aos interrogativos cad, quede e qued, bastante
Modernamente, costuma-se distinguir todo (= cada, qual-
utilizados na linguagem coloquial e j incorporados pela lite-
quer) e todo o (= inteiro, completo):
ratura.
Li todo o livro. (= o livro todo ou inteiro)
E cad doutor? Cad remdio? Cad jeito?
Li todo livro que encontrasse. (= cada ou qualquer livro)
(Monteiro Lobato)

30
Lngua Portuguesa
Qued o meu dinheiro? Apesar de ser considerado pela NGB como pronome de
(O que feito do meu dinheiro?) tratamento, voc enquadra-se mais apropriadamente na
categoria de pronome pessoal, visto que substitui tu em qua-
FORMAS DE TRATAMENTO se todo o territrio brasileiro.
Deve-se notar ainda o emprego de voc como pronome
Entre os pronomes pessoais incluem-se os pronomes de que indetermina o sujeito:
tratamento, que so palavras ou expresses utilizadas para
as pessoas com quem se fala. So, portanto, pronomes de 2 Mas o que voc pode fazer contra as foras da natureza?
pessoa, embora sejam empregados com verbo na 3 pessoa.
A norma culta da lngua condena esse emprego do termo,
Esses pronomes, que aparecem apenas na linguagem preferindo a impessoalizao com o pronome se:
formal, expressam uma atitude cerimoniosa do emissor em
relao ao interlocutor ou pessoa de quem se fala. O que se pode fazer contra as foras da natureza?

Vossa Alteza precisa descansar.


$H[SUHVVmRDJHQWH
Quando se referir 3 pessoa, o pronome de tratamento
precedido de sua: Na linguagem coloquial, o pronome ns frequentemente
substitudo por a gente.
Sua Alteza retornar em Breve.
Um segurana nos xingou e queria nos agredir para que a
gente sasse da estao.
Quadro dos pronomes de tratamento
A expresso pode ainda apresentar valor impessoal,
abreviatura indeterminado:
pronomes de
tratamento singular plural
Eu sabia os riscos que estava correndo. A gente sempre
Voc v. v v. pensa: comigo no YDLDFRQWHFHU$tDFRQWHFHXGL]
Usado para pessoas familiares, ntimas. (a gente pensa = pensa-se)
a as
Senhor, Senhora Sr., Sr. Srs., Sr. A norma culta da lngua tende a rejeitar essas constru-
Usados para manter uma distncia respeitosa. es, comuns na fala coloquial.
a as
Vossa Senhoria V.S. V.S.
Senhor, senhora, senhorita
Usado para correspondncias comerciais.
a as
Vossa Excelncia V.Ex. V.Ex. Os pronomes senhor, senhora e senhorita so largamente
Usado para altas autoridades: presidente, etc. utilizados no Brasil como forma de respeito e cortesia.
a as
Vossa Eminncia V.Em. V.Em. EXERCCIOS
Usado para cardeais.
Vossa Alteza V.A. V V.A A. 1 Identifique a alternativa em que todas as palavras desta-
cadas so pronomes:
Usado para prncipes e duques
Vossa Santidade V.S. - a) Um s aluno nos prestou nenhuma colaborao.
b) Quem a ajudar a alcanar todo o sucesso?
Usado para o Papa
ma mas
c) Aquele ao qual se entregou o prmio ficou muito feliz.
Vossa Reverendssima V.Rev. V.Rev. d) Todos os que ajudam so nossos amigos.
Usado para sacerdotes e religiosos em geral.
a as 2 Assinale a alternativa que completa, corretamente, a
Vossa Magnificncia V.Mag. V.Mag.
frase:
Usado para reitores de universidades.
Vossa Majestade V.M. V V.M M. Era para _______ falar _______ ontem, mas no _______
localizei em parte alguma.
Usado para reis e rainhas.
a) mim comigo o
O pronome voc b) eu com ele o
c) eu com ele lhe
O pronome voc perdeu seu carter de tratamento ceri- d) mim consigo lhe
monioso sendo hoje, no Brasil, utilizado em situaes infor-
mais, substituindo o pronome de segunda pessoa tu. 3 Assinale a alternativa em que o pronome destacado foi
empregado corretamente:
Voc sempre foi resistente ideia de gravar discos. O que
o fez mudar de ideia? a) Aguarde um instante. Quero falar consigo.
b) lamentvel, mas isso sempre ocorre com ns dois.
Como se v pelo exemplo, voc faz referncia segunda c) O processo est a para mim examinar.
pessoa, mas exige verbo na terceira. d) Vossa Senhoria preocupa-se com problemas cuja solu-
o foge a vossa alada.
Este pronome resulta das transformaes fonticas pelas
quais passou o pronome de tratamento Vossa Merc. 4 Identifique a srie de pronomes que completa adequada-
mente as lacunas do seguinte perodo:

31
Lngua Portuguesa
Os desentendimentos entre ______ e _____ advm de uma ADVRBIO
insegurana que a vida estabeleceu para _______traar um
caminho que vai de _______ a ______ . uma palavra que modifica (que se refere) a um verbo, a
a) eu tu eu mim tu adjetivo, a um outro advrbio.
b) mim ti mim mim tu
c) mim ti - eu mim ti A maioria dos advrbios modifica o verbo, ao qual acres-
d) eu ti mim mim tu centa uma circunstncia. S os de intensidade que podem
tambm modificar adjetivos e advrbios.
5 Considere os enunciados a seguir:
Mora muito longe
I. O senhor no deixe de comparecer. Precisamos do seu (modifica o advrbio longe).
apoio.
II. Voc quer que te digamos a verdade? Sairei cedo para alcanar os excursionistas
III. Vossa Excelncia conseguiu realizar todos os vossos (modifica o verbo sairei).
intentos?
IV. Vossa Majestade no deve preocupar-se unicamente com Eram exerccios bem difceis
os problemas dos seus auxiliares diretos. (modifica o adjetivo difceis).

Verifica-se que h falta de uniformidade no emprego das


pessoas gramaticais nos enunciados: CLASSIFICAO DOS ADVRBIOS

a) II e IV 1) De Afirmao: sim, certamente, deveras, realmente,


b) III e IV incontestavelmente, efetivamente.
c) I e IV
d) II e III 2) De Dvida: talvez, qui, acaso, porventura, provavel-
mente, decerto, certo.
6 Assinale a alternativa correta quanto ao emprego do pro-
nome relativo: 3) De Intensidade: muito, mui, pouco, assaz, bastante,
mais, menos, to, demasiado, meio, todo, completamente,
a) um homem em cuja honestidade se pode confiar. profundamente, demasiadamente, excessivamente, demais,
b) Machado de Assis foi um escritor que as obras ficaram nada, ligeiramente, levemente, quo, quanto, bem, mas,
clebres. quase, apenas, como.
c) Comprou uma casa suntuosa, cuja casa lhe custou uma
fortuna. 4) De Lugar: abaixo, acima, acol, c, l, aqui, ali, a, alm,
d) Preciso de um pincel delicado, sem o cujo no poderei algures, aqum, alhures, nenhures, atrs, fora, afora, dentro,
assinar minha obra. longe, adiante, diante, onde, avante, atravs, defronte, aon-
de, donde, detrs.
7 - 3RUIDYRUHPSUHVWH-me .......... lpis que est a perto de
voc. .......... aqui est com a ponta quebrada para .......... 5) De Modo: bem, mal, assim, depressa, devagar, como,
ID]HURH[HUFtFLR adrede, debalde, melhor, pior, alis, calmamente, livremente,
e quase todos os advrbios terminados em "mente".
a) este; Esse; mim
b) este; Esse; eu 6) De Negao: no, absolutamente.
c) esse; Este; eu
d) esse; Este; mim 7) De Tempo: agora, hoje, amanh, depois, ontem, anteon-
tem, j, sempre, nunca, jamais, ainda, logo, antes, cedo,
8 - Assinale o item em que h erro no emprego do pronome tarde, ora, afinal, outrora, ento, breve, a, entrementes, bre-
demonstrativo: vemente, imediatamente, raramente, finalmente, comumente,
a) Paulo, que isso que voc leva? presentemente, etc.
b) $PDL YRVVRVLUPmRVVmR HVVDV DV YHUGDGHLUDV SDOavras
de amor. H ainda advrbios interrogativos: onde? aonde?
c) Trinta de dezembro de 1977! Foi significativo para mim quando? como? por que?: Onde esto eles? Quando sai-
esse dia. ro? Como viajaram? Por que no telefonaram?
d) Pedro, esse livro que est com Jos meu.
e) No estou de acordo com aquelas palavras que Jos pro-
nunciou. LOCUES ADVERBIAIS

9 - Assinale o item em que houve erro no emprego do pro- So duas ou mais palavras com funo de advrbio: s
a
nome de 1 pessoa, pois usou-se a forma oblqua no lugar da tontas, s claras, s pressas, s ocultas, toa, de vez em
reta: quando, de quando em quando, de propsito, s vezes, ao
acaso, ao lu, de repente, de chofre, a olhos vistos, de cor,
a) Vieram at mim rapidamente de improviso, em breve, por atacado, em cima, por trs, para
b) cedo para mim dar a resposta trs, de perto, sem dvida, passo a passo, etc.
c) Para mim ele o maior
d) Ela chegou antes de mim Exemplos:
Ele, s vezes, age s escondidas.
RESPOSTAS O segredo sempre virar direita.
1-D 2-B 3-B tarde ela trabalha no hospital, mas noite ela est em
4-C 5-D 6-A casa.
7-C 8-C 9-B

32
Lngua Portuguesa
FLEXO DOS ADVRBIOS PREPOSIO

Alguns advrbios flexionam-se no comparativo e no su- Preposio a palavra que liga um termo a outro:
perlativo.
Casa de pedra; livro de Paulo; falou com ele.
Grau comparativo:
Dividem-se as preposies em essenciais (as que sempre
de igualdade: to + advrbio + quanto foram preposies) e acidentais (palavras de outras classes
Cheguei to cedo quanto queria. gramaticais que, s vezes, funcionam como preposio).

de superioridade: mais + advrbio + que 1) Preposies Essenciais: a, ante, aps, at, com, de,
Cheguei mais cedo que queria. ds, desde, para, per, perante, por, sem, sob, sobre, trs.

de inferioridade: menos + advrbio + que Exemplos:


Cheguei menos cedo que queria. Fumava cigarro aps cigarro.
Est vestida de branco.
Grau superlativo:
2) Preposies Acidentais: conforme, consoante, segundo,
analtico: durante, mediante, visto, como,exceto, salvo, etc.

Eles estavam muito felizes. Exemplos:


Ele chegou muito cedo. Os heris tiveram como prmio uma coroa de louros.
Vov dormiu durante a viagem.
sinttico:
LOCUES PREPOSITIVAS
Eles estavam felicssimos.
Ele chegou cedssimo. So expresses com a funo das preposies.

EXERCCIOS Em geral so formadas de advrbio (ou locuo adverbial)


+ preposio: abaixo de, acima de, por trs de, em frente de,
1) H dois advrbios em todas as alternativas, exceto na: junto a, perto de, longe de, depois de, antes de, atravs de,
embaixo de, em cima de, em face de, etc.
a) Ela cantava muito bem. Exemplo:
b) Hoje, talvez eu v s compras. Passamos atravs de mata cerrada.
c) Eu no gostei de chegar tarde ao trabalho.
d) Masa muito calma. COMBINAES E CONTRAES
e) O motorista dirige muito devagar.
As preposies a, de, em, per e para, unem-se com
outras palavras, formando um s vocbulo.
2) Assinale a alternativa que contm um advrbio de afirma-
o: H combinao quando a preposio se une sem perda
de fonema; se a preposio sofre queda de fonema, haver
a) Sem dvida, ele um grande pintor. contrao.
b) Ele, provavelmente, sara do emprego.
c) Absolutamente, no entendo nada de espanhol. A preposio combina-se com os artigos, pronomes de-
d) Calmamente, expliquei a situao a ela. monstrativos e com advrbios.
e) Talvez ela venha ao nosso encontro.
As preposies a, de, em, per contraem-se com os arti-
3) Aponte a alternativa que no contm uma locuo adver- gos, e, algumas delas, com certos pronomes e advrbios.
bial:
a+a= de + isto = disto
a) Jos deixou o escritrio s pressas. a + as = s de + aqui = daqui
b) J sei a lio de cor. a + aquele = quele em + esse = nesse
c) Em breve sair o novo cd de Roberto Carlos. a + aquela = quela em + o = no
d) Atualmente, h vrios filmes em cartaz. a + aquilo = quilo em + um = num
e) Assim, ela tornou-se rica e famosa. de + o = do em + aquele = naquele
de + ele = dele per + o = pelo
 1DRUDomR-RDQDWUDEDOKDPXLWRORQJHGHFDVDWHPRVR de + este = deste
grau:
EXERCCIOS
a) comparativo de superioridade
b) superlativo sinttico 1) Assinale a alternativa em que a palavra em destaque
c) superlativo analtico preposio:
d) comparativo de igualdade
e) comparativo de inferioridade a) A professora recolheu as provas antes do horrio.
b) Obriguei-a a estudar mais.
c) Fomos ao cinema, depois levei-as para tomar um lanche.
RESPOSTAS d) A noite estava to bonita!
1-D 2-A 3-D 4-C e) A me brigou com as filhas.

33
Lngua Portuguesa
2) Aponte a alternativa que contm somente preposies INTERJEIO
acidentais:
Interjeio a palavra que exprime um estado emotivo.
a) afora, contra, perante, sobre As interjeies so um recurso da linguagem afetiva e emo-
b) desde, segundo, afora, mediante cional. Podem exprimir e registrar os mais variados sentimen-
c) exceto, salvo, mediante, visto tos.
d) durante, desde, entre, segundo Classificam-se em:
e) trs, com, contra, perante
1) de dor: ai! ui! ai de mim! 7) de apelo: ! al! psit! psiu!
3) Nas oraes: 2) de desejo: oxal! tomara! 8) de silncio: psiu! silncio!
3) de alegria: ah! oh! eh! viva! 9) de repetio: bis!
I - Valter foi a Portugal no ano passado. 4) de animao: eia! coragem! 10) de saudao: al! ol!
avante! upa! fora! vamos! salve! bom dia!
II - A sua cano linda! 5) de aplauso: bem! bravo! 11) de advertncia: cuidado!
III - Ele a iludiu com falsas promessas. apoiado! devagar! ateno!
6) de averso: ih! chi! irra! ora 12) de indignao: fora! morra!
temos, respectivamente: bolas!

a) preposio pronome artigo


LOCUO INTERJETIVA
b) pronome preposio artigo
c) artigo artigo preposio
uma expresso formada de mais de uma palavra, com
d) preposio artigo pronome
valor de interjeio: Meu Deus! Muito bem! Ai de mim! Ora
e) artigo preposio pronome
bolas! Valha-me Deus! Quem me dera!
4) Assinale a alternativa cuja lacuna no pode ser preenchida
As interjeies so proferidas em tom de voz especial e,
com a preposio entre parnteses:
dependendo desta circunstncia, a mesma interjeio pode
expressar sentimentos diversos.
a) Grande parte .............. doaes foram desviadas. (de + as)
b) Ele no tem muita sorte ............. amor. (de + o)
EXERCCIOS
c) Ela tomou a criana ............... brao e a levou. (per + o)
d) O prisioneiro foi levado ............... cela. (a + a)
1) Nas oraes:
e) Eu deixei o livro ............... lugar. (em + esse)
I - Espero que ele viva por muitos anos.
II - Viva o meu time!
5) Aponte a alternativa que preenche corretamente as frases
as palavras em destaque so respectivamente:
abaixo:
a) interjeio verbo d) ambas so verbos
I - O filme .......... assistimos era timo.
b) ambos so interjeies e) verbo substantivo
II - O emprego .......... aspiras muito difcil.
c) verbo interjeio
III - A menina .......... gosto a Mariana.
2) Aponte a alternativa incorreta quanto sua classificao:
a) a que, a que, de que
b) que, a que, de que
a) Tomara que voc vena! (desejo)
c) a que, de que, que
b) Basta! No quero ouvir mais nada! (cessao)
d) de que, a que, que
c) Nossa! Quase fui atropelado. (espanto)
e) a que, a que, que
d) Credo! No suporto manga. (alvio)
e) Raios! Mas que demora! (impacincia)
6) Assinale a alternativa que preencha as lacunas da
orao:
3) As interjeies so utilizadas para:
 as ltimas semanas, o movimento caiu ...............
H
a) expressar sentimentos
b) ligar termos de uma orao
a) Mediante - sob
c) dar uma circunstncia ao verbo
b) Durante - aps
d) ligar termos entre si
c) Desde - sob
e) n.d.a.
d) Desde - ante
e) Durante - entre
4) A interjeio oxal indica estado de:
7) Aponte a alternativa que contm somente preposies
a) admirao d) apelo
essenciais:
b) advertncia e) desejo
c) concordncia
a) exceto, segundo, perante, em
b) trs, salvo, de, por
5) Assinale a alternativa que substitua a expresso em des-
c) menos, a, sem, visto
taque:
d) entre, sobre, contra, desde Que desagradvel, l vem voc com essa mesma converVD
e) afora, fora, visto a) Oxal! d) Fora!
b) Boa! e) Salve!
c) Ih!
RESPOSTAS
1-B 2-C 3-D 4-B 5-A 6-E 7-D RESPOSTAS
1-C 2-D 3-A 4-E 5-C

34
Lngua Portuguesa
CONJUNO 3) Concessivas:
embora, conquanto, ainda que, mesmo que, por mais que,
Conjuno a palavra invarivel que liga oraes ou por menos que, se bem que, posto que, nem que, dado que,
termos da orao. sem que, etc.

Exemplos: Exemplo: Foi ao encontro, embora estivesse atrasado.

Comi mas no gostei. 4) Condicionais:


Samos de casa quando amanhecia. se, caso, desde que, salvo se, contanto que, a no ser que, a
menos que, sem que, etc.
As conjunes dividem-se em coordenativas e subordina-
tivas. Exemplo: No irei sem que ela me telefone.

Quando a conjuno liga as oraes sem fazer com que 5) Conformativas:


uma dependa da outra ou sem que a segunda complete o como, conforme, segundo, consoante, etc.
sentido da primeira, ela coordenativa.
Exemplo: Cada um colhe, conforme semeia.
Quando a conjuno liga duas oraes que se completam
uma a outra e faz com que a segunda dependa da primeira, 6) Consecutivas:
ela subordinativa. que (precedido dos termos intensivos tal, to, tanto, tama-
nho), de sorte que, de modo que, de forma que, de maneira
CONJUNES COORDENATIVAS que, sem que, etc.

Podem ser: Exemplo: Era to feio que metia medo nas crianas.

1) Aditivas: do ideia de adio: e, nem, mas tambm, mais 7) Finais:


ainda, seno, tambm, como tambm, bem como. a fim de que, para que, que, porque, etc.

Exemplo: A doena vem a cavalo e volta a p. Exemplo: Enganou-os para que no a enganassem.

2) Adversativas: exprimem mais contraste, oposio, ressal- 8) Proporcionais:


va, compensao: mas, porm, todavia, contudo, entretanto, proporo que, medida que, ao passo que, quanto mais,
seno, ao passo que, no entanto, apesar disso. quanto menos, etc.

Exemplo: Querem ser ricos, mas no trabalham. Exemplo: As criaturas so mais perfeitas proporo que
so mais capazes de amar.
3) Alternativas: exprimem alternativa, alternncia: ou,
ou . . . ou, ora . . . ora, j . . . j, seja . . . seja, quer . . . quer. 9) Temporais:
enquanto, quando, logo que, assim que, depois que, agora
Exemplo: A louca ora o acariciava, ora o renegava freneti- que, antes que, desde que, at que, sempre que, etc.
camente.
Exemplo: Todos se calaram, depois que protestei.
4) Explicativas: exprimem explicao, um motivo: que, por-
que, porquanto, pois. As conjunes explicativas aparecem 10) Integrantes:
normalmente depois de oraes imperativas. que, se.

Exemplo: Venha, porque quero conversar com voc. Exemplo: Sonhei que o mundo havia acabado.

5) Conclusivas: expressam concluso: logo, portanto, por Observao: As conjunes subordinativas integrantes in-
conseguinte, por isso, pois (depois de verbo). troduzem as oraes subordinadas substantivas. As demais
conjunes subordinativas introduzem as oraes subordina-
Exemplo: As rvores balanavam, logo estava ventando. das adverbiais. A classificao das conjunes depender
unicamente da significao que elas derem orao que
introduzem.
CONJUNES SUBORDINATIVAS
LOCUO CONJUNTIVA
Podem ser:
So duas ou mais palavras que tm valor de conjuno.
Geralmente constituda de que precedido de advrbio,
1) Causais:
preposio ou particpio.
porque, que, pois, como, porquanto, visto que, desde que,
etc. visto que j que se bem que
ainda que desde que por mais que
Exemplo: No me interessa a opinio deles, porque todos ali a menos que de modo que por menos que
so imbecis. medida que uma vez que proporo que
no entanto por consequncia posto que
2) Comparativas: ainda quando logo que a fim de que
como, tal qual, assim como, que nem, como quanto, etc.
Exemplo:
Exemplo: Talvez ningum pense como ns pensamos. J que todos saram, desisto do negcio.

35
Lngua Portuguesa
EXERCCIOS VERBO

 1DRUDomRSegundo o jornal noticiou, o ndice de Verbo a palavra varivel em nmero, pessoa, modo,
GHVHPSUHJRDXPHQWDUiWHPRVDFRQMXQomRVXERUGinativa: tempo e voz que indica um processo no tempo, isto , que
algo aconteceu, acontece ou acontecer.
a) consecutiva
Os verbos podem indicar:
b) condicional
c) causal - ao: Sofia sempre viaja a trabalho.
d) temporal - estado: O garoto est feliz.
e) conformativa - fenmeno: Nevou no sul do pas.

  1D RUDomR 1mR FRUUD que p SHULJRVR WHPRV D FRQMXn- FLEXO DO VERBO
o coordenativa:
FLEXO DE PESSOA
a) adversativa
So necessrias trs pessoas:
b) conclusiva
c) aditiva - primeira pessoa: a quem fala (eu e ns).
d) explicativa
e) alternativa - segunda pessoa: com quem se fala (tu e vs).

3) Aponte a alternativa que preenche corretamente a lacuna: - terceira pessoa: de quem ou a respeito do que se fala
(ele / ela eles / elas).
Trata-se de um homem mais inteligente .................. bonito.
FLEXO DE MODO
a) que So as diversas maneiras que um verbo assume para
b) como indicar atitudes da pessoa que fala.
c) logo
d) porque - indicativo: expressa uma atitude real, concreta.
e) e
O jovem mdico socorreu os doentes.
4) Assinale a conjuno que d ideia de causa:
- subjuntivo: indica uma atitude hipottica, duvidosa ou
a) O filho maior que o pai. possvel.
b) Quando ela acordou, eu j havia sado. Talvez eu v ao cinema no domingo.
c) Marcelo no viajou porque no dispunha de dinheiro.
d) Ignoro como ele fez isso. - imperativo: indica uma ordem, um convite, um pedido.
e) Embora descontente, aceitou a proposta.
Pare de fumar!
5) Assinale a alternativa que d ideia de concesso:
FLEXO DE TEMPO
a) Seu choro era to forte que todos podiam ouvi-lo.
b) Foi a Petrpolis a fim de que pudesse rev-la. a propriedade que tem o verbo de localizar o fato no
tempo em que acontece o ocorrido.
c) Se voc no voltar, irei busc-la.
d) Ainda que voc no merea, lhe darei o carro. - presente: a ao ocorre no momento em que se fala.
e) medida que chorava, explicava o que havia acontecido.
Joo estuda e trabalha.
6) A vida transcorre entre o sucesso e o insucesso. impor-
tante, ..............., que o adolescente enfrente adversidades, - pretrito: a ao transcorreu num momento anterior -
fracassos e frustraes para que possa, segundo a cano quele em que se fala.
popular, "sacudir a poeira e dar volta por cima".
A conjuno que introduz uma ideia de concluso : Joo estudava e trabalhava.

- futuro: a ao poder ocorrer aps o momento em que


a) porquanto se fala.
b) porm
c) pois Joo estudar e trabalhar.
d) contudo
e) conquanto O esquema abaixo apresenta os modos e os tempos
verbais simples da lngua portuguesa:
7) Em: ". . . esses merecem perdo ou reparao total?" - o
conectivo ou encerra a ideia de: presente (eu estudo)

perfeito (eu estudei)


a) excluso modo pretrito imperfeito (eu estudava)
b) alternncia indicativo mais-que-perfeito (eu estudara)
c) adio
d) condio futuro do presente (eu estudarei)
e) simultaneidade do pretrito (eu estudaria)

RESPOSTA presente (que eu estude)


modo pretrito imperfeito (se eu estudasse)
1-E 2-D 3-A 4-C 5-D 6-C 7-B subjuntivo futuro (quando/se eu estudar)

36
Lngua Portuguesa
- Futuro: indica a ocorrncia futura de um fato que ainda no
modo presente afirmativo (estuda [tu]) ocorreu no momento da fala.
imperativo negativo (no estudes [tu])
Viajarei Itlia no prximo ms.

FLEXO DE NMERO - Futuro do presente: exprime um fato que ir ocorrer, com


certeza.
Admite singular ou plural, concordando com seu sujeito.
Voc ter um futuro maravilhoso.
O professor corrigiu as provas.
Os professores corrigiram as provas. - Futuro do pretrito: indica um fato que ainda ir se concre-
tizar, relacionado com um fato passado.
FLEXO DE VOZ
Eu compraria um carro se tivesse dinheiro.
Maneira pela qual o verbo se relaciona com o sujeito.
Pode ser:
SUBJUNTIVO
- voz ativa: quando algo ou algum responsvel pela
ao do verbo. - Presente: indica uma ocorrncia que talvez se realize.

A empregada lavou as janelas. necessrio que voc converse com ele.

- voz passiva: quando algo ou algum recebe a ao - Pretrito imperfeito: indica uma ao que talvez tenha
verbal. acontecido.

As janelas foram lavadas pela empregada. Se ele fosse politizado, no votaria naquele farsante.

Observao: a voz passiva pode ser analtica ou sinttica. - Futuro: indica um fato que talvez se concretize no futuro.

analtica: formada com os verbos ser, estar e fi- Se ela fizer o regime, emagrecer rapidamente.
car seguidos de particpio. Quando ele estudar, passar no concurso.

Todos os carros foram roubados.


(particpio) FORMAS NOMINAIS
sinttica: formada com o verbo na terceira pessoa
acompanhado do pronome se. INFINITIVO
Vendem-se casas. O infinitivo tem valor de substantivo.
- voz reflexiva: quando algo ou algum pratica e recebe Estudar um direito de qualquer cidado.
ao mesmo tempo a ao verbal. O estudo um direito de qualquer cidado.
O garoto machucou-se.
PARTICPIO
OS TEMPOS VERBAIS
O particpio pode ter valor de adjetivo. Sofre flexo de
INDICATIVO gnero e nmero, de acordo com o substantivo a que se
refere.
- Presente: indica a ocorrncia de um fato no momento em
que se fala. Calado num canto, ele observava tudo.
As guas atingem um metro, afirma o jornalista.
GERNDIO
tambm usado para indicar ocorrncia frequente de um
fato. O gerndio pode assumir o valor de advrbio ou adjetivo.
Todo dia ela visita seus pais. O atleta cruzou sorrindo a linha de chegada. (advrbio)
Eu vi o menino correndo. (adjetivo)
- Pretrito: indica a ocorrncia de um fato antes do momento
em que se fala.
LOCUO VERBAL
A escola pegou fogo.
So as combinaes verbais que produzem formas com-
- Pretrito perfeito: indica um fato que ocorreu totalmente no postas.
passado.
Eu tenho trabalhado demais.
A famlia inteira chegou em 2008.
Os verbos que se empregam frequentemente como pri-
- Pretrito imperfeito: indica um fato que iniciou no passado meiro elemento dessas combinaes so chamados verbos
e ainda no foi concluda. auxiliares.
Ela vivia chorando. Os mais comuns so ter, haver, ser e estar.
- Pretrito mais-que-perfeito: indica a ocorrncia de um fato
no passado, iniciado antes de outro, tambm no passado.

Mentiu outra vez ao afirmar que falara tudo ao pai. CONJUGAO DOS VERBOS AUXILIARES

37
Lngua Portuguesa
MODO INDICATIVO Futuro simples

for estiver tiver houver


Presente fores estiveres tiveres houveres
for estiver tiver houver
sou estou tenho hei formos estivermos tivermos houvermos
s ests tens hs fordes estiverdes tiverdes houverdes
est tem h forem estiverem tiverem houverem
somos estamos temos havemos
sois estais tendes haveis
so esto tm ho
MODO IMPERATIVO
Pretrito perfeito
Afirmativo
fui estive tive houve
foste estiveste tiveste houveste s (tu) est (tu) tem (tu) h (tu)
foi esteve teve houve seja (voc) esteja (voc) tenha (voc) haja (voc)
fomos estivemos tivemos houvemos sejamos (ns) estejamos tenhamos hajamos
sede (vs) (ns) (ns) (ns)
fostes estivestes tivestes houvestes sejam (vocs) estai (vs) tende (vs) havei (vs)
foram estiveram tiveram houveram estejam tenham (vo- hajam
(vocs) cs) (vocs)
Pretrito imperfeito
Negativo
era estava tinha havia
eras estavas tinhas havias no sejas (tu) no estejas no tenhas no hajas
era estava tinha havia no seja (vo- (tu) (tu) (tu)
ramos estvamos tnhamos havamos c) no esteja no tenha no haja
reis estveis tnheis haveis no sejamos (voc) (voc) (voc)
eram estavam tinham haviam (ns) no esteja- no tenha- no haja-
no sejais mos (ns) mos (ns) mos (ns)
(vs) no estejais no tenhais no hajais
Pretrito mais-que-perfeito no sejam (vs) (vs) (vs)
(vocs) no estejam no tenham no hajam
fora estivera tivera houvera (vocs) (vocs) (vocs)
foras estiveras tiveras houveras
fora estivera tivera houvera
framos estivramos tivramos houvramos FORMAS NOMINAIS
freis estivreis tivreis houvreis
foram estiveram tiveram houveram
Infinitivo impessoal

Futuro do presente ser estar ter haver

serei estarei terei haverei


sers estars ters havers
ser estar ter haver Infinitivo pessoal
seremos estaremos teremos haveremos
sereis estareis tereis havereis ser (eu) estar (eu) ter (eu) haver (eu)
sero estaro tero havero seres (tu) estares (tu) teres (tu) haveres (tu)
ser (ele) estar (ele) ter (ele) haver (ele)
sermos (ns) estarmos termos havermos
Futuro do pretrito serdes (vs) (ns) (ns) (ns)
serem (eles) estardes terdes haverdes (vs)
seria estaria teria haveria (vs) (vs) haverem
serias estarias terias haverias estarem terem (eles)
seria estaria teria haveria (eles) (eles)
seramos estaramos teramos haveramos
sereis estareis tereis havereis
seriam estariam teriam haveriam
Gerndio
MODO SUBJUNTIVO
sendo estando tendo havendo

Presente
seja esteja tenha haja Particpio
sejas estejas tenhas hajas
seja esteja tenha haja sido estado tido havido
sejamos estejamos tenhamos hajamos
sejais estejais tenhais hajais
sejam estejam tenham hajam CONJUGAES

Pretrito Imperfeito So as trs conjugaes:

fosse estivesse tivesse houvesse


fosses estivesses tivesses houvesses 1 conjugao ar: andar, amar, trabalhar, etc.
fosse estivesse tivesse houvesse
fssemos estivssemos tivssemos houvssemos 2 conjugao er: correr, vender, perder, etc.
fsseis estivsseis tivsseis houvsseis
fossem estivessem tivessem houvessem 3 conjugao ir: sorrir, pedir, partir, etc.

Os verbos so classificados em:

38
Lngua Portuguesa
VERBOS REGULARES MODO SUBJUNTIVO

So aqueles que no sofrem alterao em seu radical e


Presente
suas desinncias so iguais ao verbo paradigma (modelo de
conjugao). ame corra parta
ames corras partas
ame corra parta
Modelos amemos corramos partamos
ameis corrais partais
1 conjugao - 2 conjugao - 3 conjugao - amem corram partam
amar correr partir
Pretrito imperfeito
amasse corresse partisse
MODO INDICATIVO amasses corresses partisses
amasse corresse partisse
amssemos corrssemos partssemos
amsseis corrsseis partsseis
Presente partissem
amassem corressem
amo corro parto
amas corres partes
ama corre parte Futuro simples
amamos corremos partimos
amais correis partis amar correr partir
amam correm partem amares correres partires
amar correr partir
amarmos corrermos partirmos
amardes correrdes partirdes
amarem correrem partirem
Pretrito perfeito
amei corri parti
amaste correste partiste MODO IMPERATIVO
amou correu partiu
amamos corremos partimos
amastes correstes partistes Afirmativo
amaram correram partiram
ama (tu) corre (tu) parte (tu)
ame (voc) corra (voc) parta (voc)
amemos (ns) corramos (ns) partamos (ns)
Pretrito imperfeito amai (vs) correi (vs) parti (vs)
amava corria partia amem (vocs) corram (vocs) partam (vocs)
amavas corrias partias
amava corria partia
amvamos corramos partamos
amveis correis parteis Negativo
amavam corriam partiam
no ames (tu) no corras (tu) no partas (tu)
no ame (voc) no corra (voc) no parta (voc)
no amemos (ns) no corramos no partamos (ns)
no ameis (vs) (ns) no partais (vs)
Pretrito mais-que-perfeito
no amem (vocs) no corrais (vs) no partam (vocs)
amara correra partira no corra (vocs)
amaras correras partiras
amara correra partira FORMAS NOMINAIS
amramos corrramos partramos
amreis corrreis partreis
amaram correram partiram Infinitivo impessoal
amar correr partir

Futuro do presente
Infinitivo pessoal
amarei correrei partirei
amars corrers partirs amar (eu) correr (eu) partir (eu)
amar correr partir amares (tu) correres (tu) partires (tu)
amaremos correremos partiremos amar (ele) correr (ele) partir (ele)
amareis correreis partireis amarmos (ns) corrermos (ns) partirmos (ns)
amaro correro partiro amardes (vs) correrdes (vs) partirdes (vs)
amarem (eles) correrem (eles) partirem (eles)

Futuro do pretrito
Gerndio
amaria correria partiria
amarias correrias partirias amando correndo partindo
amaria correria partiria
amaramos correramos partiramos
amareis correreis partireis Particpio
amariam correriam partiriam
amado corrido partido

39
Lngua Portuguesa
VERBOS IRREGULARES Ler
Presente do indicativo: leio, ls, l, lemos, ledes, leem.
So aqueles que sofrem alteraes em seu radical ou em Pretrito imperfeito: lia, lias, lia, lamos, leis, liam.
sua desinncia, afastando-se do modelo a que pertencem. Pretrito perfeito: li, leste, leu, lemos, lestes, leram.
Pretrito mais-que-perfeito: lera, leras, lera, lramos, lreis, leram.
1 CONJUGAO AR Presente do subjuntivo: leia, leias, leia, leiamos, leiais, leiam.
Pretrito imperfeito do subjuntivo: lesse, lesses, lesse, lssemos,
Aguar lsseis, lessem.
Imperativo afirmativo: l, leia, leiamos, lede, leiam.
Presente do indicativo: guo, guas, gua, aguamos, aguais, Assim se conjugam: reler, tresler.
guam.
Pretrito perfeito: aguei, aguaste, aguou, aguamos, aguastes, Ver
aguaram.
Presente do subjuntivo: gue, gues, gue, aguemos, agueis, Presente do indicativo: vejo, vs, v, vemos, vedes, veem.
guem. Pretrito perfeito: vi, viste, viu, vimos, vistes, viram.
Verbo regular nos demais tempos. Assim se conjugam desaguar,
Pretrito mais-que-perfeito: vira, viras, vira, vramos, vreis, viram.
enxaguar e minguar.
Imperativo afirmativo: v, veja, vejamos, vede, vejam.
Dar Presente do subjuntivo: veja, vejas, veja, vejamos, vejais, vejam.
Pretrito imperfeito do subjuntivo: visse, visses, visse, vssemos,
Presente do indicativo: dou, ds, d, damos, dais, do. vsseis, vissem.
Pretrito perfeito: dei, deste, deu, demos, destes, deram. Futuro do subjuntivo: vir, vires, vir, virmos, virdes, virem.
Pretrito imperfeito: dava, davas, dava, dvamos, dveis, davam. Gerndio: vendo. / Particpio: visto.
Pretrito mais-que-perfeito: dera, deras, dera, dramos, dreis, Assim se conjugam: antever, prever e rever.
deram.
Futuro do presente: darei, dars, dar, daremos, dareis, daro. 3 CONJUGAO IR
Futuro do pretrito: daria, darias, daria, daramos, dareis, dariam.
Presente do subjuntivo: d, ds, d, demos, deis, deem.
Pretrito imperfeito do subjuntivo: desse, desses, desse, dsse- Cair
mos, dsseis, dessem. Presente do indicativo: caio, cais, cai, camos, cas, caem.
Futuro do subjuntivo: der, deres, der, dermos, derdes, derem. Pretrito imperfeito: caa, caas, caa, caamos, caeis, caam.
Imperativo afirmativo: d, d, demos, dai, deem. Pretrito perfeito: ca, caste, caiu, camos, castes, caram.
Infinitivo impessoal: dar. Pretrito mais-que-perfeito: cara, caras, cara, caramos, careis,
Infinitivo pessoal: dar, dares, dar, darmos, dardes, darem. caram.
Gerndio: dando. Imperativo afirmativo: cai, caia, caiamos, ca, caiam.
Particpio: dado. Presente do subjuntivo: caia, caias, caia, caiamos, caiais, caiam.
Pretrito imperfeito do subjuntivo: casse, casses, casse, cas-
Optar semos, casseis, cassem.
Presente do indicativo: opto, optas, opta, optamos, optais, optam. Futuro do subjuntivo: cair, cares, cair, cairmos, cairdes, carem.
Presente do subjuntivo: opte, optes, opte, optemos, opteis, optem. Assim so conjugados: atrair, recair, sair, trair, subtrair etc.
Obs.: No caso do verbo optar a irregularidade est na pronncia. Nas
trs pessoas do singular e na terceira do plural do presente do indica- Ferir
tivo e do presente do subjuntivo, a vogal o do radical pronunciada
aberta e fortemente. Presente do indicativo: firo, feres, fere, ferimos, feris, ferem.
Presente do subjuntivo: fira, firas, fira, firamos, firais, firam.
2 CONJUGAO ER O verbo ferir tem o e do radical substitudo por i na primeira pessoa
do singular do presente do indicativo, nas pessoas do presente do
Caber subjuntivo e nas formas derivadas do imperativo.
Assim se conjugam: competir, divertir, expelir, vestir, inserir e os
Presente do indicativo: caibo, cabes, cabe, cabemos, cabeis, ca- derivados de ferir.
bem.
Pretrito perfeito: coube, coubeste, coube, coubemos, coubestes,
couberam. Rir
Pretrito imperfeito: cabia, cabias, cabia, cabamos, cabeis, cabi-
am. Presente do indicativo: rio, ris, ri, rimos, rides, riem.
Pretrito imperfeito: ria, rias, ria, ramos, reis, riam.
Pretrito mais-que-perfeito: coubera, couberas, coubera, coubra- Pretrito perfeito: ri, riste, riu, rimos, ristes, riram.
mos, coubreis, couberam. Pretrito mais-que-perfeito: rira, riras, rira, rramos, rreis, riram.
Futuro do presente: caberei, cabers, caber, caberemos, cabereis, Futuro do presente: rirei, rirs, rir, riremos, rireis, riro.
cabero. Futuro do pretrito: riria, ririas, riria, riramos, rireis, ririam.
Futuro do pretrito: caberia, caberias, caberia, caberamos, caber- Presente do subjuntivo: ria, rias, ria, riamos, riais, riam.
eis, caberiam. Pretrito imperfeito do subjuntivo: risse, risses, risse, rssemos,
Presente do subjuntivo: caiba, caibas, caiba, caibamos, caibais, rsseis, rissem.
caibam. Futuro do subjuntivo: rir, rires, rir, rirmos, rirdes, rirem.
Pretrito imperfeito do subjuntivo: coubesse, coubesses, coubes- Imperativo afirmativo: ri, ria, riamos, ride, riam.
se, coubssemos, coubsseis, coubessem. Infinitivo pessoal: rir, rires, rir, rirmos, rirdes, rirem.
Futuro do subjuntivo: couber, couberes, couber, coubermos, cou- Gerndio: rindo. Particpio: rido.
berdes, couberem. Assim se conjuga: sorrir.
Observao: O verbo caber no se apresenta conjugado nem no
imperativo afirmativo nem no imperativo negativo. Vir
Crer Presente do indicativo: venho, vens, vem, vimos, vindes, vm.
Presente do indicativo: creio, crs, cr, cremos, credes, creem. Pretrito imperfeito: vinha, vinhas, vinha, vnhamos, vnheis, vi-
nham.
Pretrito perfeito: cri, creste, creu, cremos, crestes, creram.
Pretrito perfeito: vim, vieste, veio, viemos, viestes, vieram.
Pretrito imperfeito: cria, crias, cria, criamos, crieis, criam. Pretrito mais-que-perfeito: viera, vieras, viera, viramos, vireis,
Pretrito mais-que-perfeito: crera, creras, crera, crramos, crreis, vieram.
creram. Futuro do presente: virei, virs, vir, viremos, vireis, viro.
Presente do subjuntivo: creia, creias, creia, creiamos, creiais, Futuro do pretrito: viria, virias, viria, viramos, vireis, viriam.
creiam. Presente do subjuntivo: venha, venhas, venha, venhamos, venhais,
Pretrito imperfeito do subjuntivo: cresse, cresses, cresse, crs- venham.
semos, crsseis, cressem Pretrito imperfeito do subjuntivo: viesse, viesses, viesse, vis-
Futuro do subjuntivo: crer, creres, crer, crermos, crerdes, crerem. semos, visseis, viessem.
Imperativo afirmativo: cr, creia, creiamos, crede, creiam. Futuro do subjuntivo: vier, vieres, vier, viermos, vierdes, vierem.
Imperativo negativo: no creias (tu), no creia (voc), no creiamos Infinitivo pessoal: vir, vires, vir, virmos, virdes, virem.
(ns), no crede (vs), no creiam (vocs) Imperativo afirmativo: vem, venha, venhamos, vinde, venham.
Assim se conjugam: ler e descrer. Gerndio: vindo. Particpio: vindo.
Assim se conjugam: intervir, advir, convir, provir, sobrevir.

40
Lngua Portuguesa
VERBOS DEFECTIVOS Imperativo negativo: no vs, no v, no vamos, no vades, no
vo.
Infinitivo pessoal: ir, ires, ir, irmos, irdes, irem.
So aqueles que no possuem todas as formas, ou seja, Gerndio: indo. Particpio: ido.
deixam de ser flexionados em algumas conjugaes.
CORRELAO VERBAL
ABOLIR
Damos o nome de correlao verbal coerncia que, em
O presente do indicativo comea na segunda pessoa do uma frase ou sequncia de frases, deve haver entre as for-
singular: tu aboles, ele abole, ns abolimos, vs abolis, eles mas verbais utilizadas. Ou seja, preciso que haja articula-
abolem o temporal entre os verbos, que eles se correspondam, de
ADEQUAR / FALIR / REAVER maneira a expressar as ideias com lgica. Tempos e modos
verbais devem, portanto, combinar entre si. Vejamos este
No presente do indicativo, s conjugado em duas for- exemplo: Seu eu dormisse durante as aulas, jamais aprende-
mas: ria a lio.
Ns adequamos Vs adequais
Ns falimos Vs falis No caso, o verbo dormir est no pretrito imperfeito do
Ns reavemos Vs reaveis subjuntivo. Sabemos que o subjuntivo expressa dvida, incer-
teza, possibilidade, eventualidade. Assim, em que tempo o
VERBOS ABUNDANTES verbo aprender deve estar, de maneira a garantir que o per-
odo tenha lgica? Na frase, aprender usado no futuro do
So os verbos que possuem formas duplas, geralmente
de particpio. pretrito (aprenderia), um tempo que expressa, dentre outras
ideias, uma afirmao condicionada (que depende de algo),
particpio particpio
infinitivo regular irregular quando esta se refere a fatos que no se realizaram e que,
provavelmente, no se realizaro. O perodo, portanto, est
emergir emergido emerso correto, j que a ideia transmitida por dormisse exatamente
encher enchido cheio
entregar entregado entregue a de uma dvida, a de uma possibilidade que no temos
envolver envolvido envolto certeza se ocorrer.
enxugar enxugado enxuto
expelir expelido expulso Correlaes verbais corretas
expressar expressado expresso
exprimir exprimido expresso
expulsar expulsado expulso presente do indicativo + presente do subjuntivo:
extinguir extinguido extinto
fixar fixado fixo Exijo que voc faa o dever.
frigir frigido frito
fritar fritado frito pretrito perfeito do indicativo + pretrito imperfeito do
ganhar ganhado ganho
gastar gastado gasto subjuntivo:
imprimir imprimido impresso
incluir includo incluso Exigi que ele fizesse o dever.
isentar isentado isento
inserir inserido inserto presente do indicativo + pretrito perfeito composto do
limpar limpado limpo
matar matado morto subjuntivo:
misturar misturado misto
morrer morrido morto Espero que ele tenha feito o dever.
nascer nascido nato
pagar pagado pago pretrito imperfeito do indicativo + mais-que-perfeito
pegar pegado pego
prender prendido preso composto do subjuntivo:
salvar salvado salvo
secar secado seco Queria que ele tivesse feito o dever.
segurar segurado seguro
soltar soltado solto futuro do subjuntivo + futuro do presente do indicativo:
sujeitar sujeitado sujeito
suprimir suprimido supresso
suspender suspendido suspenso Se voc fizer o dever, eu ficarei feliz.
vagar vagado vago
pretrito imperfeito do subjuntivo + futuro do pretrito do
VERBOS ANMALOS indicativo:

So os verbos cujos radicais sofrem profundas irregulari- Se voc fizesse o dever, eu leria suas respostas.
dades e que no se enquadram em nenhuma classificao.
o caso dos verbos ser e ir. pretrito mais-que-perfeito composto do subjuntivo +
futuro do pretrito composto do indicativo:
Ir
Presente do indicativo: vou, vais, vai, vamos, ides, vo.
Pretrito imperfeito: ia, ias, ia, amos, eis, iam. Se voc tivesse feito o dever, eu teria lido suas respostas.
Pretrito perfeito: fui, foste, foi, fomos, fostes, foram.
Pretrito mais-que-perfeito: fora, foras, fora, framos, freis, foram. futuro do subjuntivo + futuro do presente do indicativo:
Futuro do presente: irei, irs, ir, iremos, ireis, iro.
Futuro do pretrito: iria, irias, iria, iramos, ireis, iriam.
Presente do subjuntivo: v, vs, v, vamos, vades, vo. Quando voc fizer o dever, dormirei.
Pretrito imperfeito do subjuntivo: fosse, fosses, fosse, fssemos,
fsseis, fossem. Fut. do subj. + fut. do presente composto do indicativo:
Futuro do subjuntivo: for, fores, for, formos, fordes, forem.
Imperativo afirmativo: vai, v, vamos, ide, vo. Quando voc fizer o dever, j terei dormido.

41
Lngua Portuguesa
EXERCCIOS . VOZES VERBAIS E SUA CONVERSO

1 - Se voc ............ no prximo domingo e ................ de VOZES DO VERBO


tempo ............... assistir a final do campeonato.
Voz do verbo a forma que este toma para indicar que a
a) vir / dispor / v ao verbal praticada ou sofrida pelo sujeito.
b) vir / dispuser / vai
c) vier / dispor / v Trs so as vozes dos verbos: a ativa, a passiva e a refle-
d) vier / dispuser / v xiva.
e) vier / dispor / vai
Um verbo est na voz ativa quando o sujeito agente,
2 - Ele ............... que lhe ............... muitas dificuldades, mas isto , faz a ao expressa pelo verbo.
enfim ............... a verba para a pesquisa.
Ex.: O caador abateu a ave.
a) receara / opusessem / obtera
b) receara / opusessem / obtivera Um verbo est na voz passiva quando o sujeito pacien-
c) receiara / opossem / obtivera te, isto , sofre, recebe ou desfruta, a ao expressa pelo
d) receiara / oposessem / obtera verbo.
e) receara / opossem / obtera
Ex.: A ave foi abatida pelo caador.
3 - A segunda pessoa do singular do pretrito perfeito do
indicativo do verbo precaver : Obs.: S verbos transitivos podem ser usados na voz passi-
va.
a) precavias b) precavieste
c) precaveste d) precaviste FORMAO DA VOZ PASSIVA
e) n.d.a.
A voz passiva, mais frequentemente, formada:
4 - Assinale a alternativa que se encaixe no perodo seguinte:

"Se voc .......... e o seu irmo ......., quem sabe voc ............. 1) Pelo verbo auxiliar ser seguido do particpio do verbo
o dinheiro. principal (passiva analtica).

a) requeresse / interviesse / reouvesse Ex.: O homem afligido pelas doenas.


b) requisesse / intervisse / reavesse
c) requeresse / intervisse / reavesse Na passiva analtica, o verbo pode vir acompanhado pelo
d) requeresse / interviesse / reavesse agente da passiva. Menos frequentemente, pode-se exprimir
e) requisesse / intervisse / reouvesse a passiva analtica com outros verbos auxiliares.

5 - Assinale a opo que completa corretamente as lacunas Ex.: A aldeia estava isolada pelas guas.
da seguinte frase: (agente da passiva)

"Quando ............... mais aperfeioado, o computador certa- 2) Com o pronome apassivador se associado a um verbo
mente ............... um eficiente meio de controle de toda a vida ativo da terceira pessoa (passiva pronominal).
social."
a) estivesse / ser Ex.: Regam-se as plantas.
b) estiver / seria Organizou-se o campeonato.
c) esteja / era (sujeito paciente)
d) estivesse / era (pronome apassivador ou partcula apassivadora)
e) estiver / ser
VOZ REFLEXIVA
6 - Quando ............ todos os documentos, ............... um re-
querimento e ............... a chamada de seu nome. Na voz reflexiva o sujeito , ao mesmo tempo, agente e
paciente: faz uma ao cujos efeitos ele mesmo sofre.
a) obtiver / redija / aguarda
b) obteres / rediges / aguardes Ex.: O caador feriu-se.
c) obtiveres / redige / aguarda A menina penteou-se.
d) obter / redija / aguarde
e) obtiver / redija / aguarde O verbo reflexivo conjugado com os pronomes reflexi-
vos me, te, se, nos, vos, se. Estes pronomes so reflexivos
7 - Ele ............... numa questo difcil de ser resolvida e quando se lhes podem acrescentar: a mim mesmo, a ti mes-
............... seus bens graas ao bom senso. mo, a si mesmo, a ns mesmos, etc., respectivamente.

a) interviu / reouve Ex.: Consideras-te aprovado? (a ti mesmo)


b) interveio / rehaveu pronome reflexivo
c) interviu / reaveu
d) interveio / reouve Uma variante da voz reflexiva a que denota reciprocida-
e) interviu / rehouve de, ao mtua ou correspondida. Os verbos desta voz, por
alguns chamados recprocos, usam-se geralmente, no plural
RESPOSTAS e podem ser reforados pelas expresses um ao outro, reci-
1-D 2-B 3-C 4-A 5-E 6-E 7-D procamente, mutuamente.

42
Lngua Portuguesa
Ex.: Amam-se como irmos.
Os pretendentes insultaram-se. CONCORDNCIA NOMINAL E VERBAL
(Pronome reflexivo recproco)

CONVERSO DA VOZ ATIVA NA PASSIVA Concordncia o princpio sinttico segundo o qual as pala-
vras dependentes se harmonizam, nas suas flexes, com as
Pode-se mudar a voz ativa na passiva sem alterar subs- palavras de que dependem.
tancialmente o sentido da frase:
Assim:
Ex.: Gutenberg inventou a imprensa.
A imprensa foi inventada por Gutenberg. a) os adjetivos, pronomes, artigos e numerais concordam em
gnero e nmero com os substantivos determinados (concor-
Observe que o objeto direto ser o sujeito da passiva, o dncia nominal).
sujeito da ativa passar a agente da passiva e o verbo ativo
revestir a forma passiva, conservando o mesmo tempo. b) o verbo concordar com o seu sujeito em nmero e pessoa
(concordncia verbal).
Ex.: Os calores intensos provocam as chuvas.
As chuvas so provocadas pelos calores intensos. CONCORDNCIA NOMINAL
Eu o acompanharei. Ele ser acompanhado por mim.
1) Quando o adjetivo se referir a um s nome, o substantivo
Obs.: Quando o sujeito da voz ativa for indeterminado, no concorda com ele em gnero e nmero.
haver complemento agente da passiva.
Boa rvore no d maus frutos.
Ex.: Prejudicaram-me. Fui prejudicado.
2) Quando o adjetivo se referir a dois ou mais substantivos
do mesmo gnero e do singular e vier posposto, toma o
EXERCCIOS gnero deles e vai facultativamente, para o singular ou plural.

1) Apenas uma das frases admite a voz passiva. Assinale-a. Disciplina, ao e coragem digna (ou dignas).

a) Gosto de frutas. Porm: Dedicado o pai, o filho e o irmo.


b) Milhares de pessoas assistiram ao jogo. (adjetivo anteposto concordar com o mais prximo).
c) Deus criou o mundo.
d) Este ano foi quente.
3) Quando o adjetivo se referir a dois ou mais substantivos
de gneros diferentes e do singular e vier posposto, pode-
2) "O velho casaro foi substitudo por um enorme edifcio." r ir para o masculino plural ou concordar com o mais prxi-
Passando esta frase para a voz ativa, temos: mo.

a) O velho casaro substituiu o enorme edifcio. Escolheste lugar e hora maus.


b) Um enorme edifcio substituiu o casaro. Escolheste lugar e hora m.
c) O velho casaro, substituram-no por um enorme edifcio.
d) Substituiu-se o enorme edifcio pelo velho casaro. Porm: Sinto eterno amor e gratido.
(adjetivo anteposto concordar com o mais prximo).
3) Assinale a alternativa que preenche corretamente as lacu-
nas da frase apresentada. 4) Quando o adjetivo se referir a dois ou mais substantivos
de gneros diferentes e do plural e vier posposto, tomar
Transpondo da voz ativa para a passiva a frase "Os alunos o plural masculino ou concordar com o mais prximo.
haveriam de ouvir os conselhos do mestre", obtm-se a forma
verbal ...... . Rapazes e moas estudiosos (ou estudiosas).
a) teriam sido ouvidos 5) Quando o adjetivo se referir a dois ou mais substantivos
b) haveriam de ser ouvidos
de gnero e nmero diferente e vier posposto, poder
c) haveria de ser ouvido
d) seriam ouvidos concordar com o mais prximo ou ir para o plural masculino.

4) Assinale a letra correspondente alternativa que preenche Primos, primas e irms educadssimas (ou educadssi-
corretamente as lacunas da frase apresentada. mos).

Transpondo para a voz passiva a frase "No os enganara- 6) Pode o adjetivo ainda concordar com o mais prximo
mos por muito tempo", obtm-se a forma verbal ...... . quando os substantivos so ou podem ser considerados
sinnimos.
a) teriam sido enganados
b) enganar-se-iam
c) teramos enganado Gratido e reconhecimento profundo.
d) seriam enganados
7) Quando dois ou mais adjetivos se referem ao mesmo
substantivo determinado pelo artigo, ocorrem trs tipos de
construo:

RESPOSTAS Estudo as lnguas inglesa e francesa.


1-C 2-B 3-B 4-D Estudo a lngua inglesa e a francesa.
Estudo a lngua inglesa e francesa.

43
Lngua Portuguesa
8) As palavras: mesmo, prprio e s (quando equivale a 13) A palavra possvel em o mais . . . possvel, o pior
sozinho) concordam segundo a regra geral em gnero e possvel, o melhor possvel, mantm-se
nmero com a palavra a que se referem. S quando equivale invarivel.
a somente advrbio e invarivel.
Praias o mais tentadoras possvel.
Ela mesma me avisou.
Vocs prprios me trouxeram a notcia. Porm:
Ns no estivemos ss.
S eles no concordaram. Com o plural os mais, os menos, os piores, os melho-
res, a palavra possvel vai para o plural.
Obs.: A expresso a ss invarivel. Exemplo:
Gostaria de ficar a ss por uns momentos. Praias as mais tentadoras possveis.

9) Anexo, incluso, junto, bastante e nenhum, concordam, 14) A palavra obrigado concorda com o nome a que se
normalmente, com os substantivos a que se referem. refere.

Segue anexa a cpia do contrato. Muito obrigado (masculino singular)


Vo inclusos os requerimentos. Muito obrigada (feminino singular)
Seguem juntas as notas. Eles disseram muito obrigados (masculino plural)
Bastantes pessoas ignoram esse plural.
Homens nenhuns, nenhumas causas. 15) O verbo ser mais adjetivo.

Observaes: Nos predicados nominais em que ocorre o verbo ser mais


um adjetivo, formando expresses do tipo bom, claro,
a) Alerta e menos so sempre invariveis. evidente, etc., h duas construes:

Estamos alerta.
H situaes menos complicadas. se o sujeito no vem precedido de nenhum modificador,
H menos pessoas no local. tanto o verbo quanto o adjetivo ficam invariveis.

b) Em anexo sempre invarivel. Cerveja bom.


proibido entrada.
Seguem, em anexo, as fotografias.
se o sujeito vem precedido de modificador, tanto o verbo
10) Meio - meia, como adjetivo concordam em gnero e quanto o predicativo concordam regularmente.
nmero com o substantivo que modificam, mas como advr-
bio meio permanece invarivel. A cerveja boa.
proibida a entrada.
Obs.: como adjetivo, modifica o substantivo; como advrbio,
modifica o adjetivo, o verbo e o prprio advrbio.
16) Concordncia do Adjetivo (Predicativo)
J meio-dia e meia (hora). (substantivo)
Comprei dois meios litros de leite. (substantivo) a) Predicativo do Sujeito: concorda com o sujeito em nme-
Quero meio quilo de caf. (substantivo) ro e gnero:
Ele sentia-se meio cansado. (adjetivo)
Elas pareciam meio tontas. (adjetivo) As crianas estavam tristonhas.
Minha me est meio exausta. (adjetivo)
b) Predicativo do Objeto:
Esto nesse caso palavras como: pouco, muito, bastante,
barato, caro, meio, longe, etc. Se o objeto direto for simples o adjetivo predicativo concor-
da em gnero e nmero com o objeto.
11) Dado e visto e qualquer outro particpio, concordam
com o substantivo a que se referem. Trouxeram-na desmaiada.

Dados os conhecimentos (substantivo masculino) Se o objeto direto for composto o adjetivo predicativo deve-
Dadas as condies (substantivo feminino) r flexionar-se no plural e no gnero dos objetos.
Vistas as dificuldades (substantivo feminino)
A justia declarou criminosas a atriz e suas amigas.
12) As expresses um e outro e nem um nem outro so
seguidas de um substantivo singular. 17) Substantivos ligados por ou: o adjetivo concorda
com o mais prximo ou, ento, vai para o plural.
. . . mas aprovei um e outro ato.
. . . mas uma e outra coisa duraram. uma flor ou um fruto saboroso OU saborosos.

Porm: quando um e outro for seguido de adjetivo, o subs- 18) Dois ou mais ordinais determinando o substantivo:
tantivo fica no singular e o adjetivo vai para o plural. este ficar no singular ou no plural.

Uma e outra parede sujas. a primeira e segunda ferida (OU feridas) do corao.
Um e outro lado escuros.

44
Lngua Portuguesa
EXERCCIOS 8) Elas ............... enviaram os atestados ............... s procu-
raes.

1) Assinale a alternativa em que ocorre erro na concordncia a) mesmos, anexas


do verbo ser e do predicativo. b) mesmas, anexas
c) mesmos, anexos
a) perigoso contratos muito longos. d) mesmas, anexos
b) Foi arriscada a sua proposta. e) mesmo, anexo
c) necessrio atitudes desse tipo.
d) No parecia, mas era claro sua inteno.
e) Cerveja gelada bom para a sade. 9) Apenas uma alternativa preenche corretamente os espa-
os existentes na sentena abaixo.

2) Assinale a alternativa em que ocorra algum erro de con- Assinale-a:


cordncia nominal.
Aqueles seguranas esto ............... porque encontraram
a) Saiba que voc cometeu um crime de lesa-majestade. ............... marcas de mo.
b) Estejam alerta, pois o inimigo no manda aviso.
c) H menos indecises do que parece. a) alerta - bastante
d) Permitiram-me que as deixo s. b) alerta - bastantes
e) Ele sentiu que precisava ficar a ss. c) alertas - bastantes
d) alertas - bastante
e) n.d.a.
3) Assinale, dentre as frases abaixo, as opes corretas
quanto concordncia nominal.
10) No foi ............... a nota que receberam. Elas .......fizeram
a) meio-dia e meia. o trabalho.
b) proibido entrada.
c) proibida a entrada. a) justa - mesmas
d) Seguem anexo os documentos. b) justo - mesmo
e) Seguem anexo notas fiscais. c) justa - mesmo
f) Envio inclusas as faturas. d) justo - mesmas
g) permitido a entrada. e) justas - mesma

Questes de 4 a 6 - Responda, segundo o cdigo: 11) Assinale a alternativa em que a concordncia nominal
est incorreta:

a) Apenas correta a I. a) vergonhosa a misria e o desinteresse poltico.


b) Apenas correta a II. b) Admiro a cultura rabe e a japonesa.
c) Apenas correta a III. c) A aluna foi mal na prova porque estava meia tensa.
d) Todas corretas. d) H bastantes pessoas desempregadas nesta cidade.
e) Todas erradas. e) Muito obrigada, respondeu a menina.

4) I. expressamente proibido entrada. 12) Todas as alternativas abaixo esto corretas quanto
II. Ma muito bom para os dentes. concordncia nominal, exceto:
III. Ser necessria tal atitude?
a) Foi acusado de crime de lesa-ptria.
b) As declaraes devem seguir anexas ao processo.
5) I. Na sala, havia lugares bastantes para todos. c) Eram rapazes os mais elegantes possvel.
II. Eu mesmo, uma mulher experiente, cometo erros infan- d) Seguiram automveis, cereais e geladeiras exportados.
tis.
III. necessrio, neste momento, a exatido dos fatos.
13) Em todas as frases a concordncia se fez corretamente,
exceto em:
6) I. Encontrei uma e outra janela aberta.
II. Marta estava meia preocupada. a) Os soldados, agora, esto todos alerta.
III. Seguia anexo ao envelope uma lista de preos. b) Ela possua bastante recursos para viajar.
c) As roupas das moas eram as mais belas possveis.
G 5RVDUHFHEHXROLYURHGLVVH0XLWRREULJDGD

7) Assinale o item que apresenta erro de concordncia:

a) Os fatos falam por si s.


b) Ele estuda a histria e a mitologia egpcia. RESPOSTAS
c) Estes produtos custam cada vez mais caro. 1-D 2-D 3 a; b; c; f 4-D 5-A 6-E
d) Ela mesma nos agradeceu. 7-A 8-D 9-B 10 - A 11 - C 12 - C 13 - B
e) Ele mesmo construiu sua casa.

45
Lngua Portuguesa
CONCORDNCIA VERBAL b) ora preferindo a 3 pessoa na concorrncia tu + ele [tu +
ele = vocs em vez de tu + ele = vs]:
O verbo concorda com o sujeito, em harmonia com as
seguintes regras gerais: Deus e tu so testemunhas.
Juro que tu e tua mulher me pagam.
O sujeito simples
CASOS ESPECIAIS DE CONCORDNCIA VERBAL
O sujeito sendo simples, com ele concordar o verbo em
nmero e pessoa. Exemplos: Ncleos do sujeito unidos por ou

a) verbo depois do sujeito: H duas situaes a considerar:

As savas eram uma praga. 1) Se a conjuno ou indicar excluso ou retificao, o verbo


O vento forte quebra os telhados e as vidraas. concordar com o ncleo do sujeito mais prximo:

b) verbo antes do sujeito: Paulo ou Antnio ser o presidente.


O ladro ou os ladres no deixaram nenhum vestgio.
Acontecem tantas desgraas neste planeta!
No faltaro pessoas que nos queiram ajudar. 2) O verbo ir para a plural se a ideia por ele expressa se
referir ou puder ser atribuda a todo os ncleos do sujeito:
O sujeito composto e da 3 pessoa
Era to pequena a cidade, que um grito ou gargalhada
O sujeito, sendo composto e anteposto ao verbo, leva forte a atravessavam de ponta a ponta.
geralmente este para o plural. Exemplos: Naquela crise, s Deus ou Nossa Senhora podiam acu-
dir-lhe.
A esposa e o amigo seguem sua marcha.
Poti e seus guerreiros o acompanharam. H, no entanto, em bons autores, ocorrncia de verbo no
singular:
lcito (mas no obrigatrio) deixar o verbo no singular:
A glria ou a vergonha da estirpe provinha de atos indivi-
a) quando os ncleos do sujeito so sinnimos: duais.

A decncia e honestidade ainda reinava. Ncleos do sujeito unidos pela preposio com
A coragem e a afoiteza com que lhe respondi, perturbou-
o. Usa-se mais frequentemente o verbo no plural quando se
atribui a mesma importncia, no processo verbal, aos ele-
b) quando os ncleos do sujeito formam sequencia gradativa: mentos do sujeito unidos pela preposio com. Exemplos:

Uma nsia, uma aflio, uma angstia repentina come- Manuel com seu compadre construram o barraco.
ou a me apertar a alma.
Eu com outros romeiros vnhamos de Vigo...
Sendo o sujeito composto e posposto ao verbo, este po-
der concordar no plural ou com o substantivo mais prximo: Pode-se usar o verbo no singular quando se deseja dar
relevncia ao primeiro elemento do sujeito e tambm quando
Ali estavam o rio e suas lavadeiras. o verbo vier antes deste.
Aqui que reina a paz e a alegria na boas conscincias.
O bispo, com dois sacerdotes, iniciou solenemente a
O sujeito composto e de pessoas diferentes missa.

Se o sujeito composto for de pessoas diversas, o verbo se O presidente, com sua comitiva, chegou a Paris s 5 h da
flexiona no plural e na pessoa que tiver prevalncia. [A 1 tarde.
pessoa prevalece sobre a 2 e a 3; a 2 prevalece sobre a
3]: Ncleos do sujeito unidos por nem

Foi o que fizemos Capitu e eu. [ela e eu = ns] Quando o sujeito formado por ncleos no singular uni-
dos pela conjuno nem, usa-se, comumente, o verbo no
Tu e ele partireis juntos. [tu e ele = vs] plural. Exemplos:

Voc e meu irmo no me compreendem. [voc e ele = Nem a riqueza nem o poder o livraram de seus inimigos.
vocs]
Nem eu nem ele o convidamos.

Muitas vezes os escritores quebram a rigidez dessa regra: prefervel a concordncia no singular:

a) ora fazendo concordar o verbo com o sujeito mais prxi- a) quando o verbo precede o sujeito:
mo, quando este se ope ao verbo:
No o convidei eu nem minha esposa.
O que me resta da felicidade passada s tu e eles.
Faze uma arca de madeira; entra nela tu, tua mulher e 1D ID]HQGD DWXDOPHQWH QmR VH recusa trabalho, nem
teus filhos. dinheiURQHPQDGDDQLQJXpP(Guimares Rosa)

46
Lngua Portuguesa
b) quando h excluso, isto , quando o fato s pode ser Sujeito coletivo
atribudo a um dos elementos do sujeito:
O verbo concorda no singular com o sujeito coletivo no
Nem Berlim nem Moscou sediar a prxima Olimpada. singular. Exemplos:
[S uma cidade pode sediar a Olimpada.]
A multido vociferava ameaas.
Nem Paulo nem Joo ser eleito governador do Acre. [S O exrcito dos aliados desembarcou no sul da Itlia.
um candidato pode ser eleito governador.]
Observao:
Ncleos do sujeito correlacionados
Se o coletivo vier seguido de substantivo plural que o
O verbo vai para o plural quando os elementos do sujeito especifique e anteceder ao verbo, este poder ir para o plu-
composto esto ligados por uma das expresses correlativas ral, quando se quer salientar no a ao do conjunto, mas a
no s... mas tambm, no s como tambm, tanto... como, dos indivduos, efetuando-se uma concordncia no gramati-
etc. Exemplos: cal, mas ideolgica:

1mRVyDQDomRPDVWDPEpPRSUtQFLSH HVWDULDPSREUHV 8PD JUDQGHPXOWLGmR GH FULDQoDV GH YHOKRV GH PXOKe-
(Alexandre Herculano) res penetraram QDFDYHUQD
(Alexandre Herculano)
7DQWRDLJUHMDFRPR(VWDGRHUDPDWpFHUWRSRQWRLQRFHn-
WHV +DYLD QD 8QLmR XP JUXSR GH PHQLQRV Tue praticavam
(Alexandre Herculano) HVVHGLYHUWLPHQWRFRPXPDSHUWLQiFLDDGPLUiYHO
(Carlos Povina Cavalcanti)
Sujeitos resumidos por tudo, nada, ningum
A maior parte de, grande nmero de, etc.
Quando o sujeito composto vem resumido por um dos
pronomes tudo, nada, ningum, etc., o verbo concorda, no Sendo o sujeito uma das expresses quantitativas a mai-
singular, com o pronome resumidor. Exemplos: or parte de, parte de, a maioria de, grande nmero de,
etc., seguida de substantivo ou pronome no plural, o verbo,
Jogos, espetculos, viagens, diverses, nada pde satis- quando posposto ao sujeito, pode ir para o singular ou para o
faz-lo. plural, conforme se queira efetuar uma concordncia estrita-
Jogadores, rbitro, assistentes, ningum saiu do campo. mente gramatical (com o coletivo singular) ou uma concor-
dncia enftica, expressiva, com a ideia de pluralidade suge-
Ncleos do sujeito designando a mesma pessoa ou coisa rida pelo sujeito. Exemplos:

O verbo concorda no singular quando os ncleos do sujei- $PDLRUSDUWHGRVLQGtJHQDVrespeitavam RVSDMpV


to designam a mesma pessoa ou o mesmo ser. Exemplos: (Gilberto Freire)

(PERUDVDEHQGRTXHWXGRYDLFRQWLQXDUFRPRHVWi fica *UDQGH SDUWH GRV DWXDLV DGYpUELRV nasceram de subs-


RUHJLVWURRSURWHVWRHPQRPHGRVWHOHVSHFWDGRUHV WDQWLYRV
(Valrio Andrade) (Mrio Barreto)

Advogado e membro da instituio afirma que ela cor- $PDLRULDGDVSHVVRDV so sinuosas, coleanWHV
rupta. (Ondina Ferreira)

Ncleos do sujeito so infinitivos $PDLRULDGDVSDODYUDVcontinua YLVtYHO


(Carlos D. de Andrade)
O verbo concordar no plural se os infinitivos forem de-
0HLDG~]LDGHJDULPSHLURVGRHQWHV esperava a consulta
terminados pelo artigo ou exprimirem ideias opostas; caso
PDWXWLQD
contrrio, tanto lcito usar o verbo no singular como no
(Herman Lima)
plural. Exemplos:
9LVLWHL RV SUHVRV %RD SDUWH GHOHV GRUPLD >RX GRUPLDP@
O comer e o beber so necessrios.
no cho.
Rir e chorar fazem parte da vida.
Um e outro, nem um nem outro
Cantar, danar e representar faz [ou fazem] a alegria do
O sujeito sendo uma dessas expresses, o verbo concor-
artista.
da, de preferncia, no plural. Exemplos:
Sujeito oracional
8PHRXWURVHdestinavam DRFRQKHFLPHQWR
(Hernani Cidade)
Concorda no singular o verbo cujo sujeito uma ora-
o: 8PDHRXWUDIDPtOLD tinham [ou tinha@SDUHQWHVQR5LR

Ainda falta comprar os cartes. 'HSRLV QHP Xm nem outro acharam novo motivo para
 GLiORJR
predicado sujeito oracional (Fernando Namora)

Estas so realidades que no adianta esconder. Nem uma nem outra foto prestavam [ou prestava]
[sujeito de adianta: esconder que (as realidades)]

47
Lngua Portuguesa
Um ou outro Um dos meninos, que estava sentado porta da casa, foi
chamar o pai. [S um menino estava sentado.]
O verbo concorda no singular com o sujeito um ou outro:
Um dos cinco homens, que assistiam quela cena estu-
5HVSRQGL-OKHTXHXPRXRXWURFRODUOKHILFDYDEHP pefatos, soltou um grito de protesto. [Todos os cinco homens
(Machado de Assis) assistiam cena.]

8PDRXRXWUDSRGHGDUOXJDUDGLVVHQWLPHQWRV Mais de um
(Machado de Assis)
O verbo concorda, em regra, no singular. O plural ser de
Um dos que, uma das que rigor se o verbo exprimir reciprocidade, ou se o numeral for
superior a um. Exemplos:
Quando, em oraes adjetivas restritivas, o pronome que
vem antecedido de um dos ou expresso anloga, o verbo da Mais de um excursionista j perdeu a vida nesta monta-
orao adjetiva flexiona-se, em regra, no plural: nha.
Mais de um dos circunstantes se entreolharam com
2SUtQFLSHIRLXPGRVTXHdespertaram PDLVFHGR espanto.
(Alexandre Herculano) Devem ter fugido mais de vinte presos.
$EDURQHVDHUDXPDGDVSHVVRDVTXHPDLV desconfia- Quais de vs? Alguns de ns
vam GHQyV
(Machado de Assis)
Sendo o sujeito um dos pronomes interrogativos quais?
quantos? ou um dos indefinidos alguns, muitos, poucos, etc.,
Essa a concordncia lgica, geralmente preferida pelos
seguidos dos pronomes ns ou vs, o verbo concordar, por
escritores modernos. Todavia, no prtica condenvel fugir
atrao, com estes ltimos, ou, o que mais lgico, na 3
ao rigor da lgica gramatical e usar o verbo da orao adjeti-
pessoa do plural:
va no singular (fazendo-o concordar com a palavra um),
quando se deseja destacar o indivduo do grupo, dando-se a 4XDQWRVGHQWUHQyVDconhecemos"
entender que ele sobressaiu ou sobressai aos demais: (Rogrio Csar Cerqueira)

Ele um desses parasitas que vive custa dos outros. 4XDLVGHYyVsoisFRPRHXGHVWHUUDGRV"


(Alexandre Herculano)
)RL XP GRV SRXFRV GR VHX WHPSR TXH reconheceu a
RULJLQDOLGDGHHLPSRUWkQFLDGDOLWHUDWXUDEUDVLOHLUD TXDQWRVGHQWUHYyVHVWXGDPFRQVFLHQFLRVDPHQWHRSDVVa-
(Joo Ribeiro) GR" -RVpGH$OHQFDU

Observao: $OJXQVGHQyV vieram [ou viemos@GHORQJH

H gramticos que condenam tal concordncia. Por coe- Poucos dentre ns conhecem [ou conhecemos] as leis.
rncia, deveriam condenar tambm a comumente aceita em
construes anormais do tipo: Quais de vs sois isentos de Observao:
culpa? Quantos de ns somos completamente felizes?
Estando o pronome no singular, no singular (3 pessoa)
O verbo fica obrigatoriamente no singular quando se apli- ficar o verbo:
ca apenas ao indivduo de que se fala, como no exemplo:
Qual de vs testemunhou o fato?
Jairo um dos meus empregados que no sabe ler. [Jairo Nenhum de vs a viu?
o nico empregado que no sabe ler.] Nenhuma de ns a conhece.
Qual de ns falar primeiro?
Ressalte-se, porm, que nesse caso prefervel construir
a frase de outro modo: Pronomes quem, que, como sujeitos

Jairo um empregado meu que no sabe ler. O verbo concordar, em regra, na 3 pessoa, com os
pronomes quem e que, em frases como estas:
Dos meus empregados, s Jairo no sabe ler.
Sou eu quem responde pelos meus atos.
Na linguagem culta formal, ao empregar as expresses
em foco, o mais acertado usar no plural o verbo da orao Somos ns quem leva o prejuzo.
adjetiva:
Eram elas quem fazia a limpeza da casa.
O Japo um dos pases que mais investem em tecno-
logia. Eu sou o que presenciou o fato.

Herclito foi um dos empresrios que conseguiram supe- 6RX XP KRPHP TXH DLQGD QmR renegou nem da cruz,
rar a crise. QHPGD(VSDQKD
(Alexandre Herculano)
Embora o caso seja diferente, oportuno lembrar que,
nas oraes adjetivas explicativas, nas quais o pronome que eUDPRV GRLV VyFLRV TXH entravam no comrcio da vida
separado de seu antecedente por pausa e vrgula, a con- FRPGLIHUHQWHFDSLWDO
cordncia determinada pelo sentido da frase: (Machado de Assis)

48
Lngua Portuguesa
Todavia, a linguagem enftica justifica a concordncia Nas locues verbais formadas com os verbos auxiliares
com o sujeito da orao principal: poder e dever, na voz passiva sinttica, o verbo auxiliar con-
cordar com o sujeito. Exemplos:
6RXHXTXHP prendo DRVFpXVDWHUUD
(Gonalves Dias) No se podem cortar essas rvores.
[sujeito: rvores; locuo verbal: podem cortar]
eVWXTXHPds IUHVFRUjPDQVDEULVD
(Gonalves Dias) Devem-se ler bons livros.
[= Devem ser lidos bons livros]
1yVVRPRVRVJDOHJRVTXH levamos DEDUULFD
(Camilo Castelo Branco) Entretanto, pode-se considerar sujeito do verbo principal a
orao iniciada pelo infinitivo e, nesse caso, no h locuo
6RPRVQyVTXHPDfazemos verbal e o verbo auxiliar concordar no singular. Assim:
(Ricardo Ramos)
No se pode cortar essas rvores.
A concordncia do verbo precedido do pronome relativo
[sujeito: cortar essas rvores; predicado: no se pode]
que far-se- obrigatoriamente com o sujeito do verbo (ser) da
orao principal, em frases do tipo: Deve-se ler bons livros.
[sujeito: ler bons livros; predicado: deve-se]
Sou eu que pago.
s tu que vens conosco?
Em sntese: de acordo com a interpretao que se esco-
Somos ns que cozinhamos.
lher, tanto lcito usar o verbo auxiliar no singular como no
Eram eles que mais reclamavam.
plural. Portanto:
Concordncia com os pronomes de tratamento
No se podem [ou pode] cortar essas rvores.
Devem-se [ou deve-se] ler bons livros.
Os pronomes de tratamento exigem o verbo na 3 pessoa,
embora se refiram 2 pessoa do discurso: Verbos impessoais
Vossa Excelncia agiu com moderao.
Os verbos haver, fazer (na indicao de tempo), passar
Vossas Excelncias no ficaro surdos voz do povo.
de (na indicao de horas), chover e outros que exprimem
9RVVD 0DMHVWDGH QmR pode consentir que os touros lhe
fenmenos meteorolgicos, quando usados como impesso-
PDWHPRWHPSRHRVYDVVDORV
ais, ficam na 3 pessoa do singular:
(Rebelo da Silva)
No havia ali vizinhos naquele deserto.
Concordncia com certos substantivos prprios
Havia j dois anos que no nos vamos.
no plural
Aqui faz veres terrveis.
Faz cinco anos que ele morreu.
Certos substantivos prprios de forma plural, como Esta-
dos Unidos, Andes, Campinas, Lusadas, etc., levam o verbo
Observaes:
para o plural quando se usam com o artigo; caso contrrio, o
verbo concorda no singular.
1. Tambm fica invarivel na 3 pessoa do singular o verbo
2V(VWDGRV8QLGRV so o pas PDLVULFRGRPXQGR que forma locuo com os verbos impessoais haver ou fazer:
(Eduardo Prado)
Dever haver cinco anos que ocorreu o incndio.
Os Andes se estendem da Venezuela Terra do fogo.
Vai fazer cem anos que nasceu o genial artista.
2V/XVtDGDVimortalizaram Lus de Cames.
2. O verbo chover, no sentido figurado [=cair ou sobrevir em
Campinas orgulha-se de ter sido o bero de Carlos Go- grande quantidade], deixa de ser impessoal e, portanto con-
mes. cordar com o sujeito:

Minas Gerais possui grandes jazidas de ferro. Choviam ptalas de flores.

Tratando-se de ttulos de obras, comum deixar o verbo Choveram comentrios e palpites.


no singular, sobretudo com o verbo ser seguido de predicati-
vo no singular: 3. Na lngua popular brasileira generalizado o uso de ter,
impessoal, por haver, existir. Nem faltam exemplos em es-
$V9DONtULDVmostra claramente o homem que existe por critores modernos:
GHWUiVGRPDJR
2V6HUW}HV XPHQVDLRVRFLROyJLFRHKLVWyULFR 1RFHQWURGRSiWLRtem uma figueira velhssima, com um
EDQFRHPEDL[R
(Jos Geraldo Vieira)
Concordncia do verbo passivo
4. Existir no verbo impessoal. Portanto:
Quando apassivado pelo pronome apassivador se, o
verbo concordar normalmente com o sujeito:
Nesta cidade existem [e no existe] bons mdicos.
Vende-se a casa e compram-se dois apartamentos.
No deviam [e no devia] existir crianas abandonadas.
Gastaram-se milhes, sem que se vissem resultados
concretos.

49
Lngua Portuguesa
Concordncia do verbo ser Ns que trabalhvamos.
[= ramos ns que trabalhvamos.]
O verbo de ligao ser concorda com o predicativo nos
seguintes casos: Da mesma forma se diz, com nfase:

1) quando o sujeito um dos pronomes tudo, o, isto, isso, Vocs so muito atrevidos.
ou aquilo:
Era uma vez
Tudo eram hipteses.
Na mocidade tudo so esperanas. Por tradio, mantm-se invarivel a expresso inicial de
histrias era uma vez, ainda quando seguida de substantivo
A concordncia com o sujeito, embora menos comum, plural:
tambm lcita:
Era uma vez dois cavaleiros andantes.
Tudo flores no presente.
A no ser
O verbo ser fica no singular quando o predicativo for-
mado de dois ncleos no singular: geralmente considerada locuo invarivel, equivalente
a exceto, salvo, seno. Exemplos:
Tudo o mais soledade e silncio.
Nada restou do edifcio, a no ser escombros.
2) quando o sujeito um nome de coisa, no singular, e o A no ser alguns pescadores, ningum conhecia aquela
predicativo um substantivo plural: praia.

A cama so umas palhas. Mas no constitui erro usar o verbo ser no plural, fazen-
A causa eram os seus projetos. do-o concordar com o substantivo seguinte, convertido em
sujeito da orao infinitiva. Exemplos:
Observao:
A no serem os antigos companheiros de mocidade,
O sujeito sendo nome de pessoa, com ele concordar o ningum o tratava pelo nome prprio.
verbo ser:
Haja vista
Emlia os encantos de sua av.
A expresso correta haja vista, e no haja visto. Pode
3) quando o sujeito uma palavra ou expresso de sentido ser construda de trs modos:
coletivo ou partitivo, e o predicativo um substantivo no plural:
Hajam vista os livros desse autor. [= tenham vista, vejam-
A maioria eram rapazes. se]
O resto so trastes velhos. Haja vista os livros desse autor. [= por exemplo, veja]
Haja vista aos livros desse autor. [= olhe-se para, atente-
4) quando o predicativo um pronome pessoal ou um subs- se para os livros]
tantivo, e o sujeito no pronome pessoal reto:
Bem haja. Mal haja
O Brasil, senhores, sois vs.
O dono da fazenda sers tu. Bem haja e mal haja usam-se em frases optativas e
imprecativas, respectivamente. O verbo concordar normal-
5) quando o predicativo o pronome demonstrativo o ou a mente com o sujeito, que vem posposto:
palavra coisa:
Bem haja Sua Majestade!
Divertimentos o que no lhe falta. Mal hajam as desgraas da minha vida...
Mentiras, era o que me pediam, sempre mentiras.
Concordncia dos verbos bater, dar e soar
6) nas locues muito, pouco, suficiente, demais,
mais (ou do que), menos que (ou do que), etc., cujo Referindo-se s horas, os trs verbos acima concordam
sujeito exprime quantidade, preo, medida, etc.: regularmente com o sujeito, que pode ser hora, horas (claro
ou oculto), badaladas ou relgio:
Seis anos era muito.
Dois mil dlares pouco. Deu trs horas o relgio da botica.
Bateram quatro horas da manh em trs torres a um
Na indicao das horas, datas e distncias, o verbo ser tempo...
impessoal (no tem sujeito) e concordar com a expresso
designativa de hora, data ou distncia: Concordncia do verbo parecer

Era uma hora da tarde. Em construes com o verbo parecer seguido de infiniti-
Eram duas horas da tarde. vo, pode-se flexionar o verbo parecer ou o infinitivo que o
acompanha:
Locuo de realce que
As parede pareciam estremecer. (construo corrente)
Eu que tenho a ordem aqui. As paredes parecia estremecerem. (construo literria)
[= Sou eu que mantenho a ordem aqui.]

50
Lngua Portuguesa
Concordncia com o sujeito oracional EXERCCIOS

O verbo cujo sujeito uma orao concorda obrigatoria- 1 Num dos advrbios abaixo no se observa a concordn-
mente na 3 pessoa do singular: cia prescrita pela gramtica:
a) No se apanham moscas com vinagre.
Parecia que os dois homens estavam bbados. b) Casamento e mortalha no cu se talha.
verbo sujeito (orao subjetiva) c) Quem ama o feio bonito lhe parece.
d) De boas ceias, as sepulturas esto cheias.
Faltava dar os ltimos retoques.
verbo sujeito (orao subjetiva) 2 Assinale a opo correta quanto concordncia verbal:
a) Devem haver outras razes para ela ter desistido.
Concordncia com sujeito indeterminado b) Foi ento que comeou a chegar um pessoal estranho.
c) Queria voltar a estudar, mas faltava-lhe recursos.
O pronome se pode funcionar como ndice de indetermi- d) No se admitir excees.
nao do sujeito. Nesse caso, o verbo concorda obrigatoria-
mente na 3 pessoa do singular. 3 Assinale a opo correta:
a) Mais de um retirante se afastou do servio.
Em casa, fica-se mais vontade. b) Qual de vs sabeis o destino do retirante?
c) Podem haver, no campo, dias horrveis.
Concordncia com os numerais milho, bilho e trilho d) Espera-se dias mais propcios.

Estes substantivos numricos, quando seguidos de subs- 4 Indique a alternativa correta:


tantivo no plural, levam, de preferncia, o verbo ao plural. a) Tratavam-se de questes fundamentais.
Exemplos colhidos nos melhores jornais do Rio de Janeiro e b) Comprou-se terrenos nos subrbios.
de So Paulo: c) Precisam-se de datilgrafos.
d) Reformam-se ternos.
8PPLOKmRGHILpLVagruparam-VHHPSURFLVVmR
5 J ______ uns pares de anos que no ia cidade natal;
Concordncia com numerais fracionrios nem sabia que ________ ocorrido tantas construes l.
a) deviam fazer, haviam b) devia fazer, haviam
De regra, a concordncia do verbo efetua-se com o nume- c) deviam fazer, havia d) devia fazerem, havia
rador.
6 - Assinale o item correto quanto concordncia verbal:
Um quinto dos bens cabe ao menino. a) Fazem quatro anos que no viajo.
Dois teros da populao vivem da agricultura. b) Batem quatro horas o relgio da matriz.
c) Existem fatos que ainda no foram revelados.
Concordncia com percentuais d) Sobra-lhe motivos para poder considerar-se uma pessoa
feliz.
O verbo deve concordar com o nmero expresso na por-
centagem: 7 Todas as alternativas abaixo esto corretas quanto
concordncia nominal, exceto:
S 1% dos eleitores se absteve de votar. a) Foi acusado de crime de lesa-ptria.
S 2% dos eleitores se abstiveram de votar. b) As declaraes devem seguir anexas ao processo.
c) Eram rapazes os mais elegantes possvel.
Concordncia com o pronome ns subentendido d) Seguiram automveis, cereais e geladeiras exportados.

O verbo concorda com o pronome subentendido ns em 8 Elas ___ providenciaram os atestados, que enviaram
frases do tipo: ____ s procuraes, como instrumentos ____ para fins
colimados.
Todos estvamos preocupados. [= Todos ns estamos a) mesmas, anexos, bastantes
preocupados.] b) mesmo, anexo, bastante
Os dois vivamos felizes. [= Ns dois vivamos felizes.] c) mesmas, anexo, bastante
d) mesmo, anexos, bastante
Seno
9 Em todas as frases a concordncia se fez corretamente,
Em frases negativas em que seno equivale a mais que, exceto em:
a no ser, e vem seguido de substantivo plural, costuma-se a) Os soldados, agora, esto todos alerta.
usar o verbo no plural, fazendo-o concordar com o sujeito b) Ela possua bastante recursos para viajar.
oculto outras coisas. Exemplos: c) As roupas das moas eram as mais belas possveis.
d) Rosa recebeu o livro e dissH0XLWRREULJDGD
Do antigo templo grego no restam seno runas.
Da velha casa no sobraram seno escombros. 10 Assinale a opo em que meio funciona como advrbio:
a) Fica no meio do quarto.
Mais de, menos de b) Quero meio quilo.
c) Est meio triste.
O verbo concorda com o substantivo que se segue a d) Achei o meio de contraste.
essas expresses:
Mais de cem pessoas perderam suas casas, na enchen- RESPOSTAS
te. 1-B 2-B 3-A 4-D 5-B
Gastaram-se menos de dois gales de tinta. 6-C 7-C 8-A 9-B 10 - C

51
Lngua Portuguesa
EXERCCIOS
REGNCIA NOMINAL E VERBAL
1) Assinale a alternativa incorreta quanto regncia nominal:

Regncia trata das relaes de dependncia entre um a) Ele sempre foi desfavorvel a sua contratao.
nome ou um verbo e seus complementos. Quando um termo b) Era uma pessoa curiosa de religio.
exige complemento o chamamos de regente e o termo com- c) Permaneciam atentos de problemas financeiros.
plementar de regido. H dois tipos: regncia nominal e re- d) A cerveja prefervel ao vinho.
gncia verbal. e) Sou favorvel a uma nova reunio.

REGNCIA NOMINAL 2) Assinale a alternativa que no admite ambas as regncias:

Quando o termo regente um nome (substantivo, adjetivo a) As crianas esto imunes ao / do vrus da gripe.
ou advrbio). b) Tenho horror a / de insetos.
c) Este filme contemporneo ao / de outro.
Tenho amor ao prximo. d) Sou devoto ao / de Santo Expedito.
termo regente termo regido e) O manual constitudo de / por novas regras
(substantivo) (complemento nominal)
de acentuao.
Estou preocupado com o desemprego. 3) Jorge estava habituado ............... trabalhar noite,
termo regente termo regido
(adjetivo) (complemento nominal) mas isto no era benfico ............... sua sade,
descontente .............. a situao, pediu demisso.
Agiram favoravelmente sua deciso.
termo regente termo regido a) por - a com
(advrbio) (complemento nominal) b) - com
c) - a - pela
H nomes que admitem mais de uma preposio sem que d) a com
o sentido seja alterado. e) em em

Estou apto a este tipo de trabalho.


Estou apto para este tipo de trabalho. 4) As palavras aluso, erudito, passvel regem, respectiva-
mente, as preposies:
H outros nomes, que dependendo do sentido, pedem
outras preposies. a) a - em - de
b) de - em - com
Tenho muita considerao por pessoas que trabalham. c) por - de - em
Tenho muita considerao sobre o trabalho filantrpico. d) a - de - de
e) por - em - de
Veja alguns nomes com as respectivas regncias:

acessvel a equivalente a 5) Joana muito cuidadosa ............... os filhos, j seu


acostumado a, com erudito em marido desatento ............... tudo.
adaptado a escasso de
aflito com, por essencial para a) a com
agradvel a estranho a b) com por
alienado de fcil de
aluso a falta de
c) a - de
ambicioso de fiel a d) a por
anlogo a firme em e) com - a
apto a, para generoso com
atento a, em grato a
averso a, para, por hbil em 6) Assinale a alternativa incorreta quanto regncia nominal:
vido de, por habituado a
benfico a horror a
a) Sou contrrio ao voto dele.
capaz de, para hostil a
compatvel com impossvel de
b ) Sua atitude no foi compatvel ao seu pensamento.
compreensvel a imprprio para c) Ele era entendido em histria.
comum a, de imune a, de d) Fica prximo ao Largo do Paissandu.
constante de, em indeciso em e) Sou leal aos meus princpios.
constitudo de, por, com independente de, em
contemporneo a, de indiferente a
contguo a indigno de 7) Ocorre regncia nominal inadequada em:
contrrio a leal a
cuidadoso com medo a, de a) Ele sempre foi insensvel a elogios.
curioso de, a necessrio a
b) Estava sempre pronta a falar.
desatento a negligente em
desejoso de passvel de c) Sempre fui solcito com a moa.
desfavorvel a perito em d) Estava muito necessitado em carinho.
devoto a, de possvel de e) Era impotente contra tantas maldades.
diferente de prefervel a
difcil de prejudicial a RESPOSTAS
digno de prximo a, de 1-C 2-B 3-D 4-A 5-E 6-B 7-D
entendido em relacionado com

52
Lngua Portuguesa
REGNCIA VERBAL 1RVHQWLGRGHmorar, residir intransitivo.

Quando o termo regente um verbo. H dois anos ele assiste em So Paulo


VI
Precisamos de alimento.
termo regente termo regido Agradecer
(verbo) (objeto indireto)
REMHWRUHIHULQGR-se a coisa, transitivo direto.
H verbos que admitem mais de uma regncia sem
que o sentido seja alterado. Agradeci o presente. Agradeci-o.
VTD OD
Nunca esquecerei os favores que fez.
verbo transitivo direto objeto direto REMHWRUHIHULQGR-se a pessoa, transitivo indireto
(preposio a).
Nunca esquecerei dos favores que me fez.
verbo transitivo indireto objeto indireto Agradeci ao mdico. Agradeci-lhe.
VTI OI
H outros verbos que mudando a regncia, mudam de
significado. FRPRVGRLVREMHWRVpWUDQVLWLYRGLUHWRHLQGLUHWR
O policial visou o alvo e atirou. Agradeci o presente mame.
transitivo direto
Agradeci-o mame.
(visar = apontar, mirar)
Agradeci-lhe o presente.
Ele visava a uma boa colocao na firma.
transitivo indireto
(visar = pretender) Ajudar

REGNCIA DE ALGUNS VERBOS pWUDQVLWLYRGLUHWR

Agradar e desagradar Sempre ajudo mame nos afazeres de casa.


VTD OD
1RVHQWLGRGHfazer carinho, transitivo direto.
pWUDQVLWLYRGLUHWRHLQGLUHWR SUHSRVLomRa).
O pai agradava a filha.
VTD OD Ajudei-a a lavar a loua.
VTDI OD OI
1RVHQWLGRGHcontentar, transitivo indireto (preposio a).

O filme agradou ao pblico. Amar


VTI OI
pWUDQVLWLYRGLUHWR
Aspirar
As crianas amam seus brinquedos.
1RVHQWLGRGHrespirar, sorver, transitivo direto. VTD OD

Aspirei o ar da manh. pLQWUDQVLWLYR


VTD OD
Amei demais e no fui correspondido.
QRVHQWLGRGHpretender, desejar, transitivo indireto VI
(preposio a).

Ele aspirava ao cargo de diretor. Apelar


VTI OI
pWUDQVLWLYRLQGLUHWR SUHSRVLomRpara e de).
Assistir
No conseguindo resolver seus problemas, apelou para os pais.
1RVHQWLGRGHver, transitivo indireto (preposio a). VTI OI

Assistimos ao jogo de basquete. Atender


VTI OI
1RVHQWLGRGHlevar em considerao, transitivo indireto
 1R VHQWLGR GH prestar assistncia, ajudar, transitivo (preposio a).
direto.
Teobaldo no atendia aos pais.
A enfermeira assistiu o paciente com muito cuidado. VTI OI
VTD OD
 1R VHQWLGR GH satisfazer, atentar, observar, transitivo
1RVHQWLGRGHpertencer, caber, transitivo indireto indireto (preposio a).
(preposio a).
Assiste ao diretor comunicar as novas regras. Mame atendia a todas as vontades de Joo.
VTI OI VTI OI

53
Lngua Portuguesa
1RVHQWLGRGHacolher ou receber, transitivo direto. Ensinar

O diretor da escola atendeu os pais. eWUDQVLWLvo direto e indireto.


VTD OD
Helena ensina ingls aos alunos.
1RVHQWLGRGH conceder ou deferir um pedido, transitivo VTDI OD OI
direto.

O chefe no atendeu as exigncias dos empregados. Esquecer e lembrar


VTD OD
eWUDQVLWLYRGLUHWRTXDQGRQmRIRUSURQRPLQDO
Atingir
Esqueci o seu nome.
pWUDQVLWLYRGLUHWR Lembrei o seu aniversrio.

O policial no atingiu o alvo. eWUDQVLWLYRLQGLUHto quando for pronominal (preposio de).


VTD OD
Esqueci-me do seu nome.
Chamar Lembrei-me do seu aniversrio.

1RVHQWLGRGHconvidar, convocar, transitivo direto.


Informar
Ns chamamos os acionistas para uma reunio de emergncia.
VTD OD
eWUDQVLWLYRGLUHWRHLQGLUHWR
1RVHQWLGRGHdenominar, cognominar, transitivo
Informou os colegas de seus problemas.
direto ou transitivo indireto. VTDI OD OI

Chamaram- no empregadinho. Informou aos colegas os seus problemas.


VTD VTDI OI OD
Chamaram- no de empregadinho.
VTD preposio
Ir
Chamaram- lhe empregadinho.
VTI
eLQWUDQVLWLYR FRPSUHSRVLomR 
Chamaram- lhe de caloteiro.
VTDI preposio
objeto predicativo do objeto Fui escola.
VI

Chegar Fui para Salvador.


VI
 intransitivo (preposio a).

Cheguei escola. Namorar


VI adjunto adverbial
eWUDQVLWLYRGLUHWR
Consistir
Joo namorou Clara durante cinco anos.
pWUDQVLWLYRLQGLUHWR SUHSRVLomRem). VTD OD

O futuro da nossa empresa consiste em nossa honestidade.


VTI OI Obedecer e desobedecer

Contentar-se eWUDQVLWLYRLQGLUHWR SUHSRVLomRa).

pWUDQVLWLYRLQGLUHWR SUHSRVLomRcom, em, de). Os filhos obedecem aos pais.


VTI OI
Ela contenta-se com to pouco.
VTI OI Aquele motorista desobedeceu aos sinais.
VTI OI
Custar

1RVHQWLGRGHser custoso, ser difcil, transitivo indireto. Pagar e perdoar

Custou mame acreditar naquele terrvel acidente. eWUDQVLWLYRGLUHWRTXDQGRRREMHWRUHIHUH-se coisa.


VTI OI
Vou pagar o livro.
1RVHQWLGRGHacarretar, transitivo direto e indireto. VTD OD

O trabalho custou-nos muita ateno. Papai perdoou suas falhas.


VTDI OI OD VTD OD

54
Lngua Portuguesa
 e WUDQVLWLYR LQGLUHWR TXDQGR R REMHWR UHIHUH-se pessoa 1RVHQWLGRGHpassar visto, transitivo direto.
(preposio a).
O gerente visou o cheque.
Vou pagar ao dentista. VTD OD
VTI OI
1RVHQWLGRGHpretender, ter em vista, transitivo
Papai perdoou aos meninos. indireto (preposio a).
VTI OI
Sempre visei ao seu bem.
eWUDQVLWLYRGireto e indireto quando possui os dois objetos. VTI OI

Papai perdoou as falhas aos meninos.


VTDI OD OI EXERCCIOS

Precisar
1) Assinale a regncia verbal incorreta:
1RVHQWLGRGHmarcar com preciso, transitivo direto.
a) Visei um passaporte e fui viajar.
O reprter no precisou o local do acidente. b) Quero um bom emprego.
VTD OD c) Aninha sempre obedece a me.
 1R VHQWLGR GH necessitar, transitivo indireto (preposio d) Esqueci-me do endereo.
de). e) Simpatizo com voc.

Eu preciso de silncio para pensar. 2) Escolha a regncia verbal correta do verbo chamar:
VTI OI
a) Chamamo-la de esperta.
Preferir b) Chamamo-la esperta.
c) Chamamos-lhe esperta.
eWUDQVLWLYRGLUHWR e indireto (preposio a). d) Todas as alternativas esto corretas.
e) Nenhuma das alternativas est correta.
Prefiro vinho a cerveja.
VTDI OD OI 3) A regncia est correta em:

Prefiro o vinho cerveja. a) Prefiro caf do que ch.


b) Pedro namora com Joana.
Presidir c) Informei o endereo ao turista.
d) Cheguei na casa de Marta s cinco horas.
eWUDQVLWLYRGLUHWRRXWUDQVLWLYRLQGLUHWR e) Ele contenta-se por to pouco.

Ele presidiu a Cmara dos Deputados. 4) Assinale a alternativa em que o verbo custar tem o
VTD OD mesmo significado da orao abaixo:
Ele presidiu Cmara dos Deputados. &XVWD-PHDFUHGLWDUTXHYRFrGLVVHLVVR
VTI OI
a) A ida ao teatro custou-lhe caro.
Querer
b) Naquela tarde custou-me chegar escola.
c) A perda dos documentos custou-me muito.
1RVHQWLGRGHdesejar, transitivo direto.
d) Quanto custa esta joia?
e) Os alimentos custam muito caro.
Quero uma boa casa para morar.
VTD OD
5) Assinale a regncia verbal incorreta:
1RVHQWLGRGHestimar, gostar, transitivo indireto
(preposio a). a) No informaram aos alunos sobre as provas.
b) No informaram os alunos sobre as provas.
c) No informaram aos alunos as provas.
Quero bem ao Bruno.
VTI OI d) No informaram os alunos das provas.
e) No informaram das provas aos alunos.

Simpatizar e antipatizar 6) Assinale a regncia verbal incorreta:

eWUDQVLWLYRLQGLUHWR SUHSRVLomRcom) a) assistir ao jogo (= ver)


b) assistir o paciente (= prestar assistncia)
Simpatizo com Lusa. c) assistir em Minas Gerais (morar)
d) assistir o professor (= caber)
Visar e) assiste ao menino (= pertencer)

1RVHQWLGRGHapontar, mirar, transitivo direto.


RESPOSTAS
O atirador visou o alvo. 1-C 2-D 3-C 4-B 5-A 6-D
VTD OD

55
Lngua Portuguesa
Observao:
COLOCAO PRONOMINAL
Se houver partcula atrativa, dever ser usada a prclise.
Assim:
Os pronomes oblquos tonos (o, a, os, as, lhe, lhes, me,
te, se, nos, vos) podem ocupar trs posies na orao em No o compreenderia.
relao ao verbo:
Uso da nclise
a) antes do verbo neste caso tem-se a prclise e diz-se
que o pronome est procltico. Emprega-se, geralmente, a nclise:

Nunca se fala nestas coisas aqui. com verbos no incio do perodo:


Quero que todos me acompanhem.
Sabe-se que a temperatura global est em mdia cerca
b) no meio do verbo tem-se a mesclise, e o pronome de meio grau Celsius mais alta do que h 100 anos.
est mesocltico.
com verbos no modo imperativo afirmativo:
Ajudar-te-ei amanh sem falta.
Dir-lhe-ei depois o que desejo. Diga, diga-lhe toda a verdade.

c) depois do verbo tem-se, ento, a nclise, e o pronome Levante-se da, senhor Belchior...
est encltico.
com verbos no gerndio, desde que no venham precedi-
Ouviu-se um alarido. dos da preposio em:
Faltavam-me alguns relgios.
Para tratar o enfermo, no basta ter pena dele, consolan-
Uso da prclise do-o e ouvindo-o com interesse.

A prclise ser obrigatria: com verbos no infinitivo impessoal:

quando houver palavra de sentido negativo antes do ver- No sou desumano, no traria o bicho aqui para maltrat-
bo. lo.
Casos especiais
Nada lhe posso dizer.
Ningum me procurou. A seguir, alguns casos em que o pronome oblquo vem
acompanhado de locuo verbal.
quando conjuno subordinativa e pronome relativo esti-
verem presentes na orao. a) Quando o verbo principal de uma locuo verbal encon-
tra-se no infinitivo ou no gerndio, coloca-se o pronome obl-
Quero que me entendas. quo depois do verbo auxiliar ou depois do verbo principal:
Ainda que a encontre, no conversaremos.
O recibo que lhe deram no vlido. Quero-lhe pedir dinheiro. Quero pedir-lhe dinheiro.
v. auxiliar v. principal v. auxiliar v. principal
em oraes iniciadas por palavras interrogativas. no infinitivo no infinitivo

Quando nos enviaro as passagens? Observao:


Quem te perdoou a dvida?
Se a locuo verbal vier precedida de partcula atrativa, o
em oraes que exprimem desejo, iniciadas por palavras pronome dever vir antes do verbo auxiliar ou depois do
exclamativas. verbo principal:

Deus me acuda! No lhe quero pedir dinheiro. No quero pedir-lhe dinheiro.


Como me recordo daquele feriado! partcula v. auxiliar partcula v. auxiliar
atrativa atrativa
quando se usar gerndio com em.
b) Quando o verbo principal de uma locuo verbal encontra-
Em se tratando de medicina, ele especialista. se no particpio, coloca-se o pronome oblquo depois do ver-
Em se apresentando condies, faremos o que pedes. bo auxiliar:

Uso da mesclise Tinha-me consultado sobre a sua deciso.


v. auxiliar v. principal no particpio
Usa-se a mesclise os seguintes tempos verbais:
Observao:
futuro do presente:
Se a locuo verbal vier precedida de partcula atrativa, o
pronome oblquo dever vir antes do verbo auxiliar:
Dir-lhe-ei a verdade na ocasio certa.
No me tinha consultado sobre a sua deciso.
futuro do pretrito: partcula v. auxiliar
atrativa
Dir-lhe-ia a verdade na ocasio certa.

56
Lngua Portuguesa
EXERCCIOS 9 - Substituindo o termo grifado pelo pronome tono corres-
pondente, marque a alternativa em que houve erro na colo-
cao pronominal.
1 A colocao do pronome tono est incorreta apenas em:
a) Entreguei O BILHETE AO GUARDA. Entreguei-LHO.
a) No poderia consult-lo fraca luz da masmorra. b) Ningum exigiu-ME O SEGREDO. Ningum exigiu-MO
b) Nunca mais v-los-ia, nunca! c) Dariam UM PRMIO AO VENCEDOR. Dar-LHO-iam.
c) Quaresma, porm, enganava-se em parte. d) Meu irmo NOS emprestou a bicicleta. Meu irmo NO-LA
d) O que o fazia sofrer era aquela semivida de moa, mergu- emprestou.
lhada na loucura e na modstia.
10) Assinale a alternativa correta quanto colocao do
2 Assinale a alternativa em que o pronome oblquo esteja pronome.
colocado de maneira correta, segundo a norma culta gramati-
cal. a) Preciso v-lo, me disse o rapaz.
b) Este um trabalho que absorve-me muito.
a) Talvez tenha solicitado-me o pedido. c) Em tratando-se frutas, prefiro as ctricas.
b) Jamais convidei-o para compor minha equipe. d) Tudo se resolve com o tempo.
c) Se for necessrio, calarei-me.
d) At l muitos s se tero arrependido. 11) Complete os espaos da frase abaixo:

3 Assinale a alternativa em que ocorre nclise: Quem _____________ estragado que __________ de
______________________.
a) Os senadores cujos mandatos se prorrogaram foram
cassados. a) o trouxe, encarregue-se, consert-lo.
b) Repetir-se-, assim, o que neste ano j aconteceu com b) o trouxe, se encarregue, consert-lo.
tantos outros feriados. c) trouxe-o, se encarregue, o consertar.
c) Para assust-lo, os soldados atiram a esmo. d) trouxe-o, encarregue-se, consert-lo.
d) No nos iludamos, o jogo est feito.
12) Assinale a frase gramaticalmente correta.
4 Assinale a alternativa em que ocorre prclise:
a) Quando recebe-o em minha casa, fico feliz.
a) Apanhei-te, cavaquinho. b) Por este processo, teriam-se obtido melhores resultados.
b) Quem te viu, quem te v. c) Tudo fez-se como voc mandou.
c) At o final do ano, abster-me-ei da meditao contempla- d) Em se tratando disto, podemos contar com ele.
tiva.
d) Faa-se logo o que precisa ser feito. 13) H um erro de colocao pronominal em:

5 - $VIRWRVTXHHVto timas; ................ em breve a) Sempre a quis como namorada.


FRQIRUPHSRUWHOHIRQH b) Os soldados no lhe obedeceram s ordens.
c) Todos me disseram o mesmo.
a) me mandaram; devolv-las-ei; lhes informei. d) Recusei a ideia que apresentaram-me.
b) mandaram-me; devolverei-as; informei-lhes
c) me mandaram; devolverei-as; lhes informei 14) O oblquo O coloca-se procltico (antes do verbo) nos
d) mandaram-me; devolv-las-ei; informei-lhes perodos abaixo, exceto em:

6 - Assinale a afirmao incorreta: a) Deus ___ livre ___ de um tropeo na prova!


b) Como ___ achou ___ ontem.
a) Usa-se a prclise quando o verbo vem precedido de ex- c) No quis o rapaz aqui, ___ mandei ___ embora.
presses negativas; d) Talvez ___ encontre ___ na outra sala.
b) Usa-se a prclise com verbo no infinitivo;
c) Usa-se a mesclise com o verbo no futuro do presente e 15) O pronome que substitui corretamente o segmento grifa-
no futuro do pretrito; do, respeitando tambm as exigncias de colocao prono-
d) Usa-se a nclise quando a frase se inicia com o verbo. minal, est em:

7 H prclise na alternativa: a) no haveria limites para a atividade humana = no haveria-


os.
a) Queixar-me-ei com a professora. b) detonando a questo das mudanas do clima = as deto-
b) Vou esconder-me no sto. nando.
c) A menina, curvando-se, pegou a flor. c) as principais produtoras criaram um sistema conjunto =
d) Pouco importa que lhe perdoem. criaram-no.
d) para aumentar a eficincia de hardwares e softwares =
8 H nclise na alternativa: aument-los.

a) Ele se arrependeu e voltou.


b) Quero-te. RESPOSTAS
c) Eu lhe telefonarei. 1-B 2-D 3-C 4-B 5-A
d) Nada o anima. 6-B 7-D 8-B 9-B 10 D
11 - B 12 - D 13 - D 14 - C 15 - C

57
Lngua Portuguesa
CASOS EM QUE O USO DA CRASE OBRIGATRIO
CRASE
QDVORFXo}HVDGYHUELDLVSUHSRVLWLYDVHFRQMXQWLYDV
femininas:
Crase a fuso de duas vogais a + a (), indicada pelo
acento grave. A crase pode ocorrer com a juno da preposi- parte em frente
o com: s vezes espera de
proporo que medida que
RDUWLJRIHPLQLQRa ou as:
Exceo:
Fomos a a escola.
preposio artigo
Locues adverbiais femininas que indiquem instrumento
no levam o acento de crase.
Fomos escola.
a mquina a bala
Ra dos pronomes demonstrativos aquele, aquela, aquilo:
A carta foi escrita a mquina.
Entreguei os documentos a aquele senhor.
preposio pronome demonstrativo
Ele foi ferido a bala.
Entreguei os documentos quele senhor.
QDVH[SUHVV}HV moda de e maneira de, mesmo quando
Ra do pronome relativo a qual (as quais): subentendidas:

A casa a a qual comprei h muitos anos foi demolida. Usava sapatos Lus XV. ( moda de)
preposio pronome relativo
QDLQGLFDomRGHKRUDV
A casa qual comprei h muitos anos foi demolida.
O avio chegar s quinze horas.
A regncia de alguns verbos exige a preposio a.
Veja alguns exemplos:
CASOS FACULTATIVOS
Fui feira.
Pea sua me que lhe conte uma histria. So casos em que pode ou no ocorrer a crase:
Referi-me sua atual situao.
DQWHVGHQRPHVIHPLQLQRV

CASOS EM QUE NO OCORRE A CRASE: No conte isso a ( ) Carla.

DQWHVGHVXEVWDQWLYRVPDVFXOLQRV DQWHVGHSURQRPHVSRVVHVVLYRVIHPLQLQRV

No assisto a jogo de futebol. Obedeo a ( ) minha me.

DQWHVGHYHUERV GHSRLVGDSUHSRVLomRDWp

Assim que cheguei em casa, comeou a chover. Fui at a ( ) escola.

DQWHVGHDUWLJRLQGHILQLGR
CASOS ESPECIAIS
noite iremos a uma festa.
DQWHVGDSDODYUDcasa:
DQWHVGHSronome indefinido:
A palavra casa, no sentido de lar, residncia, no admite o
Desejo a todos boa viagem. uso da crase. Se a palavra casa vier determinada, leva o
acento de crase.
DQWHVGHSURQRPHVSHVVRDLVGRFDVRUHWRGRFDVRREOtTXR
e de alguns pronomes de tratamento que no admitem artigo: Voltei a casa depois do trabalho.

Dei um presente a ela. Vou casa de meus pais nas prximas frias.
Todos se dirigiram a mim.
Contei meus planos a Vossa Majestade. DQWHVGDSDODYUDterra:

TXDQGRRa aparece antes de uma palavra no plural, dando A palavra terra, no sentido de cho firme, no admite o
um sentido genrico: uso da crase. Se a palavra terra vier determinada, leva o
acento de crase.
Ele se referiu a mulheres estranhas.
Depois de meses no navio, os marinheiros voltaram a
QDVH[SUHVV}HVIRUPDGDVSRUSDODYUDVUHSHWLGDV terra.

cara a cara frente a frente Regressarei terra dos meus avs.

58
Lngua Portuguesa
Se estivermos em dvida quanto ao emprego da crase, 4) Assinale a alternativa em que todas as locues devem
basta recorrermos a trs regras bsicas: receber o acento de crase:

1 regra: troca-se a palavra feminina por uma masculina a) as vezes a esmo a parte
correspondente. b) em frente a a espera de a medida que
c) a mquina as vezes a proporo que
Vou feira. Ela visitou a irm. d) a espera de a bala as pressas
Vou ao cinema. Ela visitou o irmo. e) a cabo a esmo - a parte

2 regra: troca-se o a craseado por para a: 5) Todas as alternativas possuem casos facultativos no uso
da crase, exceto:
Irei Argentina. Irei a Portugal.
Ire para a Argentina. Irei para Portugal. a) Vou at farmcia.
b) Ela deu um presente sua melhor amiga.
3 regra: troca-se cheguei de por a e cheguei da por : c) Bento entregou a carta Maria.
d) Beatriz devolver o livro senhora.
Cheguei de Belo Horizonte. e) A professora entregou as notas minha me.
Irei a Belo Horizonte.
6) Aponte a alternativa em que no ocorre o uso da crase:
Cheguei da Bahia.
Irei Bahia. a) Ele age as escondidas.
b) A mulher a qual me refiro minha professora.
c) Dia a dia, os problemas se tornam mais difceis.
EMPREGO DE H E A d) Irei a Austrlia assim que puder.
e) Gosto das coisas as claras.
Essas duas formas, em relao ao tempo, tm o seguinte
uso: 7) Fui .......... cidade .......... dez horas para conhecer
.......... minhas primas.
H: usado no sentido de tempo decorrido, (verbo haver).
a) a - as - as
No o vejo h trs semanas. b) a - s - as
c) - as - s
A: usado no sentido de tempo futuro, (preposio). d) - s - s
e) - s - as
Daqui a cinco dias, retornaremos ao trabalho.
8) Garanto .......... voc que compete .......... ela, pelo menos
EXERCCIOS .......... meu ver, tomar as providncias para resolver o caso.

1) .......... poucos meses, papai referia-se .......... mame com a) a / a / a


muito carinho. b) / / a
c) a / /
a) A d) a / / a
b) H a e) / a /
c) A a
d) H h 9) Foi ............... Braslia aprender ............... artes polticas,
e) H mas retornou ............... terra natal sem grandes conhecimen-
tos.
2) Assinale a alternativa incorreta quanto ao uso do acento de
crase: a) a as d) a as - a
b) as a e) s -
a) Vou a Paris no prximo ano. c) a s
b) Partirei s duas horas.
c) Gosto de comida a italiana. 10) Ainda h pouco, o professor referia-se ............... questes
d) Ele saiu s pressas. ligadas ............... prtica de ensino.
e) Desejo a todos um Feliz Natal.
a) a c) a -
3) Assinale a alternativa que preencha corretamente as b) d) a - a
lacunas das oraes abaixo:
11) Levando-se em conta que alguns nomes de lugar admi-
Ele saiu .......... p. tem a anteposio do artigo, assinale a alternativa em que a
Ele obedece .......... professora. crase foi empregada corretamente:
Pea .......... ela que venha me encontrar.
Vou visitar .......... terra dos meus tios. a) Ele nunca foi Berlim.
b) Ele nunca foi Paris.
a) a - - a - c) Ele nunca foi Itlia.
b) - a - a - d) Ele nunca foi Roma.
c) - - - a
d) a - a - - a RESPOSTAS
e) a - a - a - 1-E 2-C 3-A 4-B 5-D 6-C
7-E 8-A 9-A 10 - C 11 - C

59
Lngua Portuguesa
SDUDVHSDUDUSDODYUDV e expresses explicativas ou retifica-
PONTUAO tivas como por exemplo, ou melhor, isto , alis, alm disso,
ento, etc.

Os sinais de pontuao so recursos utilizados para re- Eles foram praia ontem, alis, anteontem.
presentar os movimentos rtmicos e meldicos da lngua
falada. No h critrios rgidos quanto ao seu uso, mas ao SDUDVHSDUDUWHUPRVGHVORFDGRVGHVXDSRVLomRQRUPDOQD
empreg-los o texto adquire maior clareza e simplicidade. frase:
De doce, eu gosto.
3DUD(YDQLOGR%HFKDUDRVVLQDLVGHSRQWXDomRGDWDPGD
poca relativamente recente na histria da escrita, embora se SDUDVHSDrar elementos paralelos de um provrbio:
possa afirmar uma continuidade de alguns sinais desde os Tal pai, tal filho.
gregos, latinos e alta Idade Mdia; constituem hoje pea
fundamental da comunicao e se impem como objeto de A vrgula entre oraes
estudo e aprendizado.
No perodo composto, emprega-se a vrgula para:
$RODGRGRVJUDIHPDVTXHYHVWHPRVIRQHPDVRVPRr-
femas e as unidades superiores, esses sinais extra- VHSDUDURUDo}HVFRRUGHQDGDVDVVLQGpWLFDV
alfabticos so essencialmente unidades sinttiFDVVLQDLVGH Foi at a cozinha, bebeu um copo de gua, pensou por
RUDomR H VLQDLV GH SDODYUDV Sodendo comutar com unida- alguns instantes, acendeu seu cigarro.
des alfabticas e tomar de emprstimo seu valor.
 VHSDUDU RUDo}HV FRRUGHQDGDV VLQGpWLFDV H[FHWR DV LQLFLa-
Assim, um apstrofo indica a supresso de um grafema, das pela conjuno e, ou e nem:
uma vrgula uma unidade de coordenao ou de subordina- Fez o que pde, pois sentia-se culpado pelo acidente.
o. Na essncia, os sinais de pontuao constituem um tipo
especial de gUDIHPD LVRODUDVRUDo}HVVXERUGLQDGDVDGMHWLYDVH[SOLFDWLYDV
O homem, que um ser inteligente, tambm passvel de
erro.
EMPREGO DOS SINAIS DE PONTUAO
VHSDUDUDVRUDo}HVVXERUGLQDGDVDGYHUELDLVSULQFLSDOPHQWH
1) VRGULA ( , ) quando vm antepostas orao principal:
Quando as frias chegaram, todos foram para o Nordeste.
Geralmente, a vrgula utilizada para dar uma breve
pausa na leitura. SDUDVHSDUDURUDo}HVUHGX]LGDV
Terminada a aula, os alunos foram dispensados.
A vrgula entre os termos de uma orao
No se usa vrgula entre:
Emprega-se a vrgula para:
RVXMHLWRHRSUHGLFDGR
VHSDUDUHOHPHQWRVGHXPDHQXPHUDomR Os alunos da escola formaram uma comisso.
Crianas, jovens e velhos manifestaram-se contra a vio- sujeito predicado
lncia.
RYHUERHVHXVFRPSOHPHQWRV
VHSDUDURDSRVWR O turista pediu informao ao motorista.
Madalena, aquela moa alegre, possua uma vida infeliz. verbo objeto direto objeto indireto

VHSDUDURYRFDWLYR RQRPHHRFRPSOHPHQWRQRPLQDO
O jantar est servido, senhor! A leitura do jornal indispensvel.
nome complemento nominal
VHSDUDURDGMXQWRDGYHUELDODQWHFLSDGR
Logo pela manh, ouviu-se um terrvel estrondo. RQRPHHRDGMXQWRDGQRPLQDO
A claridade da manh entrava pelas janelas.
Observao: Se o adjunto adverbial viesse no final da frase, nome adjunto adnominal
no seria necessrio o uso da vrgula.
 D RUDomR SULQFLSDO H D VXERUGLQDGD VXEVWDQWLYD GHVGH TXH
LVRODURQRPHGROXJDUQDVGDWDV no seja apositiva:
So Paulo, 07 de outubro de 1963. Espero que voc seja feliz.
orao principal orao subordinada substantiva
LQGLFDUDRPLVVmRGHXPWHUPR
2) PONTO FINAL ( . )
Todos estavam alegres; eu, muito triste.
O ponto final usado para representar a pausa mxima
2EVHUYDomR1HVWHH[HPSORIRLRPLWLGRRYHUERHVWDYD
com que se encerra o perodo.
HXHVWDYDPXLWRWULVWH
Emprega-se o ponto final:
GHSRLVGRVLPHGRQmRXVDGRVFRPRUHVSRVWDQRLQtFLRGD
frase:
QRSHUtRGRVLPSOHV
A partida de futebol foi emocionante.
Voc vai escola?
QRSHUtRGRFRPSRVWR
Sim, vou. ou No, vou ficar em casa.
No quero que voc tenha medo de mim.

60
Lngua Portuguesa
QDVDEUHYLDWXUDV a) O ponto de interrogao no empregado nas perguntas
d.C. - depois de Cristo indiretas:
Av. avenida
pl. - plural Melissa perguntou onde estariam os livros que perdeu.

b) O ponto de interrogao e o de exclamao podem apare-


3) PONTO-E-VRGULA ( ; ) cer lado a lado em frases de entonao interrogativa e ex-
clamativa:
O ponto-e-vrgula utilizado para marcar uma pausa
intermediria entre o ponto e a vrgula. O senhor outra vez?! Assim no possvel!

Emprega-se o ponto-e-vrgula para:


6) PONTO DE EXCLAMAO ( ! )
VHSDUDURUDo}HVFRRUGHQDGDVVHXPDGHODVMiWLYHUYtUJXOD
Emprega-se o ponto de exclamao, geralmente,
Fazia muito calor naquela manh; alguns hspedes, pen- depois de:
sava eu, tinham ido piscina.

VHSDUDURUDo}HVFRRUGHQDGDVGHVHQWLGRRSRVWR IUDVHVH[FODPDWLYDV
Que dia lindo!
As crianas viajaro hoje; os adultos amanh.
LQWHUMHLo}HVHRQRPDWRSHLDV
VHSDUDULWHQVGHXPDHQXPHUDomRGHXPUHJXODPHQWRGH Puxa!
um decreto, de uma lei, etc. Plim - plim!

Art. 17 - Fica vedado: YHUERQRLPSHUDWLYR


I - fumar em local fechado; Venha c! Apague a luz!
II - ter animais de grande e mdio porte;
III - usar o ptio para promover festas; 'HSRLVGHYRFDWLYR
IV - usar o salo de festas para reunies. Tenha pacincia, Joo!

4) DOIS-PONTOS ( : ) 7) RETICNCIAS (. . .)

Os dois-pontos so utilizados para marcar uma sensvel As reticncias so utilizadas para indicar que a frase foi
suspenso da voz de uma frase no concluda. interrompida. Emprega-se as reticncias para indicar:

Emprega-se os dois-pontos: G~YLGDKHVLWDomRRXVXUSUHVD

SDUDDQXQFLDUDIDODGDSHUVRQDJHP Eu estava pensando . . . no sei se invisto o dinheiro em


O professor ordenou: aes ou em imveis.
Faam silncio!
LQWHUUXSomRGDIDODGRQDUUDGRURXGDSHUVRQDJHP
SDUDDQXQFiar uma enumerao:
Os entrevistados do programa sero os seguintes: J Eu te amo, disse Lusa em voz baixa. Como Alfredo
Soares, Marta Suplicy, Antonio Fagundes e Paulo Maluf. QmR HVFXWRX /XtVD LD GL]HU RXWUD YH] HX WH . . . PDV IRL
interrompida com a chegada de seu pai.
SDUDDQXQFLDUXPHVFODUHFLPHQWR
Escute bem isto: s se vive bem quando se tem paz. VXSUHVVmRGHSDODYUDV

SDUDDQXQFLDUXPDFLWDomR Samantha parecia impaciente:


O filsofR'HVFDUWHVGLVVH3HQVRORJRH[LVWR Mame, eu quero . . . a senhora sabe . . . eu . . . eu
quero muito bem a senhora.
QDLQYRFDomRGDVFRUUHVSRQGrQFLDV
Prezado amigo: DRILQDOGHXPDIUDVHTXHRVHQWLGRFRQWLQXD

DQWHVGHRUDo}HVDSRVLWLYDV E a vida continua . . .


Ns defendemos uma ideia: que todos devem ter acesso
sade, segurana e educao.
8) PARNTESES ( ( ) )

5) PONTO DE INTERROGAO ( ? ) Os parnteses so usados para intercalar pequenos co-


mentrios que no se encaixam na ordem lgica da frase.
O ponto de interrogao utilizado para marcar as ora-
es interrogativas diretas. Empregam-se os parnteses para:

Onde estaro os livros que perdi? LVRODUSDODYUDVH[SOLFDWLYDV

Observaes: A diretora da escola pediu aos alunos que conservassem


a escola, e todos (menos o Carlos) resolveram ajudar.

61
Lngua Portuguesa
GHVWDFDUGDWDV 11) COLCHETES ( [ ] )
Gregrio de Matos (1633 - 1695) foi a maior expresso
do Barroco brasileiro. Os colchetes so utilizados com a mesma finalidade dos
parnteses, principalmente na linguagem cientfica e religio-
LVRODUIUDVHVLQWHUFDODGDV sa.
O senhor Irineu (que Deus o tenha!) era uma pessoa
arrogante e mal-humorada. estrbico. Adj. 1. Relativo ao, ou prprio do estrabismo
(1). 2. Diz-se de indivduo atacado de estrabismo
 LQGLFDo}HV FrQLFDV HP SHoDV GH WHDWUR URWHLURV GH WHYr (1). [Sin.: caolho, vesgo, zarolho.]
etc.):

(Entra Ivone desesperada) 12) ASTERISCO ( * )


Onde, onde esto as crianas?
O asterisco utilizado para chamar a ateno do leitor
para alguma nota (observao), ou para substituir um nome
9) TRAVESSO ( ) que no se quer mencionar.

O travesso usado para indicar com que pessoa do O Marqus * * *


discurso est a fala.

Emprega-se o travesso para: 13) PARGRAFO ( )

LQGLFDUDPXGDQoDGRLQWHUORFXWRUQRGLiORJR O pargrafo utilizado para indicar um item de um texto


ou artigo de lei.
Bom dia, Jos. Como vai?
Bom dia, querida. Eu estou bem. Art. 1. Constituem Princpios Fundamentais de Contabili-
dade (PFC) os enunciados por esta Resoluo.
LVRODUDSDUWHILQDOGHXPHnunciado: 1. A observncia dos Princpios Fundamentais de Con-
tabilidade obrigatria no exerccio da profisso e consti-
Todos ns cometemos erros erros, s vezes, injustifi- tui condio de legitimidade das Normas Brasileiras de
cveis. Contabilidade (NBC).

LVRODUSDODYUDVRXIUDVHVXVD-se travesso duplo:


14) CHAVE ( { ) OU CHAVES ( { } )
A Chula dana tpica do sul do pas acompanhada
a sanfona ou violo. A chave utilizada para dividir um assunto. As chaves
so muito empregadas em matemtica.
OLJDUJUXSRVGHSDODYUDVTXHLQGLFDPLWLQHUiULR
(Mack / 92) - Sejam os conjuntos
A rodovia Presidente Dutra a estrada que liga Rio A = {x | x mltiplo de 7} e 9 = {x 0 |12 < x < 864}.
So Paulo. Ento o nmero de elementos de A 1 B :
a) 78 b) 100 c) 122 d) 146 e) 166
Resposta: Alternativa c.
 $63$6 

As aspas so utilizadas para isolar do contexto frases ou 15) BARRA ( / )


palavras alheias.
A barra muito utilizada nas abreviaes das datas
Empregam-se as aspas: e em algumas abreviaturas.

QRLQtFLRHQRILPGHXPDFLWDomR 01 / 06 / 94
A/C - ao(s) cuidado(s)
'HXVy'HXVRQGHHVWiVTXHQmRUHVSRQGHV"
(Castro Alves) EXERCCIOS

 QDV SDODYUDV RX H[SUHVV}HV HVWUDQJHLUDV DUFDtVPRV QHo- 1) Assinale a alternativa corretamente pontuada:
logismos, grias, etc.
a) Hoje, em dia, atravs do avano da medicina, muitas do-
)XLDRVKRZGR5REHUWR&DUORV enas tm cura.
2QRYRFGGRV7LWmVpVLQLVWUR b) Hoje em dia atravs do avano da medicina, muitas doen-
as, tm cura.
GDUrQIDVHDSDODYUDVHH[SUHVV}HV c) Hoje em dia, atravs do avano da medicina, muitas doen-
as tm cura.
0HXLUPmRQmRpLVVRTXHGLzem. d) Hoje em dia, atravs do avano da medicina muitas doen-
as tm cura.
LURQL]DURVWHUPRVGHXPDRUDomR
1) Observe as frases:
+DYLDVHPSUHXPSRUTXrHPWXGRTXHGL]LD
I - Mame semSUHGL]LD&XLGDGRFRPRVIDOVRVDPLJRV
II - Terminado o discurso, o governador retirou-se.

62
Lngua Portuguesa
III - Espero, que voc alcance seus objetivos. b) Sabe, querida, quem o vencedor?
c) Sabe querida; quem o vencedor?
Verificamos que est (esto) corretamente pontuada( s): d) Sabe, querida, quem o vencedor!

a) apenas a I 10) Aponte a alternativa que preencha as lacunas da frase


b) apenas a II abaixo:
c) apenas a I e a II Estela ..... todo dia ..... segue a mesma rotina ..... trabalhar
d) apenas a III ..... fazer jazz ..... ter aulas de ingls e encontrar seu namo-
rado .....
  1DTXHOH PRPHQWR Vy GHVHMDYD XPD FRLVD TXH $OEHUWR
UHWRUQDVVHRPDLVEUHYHSRVVtYHO a) vrgula, vrgula, aspas, ponto-e-vrgula, vrgula, vrgula
b) vrgula, ponto-e-vrgula, parnteses, vrgula, vrgula, parn-
Assinale a alternativa correta: teses
c) vrgula, vrgula, dois-pontos, vrgula, vrgula, ponto
a) Os dois-pontos antecipam um desejo do autor. d) vrgula, vrgula, vrgula, vrgula, vrgula, ponto
b) Os dois-pontos anunciam uma citao.
c) Os dois-pontos anunciam a fala da personagem. 11) Os trechos seguintes tiveram sinais de pontuao supri-
d) Os dois-pontos anunciam e introduzem um esclarecimento. midos e alterados. Aponte aquele cuja pontuao permane-
ceu gramaticalmente correta:
4) Aponte a frase corretamente pontuada:
a) A ideia do ministro extraordinrio dos Esportes, Edson
a) Ns, isto , Geraldo e eu, resolveremos o problema. Arantes do Nascimento, o Pel de colocar na cadeia "os
b) Ns, isto Geraldo e eu, resolveremos o problema. meninos" que participam de brigas entre torcidas organizadas
c) Ns, isto , Geraldo e eu resolveremos o problema. para ficar no jargo esportivo, uma "bola fora".
d) Ns isto , Geraldo e eu resolveremos o problema. b) Parece que, o Pel do milsimo gol, que pedia escola para
"esses meninos", tambm era bem mais sbio do que o que
5) Assinale a alternativa que preencha as lacunas da frase hoje lhes prope "cadeia".
abaixo: c) Os otimistas olham e dizem: Ah, est meio cheio. Mas os
pessimistas, veem o mesmo copo, a mesma quantidade de
Marisa pensativa retrucou ..... ..... No sei se devo .... meu gua e acham que est meio vazio.
amor .... confiar tanto em voc .... d) A pesquisa, descrita na edio de hoje da revista cientfica
britnica "Nature", mais um dado na busca pelos cientistas
a) dois-pontos, vrgula, vrgula, ponto-e-vrgula, ponto de compreender os mecanismos moleculares da embriog-
b) dois-pontos, travesso, vrgula, vrgula, ponto nese, ou seja, a formao e o desenvolvimento dos seres
c) travesso, aspas, vrgula, vrgula, ponto vivos.
d) aspas, dois-pontos, ponto-e-vrgula, vrgula, ponto
12) Assinale a alternativa em que o texto esteja corretamente
6) As frases abaixo esto corretas quanto sua justificativa, pontuado:
exceto:
a) Enquanto eu fazia comigo mesmo aquela reflexo, entrou
a) No sei se vou ..... se vou ..... se vou falar com ela (as na loja um sujeito baixo sem chapu trazendo pela mo, uma
reticncias indicam uma supresso de ideias). menina de quatro anos.
b) Se decidirmos agora ..... (as reticncias indicam que a b) Enquanto eu fazia comigo mesmo aquela reflexo, entrou
frase continua) na loja, um sujeito baixo, sem chapu, trazendo pela mo,
c) Como vou saber ..... j no tenho mais a mesma autori- uma menina de quatro anos.
dade (as reticncias indicam a interrupo na fala da perso- c) Enquanto eu fazia comigo mesmo aquela reflexo, entrou
nagem) na loja um sujeito baixo, sem chapu, trazendo pela mo uma
d) Tenha muito cuidado ..... meu filho! (as reticncias so menina de quatro anos.
usadas antes do vocativo) d) Enquanto eu, fazia comigo mesmo, aquela reflexo, entrou
na loja um sujeito baixo sem chapu, trazendo pela mo uma
7) Observe a orao: menina de quatro anos.
No vero, comum as pessoas permanecerem nas ruas por
mais tempo. 13) "- Muito bom dia, senhora,
Assinale a alternativa correta quanto ao uso da vrgula: Que nessa janela est;
sabe dizer se possvel algum trabalho encontrar?"
a) separar o aposto (Joo Cabral de Melo Neto)
b) separar palavra explicativa
c) separar o adjunto adverbial antecipado No primeiro verso, senhora vem entre vrgulas porque o ter-
d) separar o vocativo mo :

8) Aponte a orao incorretamente pontuada: a) um aposto.


b) um sujeito deslocado.
a) So Paulo 25 de janeiro de 2002. c) um vocativo.
b) Terminado o trabalho, v descansar. d) um predicativo.
F 2PHXFDFKRUURWHPSHGLJUHH
d) Durante o dia, faz muito calor; noite frio. RESPOSTAS
1-C 2-C 3-D 4-A 5-B
9) Assinale a pontuao correta: 6-D 7-C 8-A 9-B 10 - C
11 - D 12 - C 13 - C
a) Sabe, querida quem o vencedor.

63
Lngua Portuguesa
EXERCCIOS FINAIS 7) A polcia ............... no caso e ................. o mistrio.

Texto para as questes 01 a 06 a) interviu - resolveram


b) interveio - resolveu
O liberalismo uma teoria poltica e econmica que ex- c) interveio - resolveste
prime os anseios da burguesia. Surge em oposio ao abso- d) interviu - resolveu
lutismo dos reis e teoria econmica do mercantilismo, de- e) interviu - resolveste
fendendo os direitos da iniciativa privada e restringindo o
mais possvel as atribuies do Estado. Locke foi o primeiro
terico liberal. Presenciou na Inglaterra as lutas pela deposi- 8) Assinale a orao em que o verbo est incorretamente
o dos Stuarts, tendo se refugiado na Holanda por questes empregado:
polticas. De l regressa quando, vitoriosa a Revoluo de
1688, Guilherme de Orange chamado para consolidar a a) Ele previu o acidente.
nova monarquia parlamentar inglesa. (Maria Lcia de Arruda b) Pea-lhe que intervenha a meu favor.
Aranha, in Histria da Educao) c) Todos se dispuseram a colaborar.
d) Ainda que se prevesse o temporal, a enchente ocorreria.
e) Quando voc o vir, diga-lhe que aguardo sua resposta.
1) Segundo o texto, Locke:

a) participou da deposio dos Stuarts. 9) Assinale a alternativa incorreta:


b) tinha respeito pelo absolutismo.
c) teve participao apenas terica no liberalismo. a) O futuro do subjuntivo expressa um fato que vai acontecer
d) julgava ser necessrio restringir as atribuies do Estado. relacionado a outro fato futuro.
e) no sofreu qualquer tipo de perseguio poltica. b) O pretrito mais-que-perfeito expressa um fato anterior a
outro fato que tambm passado.
c) O pretrito imperfeito expressa um fato j concludo em
2) Infere-se do texto que os burgueses seriam simpticos: poca passada.
d) O presente do subjuntivo expressa um fato atual, expri-
a) ao absolutismo mindo suposio, dvida, possibilidade.
b) ao liberalismo e) O futuro do pretrito expressa um fato futuro, mas de for-
c) s atribuies do Estado ma hipottica em relao a um momento passado.
d) perseguio poltica de Locke
e) aos Stuarts
10) Assinale a alternativa que contm um advrbio de tempo
e de negao:
3) A Revoluo de 1688 foi vitoriosa porque:
a) s vezes, no gosto de pensar no passado.
a) derrubou o absolutismo. b) Atrs da porta ficava uma cadeira velha.
b) implantou o liberalismo. c) Maria andava apressadamente pelas ruas.
c) preservou os direitos de iniciativa privada. d) Agora s espero que voc volte logo.
d) baseou-se nas ideias liberais de Locke. e) Possivelmente iremos ao teatro noite.
e) permitiu que Locke voltasse da Holanda.

11  1D RUDomR 3RVVLYHOPHQWH YLUHL DTXL DPDQKm WHPRV


4 TXHH[SULPHRVDQVHLRVGDEXUJXHVLD>O 'DVDOWe- advrbio de:
raes feitas na passagem acima, aquela que altera substan-
cialmente seu sentido : a) intensidade - tempo - lugar
b) dvida - lugar - tempo
a) a qual expressa os anseios da burguesia. c) modo - lugar - dvida
b) a qual exprime os desejos da burguesia. d) dvida - afirmao - negao
c) que representa os anelos da burguesia. e) afirmao - dvida - lugar
d) que expressa os valores da burguesia.
e) que representa as nsias da burguesia.
12) Nas oraes:

5) A teoria poltica do liberalismo se opunha: I - Vou a Curitiba no prximo ms.


II - Fernanda estuda noite.
a) a parte da burguesia III - Ele a trouxe de Paris.
b) ao mercantilismo IV - Ele beijou a minha mo rapidamente.
c) monarquia parlamentar
d) a Guilherme de Orange temos, respectivamente:
e) ao absolutismo
a) preposio, pronome, preposio, artigo
b) artigo, pronome, preposio, pronome
6) Infere-se do texto que Guilherme de Orange: c) pronome, artigo, pronome, preposio
a) no seria simptico aos burgueses. d) preposio, preposio, pronome, artigo
b) teria ligaes com os reis absolutistas. e) artigo, pronome, pronome, artigo
c) teria ideias liberais.
d) no concordaria com Locke.
e) teria apoiado o exlio de Locke na Holanda. 13) As interjeies caramba! e bravo! indicam estado de:

64
Lngua Portuguesa
a) desejo - espanto a) Papa - V. S.
b) espanto - aplauso b) Cardeal - V. Em
c) aplauso - dor c) Rei - V. Mag
d) animao - advertncia d) Prncipe - V. A.
e) averso - alegria e) Sacerdote - V. Rev.ma

14) Assinale a alternativa corretamente pontuada: 20) Assinale a alternativa incorreta quanto colocao pro-
nominal:
a) No gosto de alguns de seus amigos, ou melhor de ne-
nhum deles. a) Fiquei observando a mulher que se dirigia portaria.
b) No, gosto de alguns de seus amigos, ou melhor de ne- b) Ningum o viu desde ontem.
nhum deles. c) Procurar-me-iam se precisassem de dinheiro.
c) No gosto de alguns, de seus amigos, ou melhor, de ne- d) Me contaram que voc est desempregado.
nhum deles. e) Talvez a encontre na escola.
d) No gosto de alguns de seus amigos, ou melhor, de ne-
nhum deles.
e) No, gosto de alguns, de seus amigos, ou melhor, de ne- 21) ........ partir daquele momento, senti que ......... minha
nhum deles. preocupao no era necessria.

a) a - a
15) Assinale a alternativa em que o diminutivo expressa ideia b) - a
afetiva: c) a -
d) -
a) No vou ler este livreco! e) - h
b) Mariana ganhou uma cartilha nova.
c) Joo sempre toma conta de seu irmozinho.
d) Fui multado por aquele guardinha. 22) Assisti ......... uma pea de teatro ........... cinco dias atrs.
e) No lerei este jornaleco.
a) - a
b) a -
16) Assinale a alternativa que preencha corretamente as c) a - h
lacunas das frases abaixo: d) h - a
e) - h
I - Se tu vais a escola, irei ......................... .
II - Mandaram este comunicado para ...... ler.
III - Voc trouxe o caderno ......................... . 23) Assinale o uso incorreto quanto ao uso do acento de
IV - No existe nada entre ..................... e ele. crase:

a) com voc, mim, consigo, eu a) Chegarei casa de meus parentes daqui a uma semana.
b) contigo, mim, com voc, mim b) Joo foi andar cavalo.
c) contigo, eu, consigo, mim c) Gosto de arroz grega.
d) consigo, eu, consigo, mim d) Assisto novela todas as noites.
e) com voc, eu, com voc, eu e) noite, viajaremos tranquilos.

17) Assinale a alternativa que preencha adequadamente 24) Assinale a alternativa que preenche corretamente as
a orao: lacunas das oraes abaixo:
.............................. bola que est perto de voc minha,
....................... aqui do meu primo. I - Romrio fez um gol ............... Pel.
II - ............... sculos que no a vejo.
a) Aquela esta III - Muita gente veio ............... reunio.
b) Esta - esta IV - Fui assistir ............... um show de Caetano Veloso.
c) Essa essa
d) Essa - esta a) a - h - a - a
e) Esta - aquela b) - - - a
c) a - h - a -
d) a - a - h -
18) O homem ......................... mais admiro o meu pai. e) - h - - a

a) a quem
b) em que 25) Assinale a alternativa incorreta quanto concordncia
c) do qual verbal:
d) com quem
e) de quem a) Vendem-se casas.
b) Pedro ou Fabiano sair vencedor.
c) Eu, voc e ele jantam cedo.
19) Assinale a alternativa incorreta quanto a abreviatura do d) As meninas pareciam gostar de doce.
pronome de tratamento correspondente: e) Precisa-se de empregados.

65
Lngua Portuguesa
 1RYDV 3DODYUDV /LWHUDWXUD JUDPiWLFD UHGDomR H OHitura /
RESPOSTAS Ricardo Leite - So Paulo: FTD, 1997. Outros autores: Emlia
1-D 2-B 3-A 4-D 5E Amaral, Mauro Ferreira, Severino Antnio.
6-C 7-B 8-D 9-C 10 A
11 - B 12 - D 13 - B 14 - D 15 C
16 - C 17 - D 18 - A 19 - C 20 D
21 - A 22 - C 23 - B 24 - E 25 - C
SITES PESQUISADOS

http://www.sandralamego.com/gramatica/exercicios-
regencia-verbal-e-nominal-com-gabarito/#ixzz2Ij9sA8w1
http://isabelacristinaabc.blogspot.com.br/2011/10/exercicios-
BIBLIOGRAFIA concordancia-nominal-e.html
http://www.portalescolar.net/2012/04/portugues-interpretacao-
de-textos-18.html
%HFKDUD(YDQLOGR
Moderna Gramtica Portuguesa Rio de Janeiro: Lucerna,
2005.

&LSUR1HWR3DVTXDOH.
Gramtica da lngua portuguesa / Pasquale & Ulisses - Nova ANOTAES
edio conforme o Acordo Ortogrfico - So Paulo: Scipione,
2008. _________________________________________________

&HJDOOD'RPLQJRV3DVFKRDO _________________________________________________
Novssima Gramtica da Lngua Portuguesa So Paulo:
Companhia Editora Nacional, 2002. ________________________________________________

3DVFKRDOin, Maria Aparecida. _________________________________________________


Gramtica: teoria e exerccios / Paschoalin & Spadoto - So
Paulo: FTD, 1996. _________________________________________________

,QIDQWH8OLVVHV _________________________________________________
Curso de Gramtica Aplicada aos textos So Paulo: Scipione,
1995. _________________________________________________

%DUERVDGH6RX]D-pVXV _________________________________________________
Minigramtica / Jsus & Samira - So Paulo: Saraiva, 1997.
7HUUD(UQDQL _________________________________________________
Minigramtica - So Paulo: Scipione, 1995.
_________________________________________________
$QGUp+LOGHEUDQGR$GH
Gramtica Ilustrada - So Paulo: Moderna, 1997. _________________________________________________

)HUUHLUD0DXUR _________________________________________________
Aprender e praticar gramtica: teoria, snteses das
unidades, atividades prticas, exerccios de vestibulares: 2 _________________________________________________
grau - So Paulo: FTD, 1992.
_________________________________________________
)DULDV$
A interpretao do texto e o pretexto / A. Farias [ e ] Agosti- _________________________________________________
nho Dias Carneiro - Rio de Janeiro: Ao Livro Tcnico, 1979.
_________________________________________________
&HUHMD:LOOLDP5REHUWR
Texto e interao: uma proposta de produo textual _________________________________________________
a partir de gneros e projetos / William Roberto Cereja, The-
reza Cochar Magalhes - So Paulo: Atual, 2000. _______________________________________________________

,QIDQWH8OLVVHV _________________________________________________
Textos: leituras e escritas: literatura, lngua e redao
- So Paulo: Scipione, 2000. ________________________________________________

7HUUD(UQDQL _________________________________________________
Portugus para o ensino mdio: lngua, literatura e produo
de textos: volume nico / Ernani Terra & Jos Nicola, Floriana
Toscano Cavallete. So Paulo: Scipione, 2002.

66
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

',5(,723(1$/&',*23(1$/
&20$6$/7(5$d(69,*(17(6$7e$38%/,&$d2'2(',7$/

(QILP QRV FULPHV FRQWUD D Ip S~EOLFD SURWHJHVH D


&ULPHV&RQWUDD)p3~EOLFD FRQILDQoD Ip GDVSHVVRDVQDVFRLVDVHGRFXPHQWRVTXH
ID]HPSDUWHGDYLGDHGDVUHODo}HVVRFLDLV

$ )p 3~EOLFD p D LQGLVSHQViYHO FRQILDQoD TXH RV


LQGLYtGXRV SUHFLVDP H GHYHP GHSRVLWDU QDV Do}HV GRV 'RFXPHQWR3~EOLFRH'RFXPHQWR3DUWLFXODU
KRPHQVGR(VWDGRHQDFRLVDVRUJDQL]DGDVGLVFLSOLQDGDV
HDGPLQLVWUDGDVGLUHWDRXLQGLUHWDPHQWHSHOR3RGHU
3~EOLFR 'RFXPHQWRpWRGRHVFULWRTXHUHWUDWHXPDWRRXXP
IDWR4XDQGRFRQVWUXtGRSDUDFRPSURYDUDIRUPDomRRX
3DUD&$55$5$FRQFHLWRGHIpS~EOLFDDOFDQoDYDPDLV H[LVWrQFLDGHXPDWRRXGHIDWRFKDPDVHLQVWUXPHQWR
TXHDFRQILDQoDQRH[HUFtFLRGRFDUJRHIXQomRS~EOLFD
SHODVSHVVRDVDEUDQJHQGRWDPEpPDILGHGLJQLGDGHTXHR 6HUi SDUWLFXODU R GRFXPHQWR TXH TXDLVTXHU SHVVRDV
(VWDGRFRQIHUHDGHWHUPLQDGDVFRLVDVFRPRRVGRFXPHQ HVFUHYHUHPVHPYtQFXORFRPDDWLYLGDGHS~EOLFDHVHUi
WRVHPJHUDORVHORDPRHGDHWF S~EOLFRRGRFXPHQWRUHGLJLGRHPUD]mRGRRItFLRS~EOLFR

(0$*$/+(612521+$HQVLQDTXH$IpS~EOLFDp 7RGR GRFXPHQWR  SDUWLFXODU RX S~EOLFR  JHUDP


XPDUHDOLGDGHHpXPLQWHUHVVHTXHDOHLGHYHSURWHJHU6HP FHUWH]DHFRQILDQoDGDYHUDFLGDGHGDRFRUUrQFLDGRIDWRRX
HODVHULDLPSRVVtYHODYLGDHPVRFLHGDGH)UXWRGDFLYLOL]D DWRQHOHUHJLVWUDGR
omRHGRSURJUHVVRSRLVVHULDLQFRPSUHHQVtYHORXLQ~WLO
QDVVRFLHGDGHVSULPLWLYDVKRMHFRQVWLWXLXPEHPGRTXDO &ODURTXHHVVDIppPDLRUQRVGRFXPHQWRVS~EOLFRV
DYLGDFRPXQLWiULDQmRSRGHDEVROXWDPHQWHSUHVFLQGLU&RP EDVWDQGRVXDRULJHPSDUDTXHVHMDPFRQVLGHUDGRVDXWrQWL
HIHLWRRKRPHPWHPQHFHVVLGDGHGHDFUHGLWDUQDYHUDFLGDGH FRV3RULVVRPHVPRRVGRFXPHQWRVS~EOLFRVID]HPSURYD
RXJHQXLQLGDGHGHFHUWRVDWRVGRFXPHQWRVVLQDLVVtPERORV SOHQD VHPSUH TXH DSUHVHQWDGRV QR RULJLQDO RX HP
HWFHPSUHJDGRVQDPXOWLSOLFLGDGHGDVUHODo}HVGLiULDVHP WUDVODGRRXHPFHUWLGmR
TXHLQWHUYpP$DWLYLGDGHFLYLORPXQGRGRVQHJyFLRVHWF
$OHLSHQDOWXWHODSURWHJHDFRQILDELOLGDGH Ip GRV
FDUHFHPGHOHVHGDtDQDWXUDOFUHQoDRXFRQILDQoDGHWRGRV
GRFXPHQWRVWDQWRGRVS~EOLFRVFRPRGRVSDUWLFXODUHV
HPTXHHOHVDWHVWDPRXSURYDPDYHUDFLGDGHGDVUHODo}HV
MXUtGLFDV H VRFLDLV 1mR VH WUDWD GH EHP SDUWLFXODU RX
(0$*$/+(612521+$LQYRFDQGROLo}HVGHRXWURV
SULYDGR$LQGDTXHQRFDVRKDMDRIHQVDUHDORXSHULJRGH
DXWRUHVHQVLQDTXH0DJJLRQHGHILQHGRFXPHQWRS~EOLFR
OHVmRDRLQWHUHVVHGHXPDSHVVRDpRIHQGLGDDIpS~EOLFD
ID]HQGRRjOX]GRDUWGR&yGLJR&LYLO,WDOLDQR0DQ
LVWRpDFUHQoDRXFRQYLFomRJHUDOGDJHQXLQLGDGHHYDORU
]LQLGiQRVFRQFHLWRXP WDQWRSUROL[R/RPEDUGLHVFUHYH
GRVGRFXPHQWRVDWRVHWFSUHVFULWRVRXXVXDLVSDUDDTXHODV 3RGHGL]HUVHDVVLPGRFXPHQWRS~EOLFRDTXHOHTXHpIHLWR
UHODo}HV LQ'LUHLWR3HQDO9ROHG6DUDLYDS  SRURILFLDOS~EOLFRRXSHVVRDDHOHHTXLSDUDGDQDIRUPDOH
 'LU 3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR
JDOHQRH[HUFtFLRGHVXDVIXQo}HVHQRH[HUFtFLRGHVXDVIXQ SRVVDFDXVDUFRQVHTrQFLDVQRFDPSRMXUtGLFR FDUDFWHUtV
o}HVVHMDSDUDXPILPGHGLUHLWRS~EOLFRLQHUHQWHDHVVDV WLFDVDSUHVHQWDGDVSRU+HOHQR&)UDJRVR 1HVVHVHQWLGR
IXQo}HV VHMD SDUD UHFHEHU GHFODUDo}HV SDUWLFXODUHV GH 57H1mRFRQVWLWXHPGRFX
YRQWDGHHYHUGDGHHDWULEXLUOKHVIpS~EOLFDHILQDOPHQWH PHQWRV RV SDSpLV LQyFXRV RV TXH UHWUDWDP IDWRV RX
)DELDQLGL]4XDOTXHUGRFXPHQWR OHJLVODWLYRDGPLQLVWUD PDQLIHVWDo}HVGHYRQWDGHVHPLPSRUWkQFLDMXUtGLFD LQ
WLYRMXGLFLiULR IHLWRSRURILFLDOS~EOLFRQRH[HUFtFLRGHVXDV &yGLJR 3HQDO $QRWDGR  HG ',6 6DUDLYD  DQRWDomR DR DUW
IXQo}HVpGRFXPHQWRS~EOLFRDRTXDOVHGLULJHDSURWHomR &3 
SHQDO

3HUFRUUHQGRVHDVYiULDVGHILQLo}HVGRVMXULVWDVSRGHPRV
GL]HU TXH VmR FDUDFWHUtVWLFRV GR GRFXPHQWR S~EOLFR D )DOVLGDGHGH7tWXORVHRXWURV3DSpLV3~EOLFRV
TXDOLGDGHGDSHVVRDGHTXHPHOHHPDQDLVWRpRIXQFLRQi
ULRS~EOLFRDFRPSHWrQFLDUDWLRQHORFLPDWHULDHHRIILFLLH )DOVLILFDomRGH3DSpLV3~EOLFRV
DIRUPDOHJDO>LQ'LUHLWR3HQDOYROHG(G6DUDLYD
S@
$UW )DOVLILFDUIDEULFDQGRRVRXDOWHUDQGRDV
)DOVLILFDUIDEULFDQGRRVRXDOWHUDQGRDV
(PDQDOLVDQGRRGRFXPHQWRSDUWLFXODU(0$*$/+(6
12521+$GHILQHRGHIRUPDVLPSOHVHFRQFLVDRTXHp , VHOR
VHORGHVWLQDGR
GHVWLQDGRDFRQWUROHWULEXWiULRSDSHOVHODGR
FRQWUROHWULEXWiULRSDSHOVHODGR
IHLWR VHP LQWHUYHQomR GH IXQFLRQiULR RX GH DOJXpP TXH RXTXDOTXHUSDSHOGHHPLVVmROHJDOGHVWLQDGRj
WHQKDIpS~EOLFD$FUHVFHQWDDLQGD1mRWHPRGRFXPHQWR DUUHFDGDomRGHWULEXWR
DUUHFDGDomRGHWULEXWR
WULEXWR
SDUWLFXODU IRUPD HVSHFLDO GHYHQGR SRUpP DSUHVHQWDU 2EV UHGDomRPRGLILFDGDSHOD/HLQSDUDH[FOXLUR
FDUDFWHUtVWLFRV TXH R LQGLYLGXDOL]HP $ WUDQVFULomR QR VHORSRVWDOHDHVWDPSLOKDSHODH[SUHVVmRPDLVDEUDQJHQWHVHOR
UHJLVWURS~EOLFRRXRUHFRQKHFLPHQWRGDILUPDQmRPXGDP GHVWLQDGRDFRQWUROHWULEXWiULRHDH[SUHVVmRDUUHFDGDomRGH
VXDQDWXUH]D HPERUDHVVHVDWRVVHMDS~EOLFRV3DUWLFXODU LPSRVWR RX WD[DSRUDUUHFDGDomRGHWULEXWRJrQHURTXH
DEDUFDRXWUDVHVSpFLHVDOpPGHVVDVGXDV
WDPEpP p R GRFXPHQWR S~EOLFR QXOR SRU SUHWHULomR GH
IRUPDOLGDGHVXEVWDQFLDO>LQ'LUHLWR3HQDOYROHG ,,  SDSHO
SDSHOGH
GHFUpGLWR
FUpGLWRS~EOLFR
S~EOLFRTXH
TXHQmR
QmRVHMD
VHMDPRHGD
PRHGDGH
(G6DUDLYDS@
FXUVROHJDO
FXUVROHJDO
6mR H[HPSORV SDGU}HV GH GRFXPHQWRV S~EOLFRV DV
,,, YDOHSRVWDO
YDOHSRVWDO
&pGXODVGH,GHQWLGDGHD&DUWHLUD1DFLRQDOGH+DELOLWDomR
SDUDGLULJLUDV&DUWHLUDVGH,GHQWLGDGHFRPRDIXQFLRQDO
,9 FDXWHOD
DXWHOD GH
GH SHQKRU
SHQKRU FDGHUQHWD
FDGHUQHWD GH GHSyVLWRGH
GD 2UGHP GRV $GYRJDGRV GR %UDVLO GH 'HOHJDGRV GH
FDL[D
FDL[D HFRQ{PLFD
HFRQ{PLFD RX
RX GH
GH RXWUR HVWDEHOHFLPHQWR
)LVFDLVGH3URPRWRUHV-Xt]HVHWFDSUySULD&DUWHLUDGH
PDQWLGRSRUHQWLGDGHGHGLUHLWRS~EOLFR
PDQWLGRSRUHQWLGDGHGHGLUHLWRS~EOLFR
7UDEDOKRR&HUWLILFDGRGH$OLVWDPHQWRRGH5HVHUYLVWD
RGH,VHQomRGR6HUYLoR0LOLWDUDVHVFULWXUDVS~EOLFDVRV
IRUPXOiULRVGH*XLDGH5HFROKLPHQWRGH7ULEXWRVD*XLD 9  WDOmR UHFLER JXLD DOYDUi RX TXDOTXHU RXWUR
GR ,166 R 7HOHJUDPD R 'LSORPD GH &XUVR 6XSHULRU GRFXPHQWR
GRFXPHQWR UHODWLYR
UHODWLYR D DUUHFDGDomR
DUUHFDGDomR GH UHQGDV
3DSpLV$XWHQWLFDGRVHVmRHTXLSDUDGRVDGRFXPHQWRV S~EOL
S~EOLFDV
FDV RX
RX D GHSyVLWR
GHSyVLWR RX
RX FDXomR
FDXomR SRU
SRU TXH
TXH R
S~EOLFRV RGRFXPHQWRHPLWLGRSRUHQWLGDGHSDUDHVWD SRGHUS~EOLFRVHMDUHVSRQViYHO
SRGHUS~EOLFRVHMDUHVSRQViYHO
WDO DVDXWDUTXLDV  RWtWXORDRSRUWDGRURXWUDQVPLVVt
YHOSRUHQGRVVRQRWDVSURPLVVyULDVFKHTXHVGXSOLFDWDV 9, ELOKHWH
ELOKHWH SDVVH
SDVVH RX
RX FRQKHFLPHQWR
FRQKHFLPHQWR GHHPSUHVDGH
OHWUDVGHFkPELRFRQKHFLPHQWRVGHGHSyVLWRHWF DV WUDQVSRUWH
WUDQVSRUWHDGPLQLVWUDGD
DGPLQLVWUDGDSHOD
SHOD8QLmR
8QLmRSRU
SRU(VWDGR
Do}HV GH VRFLHGDGH FRPHUFLDO VRFLHGDGH DQ{QLPD H RXSRU0XQLFtSLR
RXSRU0XQLFtSLR
VRFLHGDGH HP FRPDQGLWD SRU Do}HV  SUHIHUHQFLDLV
RUGLQiULDVQRPLQDWLYDVRXDRSRUWDGRUHWF RVOLYURV 3HQDUHFOXVmRGHGRLVDRLWRDQRVHPXOWD
3HQD
PHUFDQWLVREULJDWyULRVRXIDFXOWDWLYRV 57- H
 RWHVWDPHQWRSDUWLFXODU KROyJUDIR   ,QFRUUHQDPHVPDSHQDTXHP

(QVLQD '$06,2 (-(686 VHUHP FDUDFWHUtVWLFDV GR , XVDJXDUGDSRVVXLRXGHWpPTXDOTXHUGRVSDSpLV


GRFXPHQWRSDUWLFXODU IRUPDHVFULWDQmRDEUDQJHDV IDOVLILFDGRVDTXHVHUHIHUHHVWHDUWLJR
IRWRJUDILDV FySLDV QmR DXWHQWLFDGDV GH GRFXPHQWRV
SLQWXUDVJUDYDo}HVHWF$HVFULWDGHYHWHUVLGRDSRVWDHP ,, LPSRUWD H[SRUWD DGTXLUHYHQGHWURFDFHGH
FRLVD PyYHO   DXWRU GHWHUPLQDGR D HVFULWD DQ{QLPD HPSUHVWDJXDUGDIRUQHFHRXUHVWLWXLjFLUFXODomR
QmRFRQILJXUDGRFXPHQWR GHYHFRQWHUXPDPDQLIHV VHORIDOVLILFDGRGHVWLQDGRDFRQWUROHWULEXWiULR
WDomRGHYRQWDGHRXDH[SRVLomRGHXPIDWRDVLPSOHV
DSRVLomR GH XPD DVVLQDWXUD HP SDSHO HP EUDQFR QmR ,,, LPSRUWDH[SRUWDDGTXLUHYHQGHH[S}HjYHQGD
FRQVWLWXLGRFXPHQWR3DSHODVVLQDGRHPEUDQFRpIDOVLGD PDQWpP HP GHSyVLWR JXDUGD WURFD FHGH HP
GHPDWHULDOIRUMDUGRFXPHQWRTXHOKHIRUDFRQILDGRSDUD SUHVWD IRUQHFH SRUWD RX GH TXDOTXHU IRUPD
SUHHQFKLPHQWR 57 VHQmROKHIRLFRQILDGR XWLOL]DHPSURYHLWRSUySULRRXDOKHLRQRH[HUFtFLR
57'DPHVPDIRUPDQmRFRQVLVWHPHPGRFX GHDWLYLGDGHFRPHUFLDORXLQGXVWULDOSURGXWRRX
PHQWRV RV SDSpLV FRP HVFULWRV LQLQWHOLJtYHLV RX VHP PHUFDGRULD
VHQWLGR UHOHYkQFLDMXUtGLFDpQHFHVViULRTXHRHVFULWR
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

D  HPTXHWHQKDVLGRDSOLFDGRVHORTXHVHGHVWLQH $omR)tVLFD 
$omR)tVLFD  
 
DFRQWUROHWULEXWiULRIDOVLILFDGR LQFULPLQDVH D VXSUHVVmR HOLPLQDomR RX UHPRomR  GH
FDULPERRXVLQDOLQGLFDWLYRGHVXDLQXWLOL]DomRFRPRILP
E  VHPVHORRILFLDOQRVFDVRVHPTXHDOHJLVODomR GHWRUQiORVQRYDPHQWHXWLOL]iYHLV
WULEXWiULDGHWHUPLQDDREULJDWRULHGDGHGHVXD
DSOLFDomR (OHPHQWR6XEMHWLYRGR,QMXVWR
RGROR6HPPRGDOLGDGHFXOSRVD
2EV UHGDomRPRGLILFDGDSHOD/HLQSDUD
LQFOXLU RXWUDV FRQGXWDV WtSLFDV DOpP GR XVR GRV
SDSpLVIDOVLILFDGRV $omR)tVLFD 
$omR)tVLFD  
 
SXQHVHRXVRGRVSDSpLVUHIHULGRVQRFDSXW
 6XSULPLU HP TXDOTXHU GHVVHVSDSpLVTXDQGR
OHJtWLPRV
OHJtWLPRV FRP
FRP R ILP
ILP GH WRUQiORV QRYDPHQWH (OHPHQWR6XEMHWLYRGR,QMXVWR
XWLOL]iYHLV
XWLOL]iYHLV FDULPER
FDULPER RX
RX VLQDO
VLQDO LQGLFDWLYR
LQGLFDWLYR GH VXD RGROR,QH[LVWHQWHDIRUPDFXOSRVD
LQXWLOL]DomR
LQXWLOL]DomR
$omR)tVLFD 
$omR)tVLFD  
 
3HQDUHFOXVmRGHXPDTXDWURDQRVHPXOWD
3HQD SXQHVHDFRQGXWDGHTXHPWHQGRUHFHELGRRVSDSpLVQD
LJQRUkQFLDGDIDOVLILFDomRRXDOWHUDomRRVXVDjFLUFXOD
 ,QFRUUH QD PHVPD SHQD TXHP XVDGHSRLVH
omRGHSRLVGHFRQKHFHUDIDOVLGDGHRXDOWHUDomR
DOWHUDGRTXDOTXHUGRVSDSpLVDTXHVHUHIHUHR
DOWHUDGRTXDOTXHUGRVSDSpLVDTXHVHUHIHUHR
SDUiJUDIRDQWHULRU
SDUiJUDIRDQWHULRU
(OHPHQWR6XEMHWLYRGR,QMXVWR
RGROR1mRKiSXQLomRDWtWXORGHFXOSD
 4XHP XVD RX UHVWLWXL jFLUFXODomRHPERUD
UHFHELGR GHERD
UHFHELGRGH ERDIp
IpTXDOTXHU
TXDOTXHUGRV
GRVSDSpLV
SDSpLVIDOVLILFD
GRVRXDOWHUDGRVDTXHVHUHIHUHPHVWH
GRVRXDOWHUDGRVDTXHVHUHIHUHPHVWHDUWLJR
DUWLJRH $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
R VHX
VHX   GHSRLV GH FRQKHFHU D IDOVLGDGH RX
DOWHUDomR
DOWHUDomR LQFRUUH
LQFRUUH QD
QD SHQD
SHQD GH
GH GHWHQomRGHVHLV
GHWHQomRGHVHLV
PHVHVDGRLVDQRVRXPXOWD
PHVHVDGRLVDQRVRXPXOWD 3HWUHFKRVGH)DOVLILFDomR

 (TXLSDUDVH
(TXLSDUDVHDDWLYLGDGH
DWLYLGDGHFRPHUFLDO
FRPHUFLDOSDUD
SDUDRVRVILQVGR $UW )DEULFDUDGTXLULUIRUQHFHUSRVVXLURXJXDUGDU
)DEULFDUDGTXLULUIRUQHFHUSRVVXLURXJXDUGDU
LQFLVR
LQFLVR ,,,
,,, GR
GR  
 TXDOTXHU
TXDOTXHU IRUPD
IRUPD GH
GH FRPpUFLR REMHWR
REMHWR HVSHFLDOPHQWHGHVWLQDGRjIDOVLILFDomR
HVSHFLDOPHQWHGHVWLQDGRjIDOVLILFDomR
LUUHJXODU RX
LUUHJXODU RX FODQGHVWL
FODQGHVWLQR
QR LQFOXVLYH
LQFOXVLYH R H[HUFLGR
H[HUFLGR HP GH
GH TXDOTXHU
TXDOTXHU GRV
GRV SDSpLV
SDSpLV UHIHULGRV
UHIHULGRV QR
QR DUWLJR
YLDV
YLDVSUDoDV
SUDoDVRXRXWURVORJUDGRXURVS~EOLFRVHHP DQWHULRU
DQWHULRU
UHVLGrQFLDV
3HQD
3HQD UHFOXVmRGHXPDWUrVDQRVHPXOWD
2EV DFUHVFLGRSHOD/HLQGHSDUD
DOFDQoDUWDPEpPRVDFROHLURHRVPLFURRXSHTXHQRV
HPSUHViULRVTXHID]HPGHVVDIDOVLGDGHPHLRSDUDVHX 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
GHVFDPLQKR
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
2EMHWRGD7XWHOD3HQDODIpS~EOLFD
2EMHWRGD7XWHOD3HQDO
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
$omR)tVLFD
2EMHWR
2EMHWRGD
GD7XWHOD
7XWHOD3HQDODIpS~EOLFDHPIDFHGDRUGHP
3HQDO DV Do}HV LQFULPLQDGDV VmR D 
D IDEULFDU E  DGTXLULU F
WULEXWiULD
IRUQHFHUG
G SRVVXLUH
G H JXDUGDU
H
$omR)tVLFD FDSXW
$omR)tVLFD FDSXW 
FDSXW 

(OHPHQWR6XEMHWLYRGR,QMXVWR
DLQFULPLQDomRpIDOVLILFDUGDUDSDUrQFLDHQJDQRVDDILP
RGROR1mRKiSXQLomRDWtWXORGHFXOSD
GHSDVVDUSRURULJLQDO0HLRVSUHYLVWRVD
D IDEULFDQGRRV
D
E DOWHUDQGRRV
E
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
(OHPHQWR6XEMHWLYRGR,QMXVWR
RGROR1mRKiIRUPDFXOSRVD $UW 6HRDJHQWHp
6HRDJHQWHpIXQFLRQiULR
IXQFLRQiULRS~EOLFR
S~EOLFRHFRPHWHR
FULPH
FULPHSUHYDOHFHQGRVH
SUHYDOHFHQGRVHGR
GRFDUJR
FDUJRDXPHQWDVH
DXPHQWDVHD
$omR)tVLFD 
$omR)tVLFD  
  SHQDGHVH[WDSDUWH
SXQHVHQmRDSHQDVRXVRGHTXDOTXHUGRVSDSpLVS~EOLFRV
LQGLFDGRVQRVLQFLVRVGRFDSXWFRPRTXDOTXHULQWHUIHUrQ
FLDQRSURFHVVRGHIDOVLILFDomRRXXVRGRSDSHOIDOVLILFDGR )DOVLGDGH'RFXPHQWDO
DJRUDWDPEpPDJXDUGDHRGHSyVLWRTXHDQWHVQmRHUDP
DOFDQoDGRV
)DOVLILFDomRGR6HORRX6LQDO3~EOLFR
(OHPHQWR6XEMHWLYRGR,QMXVWR
RGROR1mRKiIRUPDFXOSRVD $UW )DOVLILFDUIDEULFDQGRRVRXDOWHUDQGRRV
)DOVLILFDUIDEULFDQGRRVRXDOWHUDQGRRV
 'LU 3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR
,  VHOR
VHORS~EOLFR
S~EOLFRGHVWLQDGR
GHVWLQDGRDDXWHQWLFDU
DXWHQWLFDUDWRV
DWRVRILFLDLV )DOVLILFDomRGH'RFXPHQWR3~EOLFR
GD8QLmRGH(VWDGRRXGH0XQLFtSLR
GD8QLmRGH(VWDGRRXGH0XQLFtSLR
$UW )DOVLILFDU
)DOVLILFDU QR WRGR RX HP SDUWHGRFXPHQWR
,,  VHOR
VHOR RX
RX VLQDO
VLQDO DWULEXtGR
DWULEXtGR SRU
SRU OHL
OHL D HQWLGDGH
HQWLGDGH GH S~EOLFR
S~EOLFR RX
RX DOWHUDUGRFXPHQWRS~EOLFRYHUGD
DOWHUDUGRFXPHQWRS~EOLFRYHUGD
GLUHLWR
GLUHLWR S~EOLFR
S~EOLFR RX
RX D DXWRULGDGH
DXWRULGDGH RXRX VLQDO GHLUR
GHLUR
S~EOLFRGHWDEHOLmR
S~EOLFRGHWDEHOLmR
3HQDUHFOXVmRGHGRLVDVHLVDQRVHPXOWD
3HQD
3HQDUHFOXVmRGHGRLVDVHLVDQRVHPXOWD
3HQD
 6HR
6HRDJHQWH
DJHQWHpIXQFLRQiULRS~EOLFRHFRPHWHR
 ,QFRUUHQDVPHVPDVSHQDV
,QFRUUHQDVPHVPDVSHQDV FULPH
FULPHSUHYDOHFHQGRVH
SUHYDOHFHQGRVHGR
GRFDUJR
FDUJRDXPHQWDVH
DXPHQWDVHD
SHQDGHVH[WDSDUWH
SHQDGHVH[WDSDUWH
, TXHPID]XVRGRVHORRXVLQDOIDOVLILFDGR
 3DUD RV HIHLWRV SHQDLV HTXLSDUDPVHDGRFX
,, TXHP XWLOL]D LQGHYLGDPHQWH R VHORRXVLQDO PHQWRS~EOLFR
PHQWR S~EOLFRRHPDQDGR
HPDQDGRGH
GHHQWLGDGH
HQWLGDGHSDUDHV
YHUGDGHLURHPSUHMXt]RGHRXWUHPRXHPSURYH WDWDO
WDWDORWtWXOR
WtWXORDR
DRSRUWDGRU
SRUWDGRURX
RXWUDQVPLVVtYHO
WUDQVPLVVtYHOSRU
LWRSUySULRRXDOKHLR HQGRVVRDVDo}HVGHVRFLHGDGHFRPHUFLDORV
HQGRVVRDVDo}HVGHVRFLHGDGHFRPHUFLDORV
OLYURVPHUFDQWLVHRWHVWDPHQWRSDUWLFXODU
OLYURVPHUFDQWLVHRWHVWDPHQWRSDUWLFXODU
,,, TXHP DOWHUD IDOVLILFD RX ID] XVR LQGHYLGRGH
PDUFDV ORJRWLSRV VLJODV RX TXDLVTXHU RXWURV 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
VtPERORVXWLOL]DGRVRXLGHQWLILFDGRUHVGHyUJmRV
RXHQWLGDGHVGD$GPLQLVWUDomR3~EOLFD 6XMHLWR3DVVLYR
6XMHLWR3DVVLYR
R(VWDGRSULPHLUDPHQWHHDSHVVRDHPSUHMXt]RGHTXHP
2EVLQFLVR,,,DFUHVFLGRSHOD/HLQ
IRLRIDOVRSUDWLFDGRVHFXQGDULDPHQWH
 6HRDJHQWH
6HRDJHQWHpIXQFLRQiULR
IXQFLRQiULRS~EOLFRHFRPHWHR
FULPHSUHYDOHFHQGRVH
FULPH SUHYDOHFHQGRVHGR
GRFDUJR
FDUJRDXPHQWDVH
DXPHQWDVHD  2EMHWR
2EMHWR GD
GD 7XWHOD
7XWHOD 3HQDODIpS~EOLFDHVSHFLDOPHQWHD
3HQDO
SHQDGHVH[WDSDUWH
SHQDGHVH[WDSDUWH DXWHQWLFLGDGHGRVGRFXPHQWRV

6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR $omR)tVLFD
VmRGXDVDVFRQGXWDVSUHYLVWDVD D IDOVLILFDUQRWRGRRX
D
6XMHLWR3DVVLYRR(VWDGRSULPHLUDPHQWH
6XMHLWR3DVVLYR HPSDUWHGRFXPHQWRS~EOLFRE E RXDOWHUDUGRFXPHQWR
E
S~EOLFRYHUGDGHLURHPTXDOTXHUGDVKLSyWHVHVpLPSUHV
2EMHWR
2EMHWRGD
GD7XWHOD
7XWHOD3HQDODIpS~EOLFDHVSHFLDOPHQWHRV
3HQDO FLQGtYHO TXH D IDOVLILFDomR VHMD LG{QHD SDUD HQJDQDU
VLQDLVS~EOLFRVGHDXWHQWLFLGDGH LQGHWHUPLQDGR Q~PHUR GH SHVVRDV H TXH VHMD FDSD] GH
FDXVDU SUHMXt]R SDUD RXWUHP SRLV R IDOVR LQyFXR QmR
FRQILJXUDRGHOLWR
 $omR
mR )tVLFD
)tVLFD FDSXW 
FDSXW 
 D DomR p IDOVLILFDU TXH WHP D
VLJQLILFDomRGHDSUHVHQWDUFRPRYHUGDGHLURRTXHQmRp
(OHPHQWR6XEMHWLYRGR,QMXVWR
$IDOVLILFDomRSDUDFDUDFWHUL]DURFULPHHPTXDOTXHUGH
RGROR1mRKiSXQLomRDWtWXORGHFXOSD
VXDVPRGDOLGDGHVGHYHVHUDSWDDHQJDQDUDJHQHUDOLGDGH
GDVSHVVRDVHODSRGHVHUIHLWDD
D IDEULFDQGRE
D E DOWHUDQ
E $omR3HQDO
$omR3HQDO
GR S~EOLFDLQFRQGLFLRQDGDVHQGRQHFHVViULRH[DPHGHFRUSR
GHGHOLWR
$omR)tVLFD ,
$omR)tVLFD , 
, 
SXQHVHTXHPID]XVRGRVHORRXVLQDOIDOVLILFDGRXVDQGR  1DV
1DVPHVPDVSHQDVLQFRUUH
PHVPDVSHQDVLQFRUUHTXHP
TXHPLQVHUH
LQVHUHRX
RXID]
RHPVXDGHVWLQDomRQRUPDOHRILFLDO LQVHULU
$omR)tVLFD ,,
$omR)tVLFD ,, 
,,  , QD
QD IROKD
IROKD GH
GH SDJDPHQWR
SDJDPHQWR RX
RX HPGRFXPHQWRGH
LQFULPLQDVHTXHPXWLOL]DLQGHYLGDPHQWHRVHORRXVLQDO LQIRUPDo}HVTXHVHMDGHVWLQDGRDID]HUSURYD
YHUGDGHLURDJLQGRHPSUHMXt]RGHRXWUHPRXHPSURYHLWR SHUDQWH
SHUDQWH D SUHYLGrQFLDVRFLDOSHVVRDTXHQmR
SUySULRRXDOKHLR SRVVXDDTXDOLGDGHGHVHJXUDGRREULJDWyULR
$omR)tVLFD ,,,
$omR)tVLFD ,,, 
,,,  ,, QD &DUWHLUDGH7UDEDOKRH3UHYLGrQFLD6RFLDO
TXLV D LQRYDomR OHJDO DOFDQoDU WDPEpP TXHP DOWHUD GR HPSUHJDGR
GR HPSUHJDGR RXRX HP
HP GRFXPHQWR TXH GHYD
IDOVLILFDRXID]XVRLQGHYLGRGDVVLPERORJLDVTXHDVVRFLDP SURGX]LU
SURGX]LU HIHLWR
HIHLWR SHUDQWH
SHUDQWH D SUHYLGrQFLD
SUHYLGrQFLD VRFLDO
RGRFXPHQWRj$GPLQLVWUDomR3~EOLFDGHTXHVHPSUH GHFODUDomR
GHFODUDomRIDOVD
IDOVDRXGLYHUVDGDTXHGHYHULD
RXGLYHUVDGDTXHGHYHULDWHU
UHVXOWD D DSDUrQFLD GH GRFXPHQWR S~EOLFR RX RILFLDO VLGRHVFULWD
SURYLGRGHIp
,,, HP
HPGRFXPHQWR FRQWiELORX
GRFXPHQWRFRQWiELO RXHP
HPTXDOTXHURXWUR
(OHPHQWR6XEMHWLYRGR,QMXVWR GRFXPHQWRUHODFLRQDGRFRPDVREULJDo}HVGD
GRFXPHQWR UHODFLRQDGRFRPDVREULJDo}HVGD
RGROR1mRKiIRUPDFXOSRVD HPSUHVD
HPSUHVDSHUDQWH
SHUDQWHDSUHYLGrQFLD
SUHYLGrQFLDVRFLDO
VRFLDOGHFODUD
omRIDOVDRXGLYHUVDGDTXHGHYHULDWHUFRQV
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO WDGR
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

 1DV PHVPDV SHQDV LQFRUUH TXHPRPLWHQRV 3HQD UHFOXVmRGHXPDFLQFRDQRVHPXOWDVHRGRFX


GRFXPHQWRV
GRFXPHQWRV PHQFLRQDGRV
PHQFLRQDGRV QRQR   QRPH GR PHQWRpS~EOLFRHUHFOXVmRGHXPDWUrVDQRVH
VHJXUDGR
VHJXUDGR H VHXVGDGRVSHVVRDLVDUHPXQHUD
VHXVGDGRVSHVVRDLVDUHPXQHUD PXOWDVHRGRFXPHQWRpSDUWLFXODU
omR
omR D YLJrQFLD
YLJrQFLD GR
GR FRQWUDWR
FRQWUDWR GH
GH WUDEDOKR
WUDEDOKR RX
RX GH
SUHVWDomRGHVHUYLoRV ~QLFR 6HRDJHQWHp
6HRDJHQWHpIXQFLRQiULR
IXQFLRQiULRS~EOLFR
S~EOLFRHFRPHWHR
2EVHDFUHVFLGRVSHOD/HLQ FULPH SUHYDOHFHQGRVHGR
FULPHSUHYDOHFHQGRVH GRFDUJR
FDUJRRX
RXVH
VHDIDOVLIL
FDomR
FDomR RX
RX DOWHUDomR
DOWHUDomR p GH
GH DVVHQWDPHQWR
DVVHQWDPHQWR GH
1RLQRYDomROHJLVODWLYDWHYHSRUSURSyVLWRWUDWDU UHJLVWUR
UHJLVWUR FLYLO
FLYLO DXPHQWDVH
DXPHQWDVH D SHQD GH VH[WD
FRP ULJRU DTXHOHV TXH IDOVLILFDP IROKDV GH SDJDPHQWR SDUWH
OLYURVGHUHJLVWURVHPHVPRFDUWHLUDVGHWUDEDOKRFODURp
RGRORGHSURGX]LUSURYDGHILOLDomRDSHVVRDVQmRILOLDGDV
6XMHLWR
6XMHLWR$WLYRTXDOTXHUSHVVRDQmRSUHFLVDQGRQHFHV
$WLYR
SDUD TXH VH FUHGHQFLHP HVWDV j FRQTXLVWD GH EHQHItFLRV
VDULDPHQWHVHUTXHPUHGLJHRGRFXPHQWR6HRDJHQWHIRU
SUHYLGHQFLiULRVUHVSRQGHPHOHVWDPEpPSHODIDOVLGDGHGH
IXQFLRQiULRS~EOLFRYLGH~QLFR
GRFXPHQWRS~EOLFR
S~EOLFRDGHVSHLWRGHVHUHPHYHQWXDOPHQWH
S~EOLFR
SDUWLFXODUHV WDLV GRFXPHQWRV 1R   TXLVVH FRLELU D
6XMHLWR
6XMHLWR3DVVLYRSULPHLUDPHQWHR(VWDGRVHFXQGDULD
3DVVLYR
RPLVVmRTXHGHVSURWHJHRVVHJXUDGRVLPSHGLQGRRVGH
VHFUHGHQFLDUHPjFRQTXLVWDGHEHQHItFLRVSUHYLGHQFLiULRV PHQWHDSHVVRDSUHMXGLFDGDSHODIDOVLGDGH

2EMHWRGD7XWHOD3HQDO
DIpS~EOLFDHVSHFLDOPHQWHHJHQXLQLGDGHGRGRFXPHQWR
)DOVLILFDomRGH'RFXPHQWR3DUWLFXODU
$omR
$omR)tVLFDVmRWUrVDVPRGDOLGDGHVDOWHUQDWLYDPHQWH
)tVLFD
$UW )DOVLILFDU QR WRGR RX HP SDUWHGRFXPHQWR
SDUWLFXODU
SDUWLFXODU RX
RX DOWHUDU GRFXPHQWR SDUWLFXODU SUHYLVWDVDRPLWLUGHFODUDomRTXHGHOHGHYLDFRQVWDUE
YHUGDGHLUR
YHUGDGHLUR LQVHULU GHFODUDomR IDOVD RX GLYHUVD GD TXH GHYLD VHU
HVFULWDFID]HULQVHULUGHFODUDomRIDOVDRXGLYHUVDGDTXH
3HQD
3HQD UHFOXVmRGHXPDFLQFRDQRVHPXOWD GHYLDVHUHVFULWD

)DOVLILFDomRGHFDUWmR (OHPHQWR6XEMHWLYRGR,QMXVWR
 RGROR1mRKiIRUPDFXOSRVD
~QLFR 3DUD
3DUD ILQVGRGLVSRVWRQRF
LQVGRGLVSRVWRQR FDSXWHTXLSDUDVHD
DSXWHTXLSDUDVHD
GRFXPHQWR
GRFXPHQWR SDUWLF
SDUWLFXODU
XODU R FDUWmR
FDUWmR GH GH FUpGLWR
FUpGLWR RX $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
GpELWR
GpELWR 2EV~QLFRDFUHVFLGRSHOD/HLQ
(VVHWLSRGHFULPHWHPHVVDGHQRPLQDomRSRUTXHHOH
2EV 3XEOLFDGDRILFLDOPHQWHHPGH]HPEURDOH[GHILQLXVXD
YLJrQFLD DSyV GHFRUULGRV  FHQWR H YLQWH  GLDV DUW  UHSUHVHQWDDIDOVLGDGHGDLGpLDMiTXHRGRFXPHQWRp
SDVVDQGRDVFRQGXWDVDFRQILJXUDUFULPHDSDUWLUGHDEULO H[WHULRUHPDWHULDOPHQWHSHUIHLWR

6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR 6LJQLILFDTXHRGRFXPHQWRpIDOVRHPVHXFRQWH~GRRX
VHMDVXDVGHFODUDo}HVVmRPHQWLURVDVHPERUDHOHVDWLVIDoD
6XMHLWR3DVVLYR
6XMHLWR3DVVLYR WRGRVRVUHTXLVLWRVSDUDVXDYDOLGDGHIRUPDO1HQKXPD
R (VWDGR SULPHLUDPHQWH VHFXQGDULDPHQWH D SHVVRD SHUtFLD FRPSURYD R IDOVR LGHROyJLFR SRUTXH HOH QmR p
SUHMXGLFDGDSHODIDOVLGDGH GRFXPHQWR UDVXUDGR RX DOWHUDGR HP VXD DSDUrQFLD
LQVWUXPHQWDO PDV VLP GRFXPHQWR SUHHQFKLGR
UHHQFKLGR FRP
 2EMHWR
2EMHWR GD
GD 7XWHOD3HQDO
7XWHOD3HQDODIpS~EOLFDHVSHFLDOPHQWHD
3HQDO SHUIHLomRSRUpPIDOVRY
SHUIHLomR YLFLDGR
LFLDGR QR
QR FRQWH~GRFRPSDOD
FRQWH~GR
DXWHQWLFLGDGHGRVGRFXPHQWRV YUDVTXHOiQmRGHYHULDPHVWDURXVHPSDODYUDVTXHOi
GHYHULDPFRQVWDU
$omR)tVLFD
DVFRQGXWDVSUHYLVWDVVmRLGrQWLFDVjVGRDUWLJRDQWHULRU
(QILPERPGHFRUSRUXLPGHDOPD
(OHPHQWR6XEMHWLYRGR,QMXVWR
,PSRUWDQWH FRQVLGHUDU TXH Vy R FULPH GH IDOVLGDGH
RGROR1mRKiIRUPDFXOSRVD
LGHROyJLFDTXHPRPLWHRXQHOHID]FRQVWDUDGHFODUDomR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO IDOVDFRPRILPGHSUHMXGLFDUGLUHLWRFULDUREULJDomRRX
DOWHUDUDYHUGDGHVREUHIDWRMXULGLFDPHQWHUHOHYDQWH6H
HVVDRXXPDGHVVDVFRQGLo}HVQmRHVWLYHUFRPSURYDGD
DLQGD TXH VH WHQKD IHLWR XP GRFXPHQWR GH FRQWH~GR
)DOVLGDGH,GHROyJLFD IDOVRQmRVHWHUiSUDWLFDGRFULPHGHIDOVLGDGHLGHROyJLFD

1mRVHWUDWDGHFULPHSUySULRGHIXQFLRQiULRS~EOLFR
$UW 2PLWLU
2PLWLU HP
HP GRFXPHQWR
GRFXPHQWR S~EOLFR
S~EOLFR RXSDUWLFXODU
RXSDUWLFXODU
TXDOTXHUSHVVRDSRGHFRPHWrOR
GHFODUDomR
GHFODUDomR TXH
TXH GHOH
GHOH GHYLD
GHYLD FRQVWDU
FRQVWDU RX
RX QHOH
LQVHULU
LQVHULU RX
RX ID]HU
ID]HU LQVHULU
LQVHULU GHFODUDomR IDOVD RX
GLYHUVD
GLYHUVDGD
GDTXH
TXHGHYLD
GHYLDVHU
VHUHVFULWD
HVFULWDFRP
FRPRILPGH
ILPGH 7UDWDVH GH FULPH FRQWUD D Ip S~EOLFD SRU TXH DV
SUHMXGLFDU
SUHMXGLFDUGLUHLWR
GLUHLWRFULDU
FULDUREULJDomR
REULJDomRRX
RXDOWHUDU
DOWHUDUD SHVVRDV GHYHP FRQILDU QRV GRFXPHQWRV H D IDOVLILFDomR
YHUGDGHVREUHIDWRMXULGLFDPHQWHUHOHYDQWH GHVWHVHOLPLQDDFRQILDQoDGDVSHVVRDVJHUDQGRDLQVHJX
 'LU 3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR
UDQoDGHWRGRVHPWRGDVDVUHODo}HVMXUtGLFDVeSRUWDQWR 3HQD
3HQD GHWHQomRGHGRLVPHVHVDXPDQR
SDUDSURWHJHUDIpTXHGHYHPLQVSLUDUWRGRVRVGRFXPHQ
WRVTXHVHSXQHDIDOVLILFDomRGHVWHVQmRLPSRUWDQGRVH 6XMHLWR$WLYR
RGRFXPHQWRpS~EOLFRRXSDUWLFXODU VyRIXQFLRQiULRS~EOLFRHPUD]mRGHVHXRItFLR

$WHQomR 6H DV PHQWLUDV IDOVLGDGHV  ODQoDGDV QR 6XMHLWR3DVVLYRR(VWDGR


6XMHLWR3DVVLYR
GRFXPHQWR S~EOLFRRXSDUWLFXODU WLYHUHPSRUSURSyVLWR
IUDXGDUDILVFDOL]DomRWULEXWiULDRXDHYDVmR QmRSDJD 2EMHWRGD7XWHOD3HQDO
PHQWRWRWDORXSDUFLDO GHWULEXWRRFULPHQmRQmRVHUiR
QmR DIpS~EOLFDHVSHFLDOPHQWHDGDVFHUWLG}HVHDWHVWDGRV
GHIDOVLGDGHLGHROyJLFDGHVWHDUWLJRPDV&ULPHFRQWUDD
2UGHP 7ULEXWiULD SUHYLVWR QXPD OHL QRYD D GH Q
$omR)tVLFD
 '(= DUWHHDSHQDVHUiGH
VmR GRLV RV Q~FOHRV HPSUHJDGRV DWHVWDU RX FHUWLILFDU
DDQRVGHUHFOXVmR PDLVPXOWD 
3XQHVHRIXQFLRQiULRS~EOLFRTXHHPUD]mRGHIXQomR
S~EOLFDDWHVWDRXFHUWLILFDIDOVDPHQWH
( VH HVVD FRQGXWD DWHQWDWyULD j RUGHP WULEXWiULD IRU
FRPHWLGD SRU XP IXQFLRQiULR S~EOLFR QR H[HUFtFLR GH
VXDVIXQo}HV DSHQDVHUiDXPHQWDGD DJUDYDGD GH (OHPHQWR6XEMHWLYRGR,QMXVWR
DWp D PHWDGH  H QmR GH DSHQDV  FRPR VH DJUDYD RGROR1mRKiSXQLomRDWtWXORGHFXOSD
SDUDDVLPSOHVIDOVLGDGHLGHROyJLFDSUHYLVWDQHVWH~QLFR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO

(PERUD QmR HVWHMD GHQWUH RV FULPHV SUySULRV FRP


)DOVR5HFRQKHFLPHQWRGH)LUPDRX/HWUD IXQFLRQiULRVS~EOLFRVHVWHFULPHVVy SRGH VHU FRPHWLGR
SRGH VHU
SRU
SRUIXQFLRQiULR
IXQFLRQiULRS~EOLFRMiTXHDIDOVLGDGHGRDWHVWDGRRX
S~EOLFR
$UW 5HFRQKHFHU
5HFRQKHFHUFRPR
FRPRYHUGDGHLUD
YHUGDGHLUDQR
QRH[HUFtFLR
H[HUFtFLRGH FHUWLGmRpSUDWLFDGD HPUD]mRGRRItFLRHSRUWDQWRVy
HPUD]mRGRRItFLR
IXQomRS~EOLFDILUPDRXOHWUDTXHRQmRVHMD
IXQomRS~EOLFDILUPDRXOHWUDTXHRQmRVHMD SHORIXQFLRQiULRS~EOLFRDRH[HFXWDUDVXDIXQomR

3HQD
3HQD UHFOXVmRGHXPDFLQFRDQRVHPXOWDVH
VH
VHRGRFX 7HPVHDTXLXPDHVSpFLHGRJrQHURIDOVLGDGHLGHROyJL
PHQWR
PHQWRpS~EOLFRHGHXPDWUrVDQRVHPXOWDVH
S~EOLFR VH FD
RGRFXPHQWRpSDUWLFXODU
RGRFXPHQWRpSDUWLFXODU (PERUDDOHLIDOHTXHDFHUWLGmRRXDWHVWDGRKDELOLWH
DOJXpPDREWHUFDUJRS~EOLFRLVHQomRGH{QXVRXVHUYLoRV
6XMHLWR$WLYR GHFDUiWHUS~EOLFRRXRXWUDYDQWDJHPSDUDDFDUDFWHUL]D
VRPHQWHRIXQFLRQiULRFRPIpS~EOLFDSDUDUHFRQKHFHU omRGRFULPH1mRpQHFHVViULRTXHRIXQFLRQiULRS~EOLFR
HPERUDSRVVDKDYHUSDUWtFLSHVHPHVVDTXDOLGDGH FRPHWDDIDOVLGDGHFRPWDOLQWXLWREDVWDQGRTXHWHQKD
YRQWDGH GH DWHVWDU RX FHUWLILFDU HP GHVDFRUGR FRP D
6XMHLWR
6XMHLWR3DVVLYRSULPHLUDPHQWHR(VWDGRHVHFXQGDULD
3DVVLYR YHUGDGH6HVLPSOHVPHQWHLQFRUUHUHPHUUR LPSUXGrQ
PHQWHDSHVVRDSUHMXGLFDGD FLD RX QHJOLJrQFLD RX LPSHUtFLD  HQWmR QmR KDYHUi
FULPHSRLVpQHFHVViULRRGROR YRQWDGHGHIDOVHDU 
 2EMHWRGD7XWHOD3HQDO
2EMHWRGD7XWHOD3HQDODIpS~EOLFDHVSHFLDOPHQWHD
WRGD7XWHOD3HQDO
DXWHQWLFDomRGHGRFXPHQWRV
,PSRUWDQWHSRUpPTXHRDWHVWDGRRXIDOVLGDGHSHUPL
WDDOJXpPSHORPHQRVSRWHQFLDOPHQWHSRVVDREWHU
$omR)tVLFD
TXDOTXHUYDQWDJHPHPUD]mRGHOD(VHHOHQmR WLYHU
RQ~FOHRpUHFRQKHFHU3XQHVHRUHFRQKHFLPHQWRFRPR
YHUGDGHLUDGHILUPDRXOHWUDTXHQmRRVHMD QHQKXPOXFUR"""9HMDEHPQmRpLPSUHVFLQGtYHOTXHR
EHQHILFLiULRFRQVLJDHVVDYDQWDJHP%DVWDTXHRDWHVWDGR
(OHPHQWR6XEMHWLYR,QMXVWR RXFHUWLGmR WHQKDHVVHSRWHQFLDOOLEHUDWyULR
H[LJHVH R GROR DLQGD TXH HYHQWXDO 1mR Ki SXQLomR D
WtWXORGHFXOSD $WHQomRQmRFRQIXQGDRJrQHURGDIDOVLGDGH
IDOVLGDGH
IDOVLGDGHLGHROy
JLFD
LFD FRP RV FDVRV HVSHFLDLV HP TXH WDPEpP Ki XPD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO PHQWLUDQRFRQWH~GRPDVTXHFRQVWLWXHPR RXWUR
XWUR FULPH
FRPQRPHGLIHUHQWH MiYLPRVTXHVHDIDOVLGDGHWHP
SRUSURSyVLWRDVRQHJDomRGHWULEXWRVRFULPHpFRQWUDD
RUGHPWULEXWiULD6HHQWUHWDQWRDIDOVLGDGHIRLSUDWLFDGD
&HUWLGmRRX$WHVWDGR,GHRORJLFDPHQWH)DOVR QXP DWHVWDGRRXQXPDFHUWLGmR HQmRpSDUDVRQHJDU
WULEXWRV HQWmRRFULPHQmRVHUiRGRDUWHVLPRGR
$UW $WHVWDU
$WHVWDU RXFHUWLILFDUIDOVDPHQWHHPUD]mRGD DUW&3
IXQomR
IXQomR S~EOLFD
S~EOLFD IDWR
IDWR RX
RX FLUFXQVWkQFLD
FLUFXQVWkQFLD TXH
KDELOLWH
KDELOLWHDOJXpP
DOJXpPDREWHU
REWHUFDUJR
FDUJRS~EOLFR
S~EOLFRLVHQomR &XLGDGR
&XLGDGR  SRUTXHMiKRXYHFRQFXUVRS~EOLFRHPTXH

GH
GH {QXV
{QXV RX
RX GH
GH VHUYLoR
VHUYLoR GH
GH FDUiWHU
FDUiWHU S~EOLFR
S~EOLFR RX WDOSHTXHQDHGHOLFDGDGLIHUHQoDIRLTXHVWLRQDGD
TXDOTXHURXWUDYDQWDJHP
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

)RUPD4XDOLILFDGD
)DOVLGDGH0DWHULDO
GH$WHVWDGRRX&HUWLGmR DUW 6H R FULPHpSUDWLFDGRFRPRILPGHOXFUR
DSOLFDVHDOpP
DSOLFDVHDOpPGD
GDSHQD
SHQDSULYDWLYDGHOLEHUGD
DUW )DOVLILFDU
)DOVLILFDU QR
QR WRGR
WRGR RX
RX HP
HP SDUWHDWHVWDGRRX
SDUWHDWHVWDGRRX GHDGHPXOWD
FHUWLGmR
FHUWLGmRRX
RXDOWHUDU
DOWHUDURWHRU
WHRUGH
GHFHUWLGmR
FHUWLGmRRX
RXGH
DWHVWDGR YHUGDGHLUR SDUD
DWHVWDGR YHUGDGHLUR SDUD SURYD GH IDWR RX 7UDWDVHGRPHVPRFULPHKDYHQGRROHJLVODGRUSHQDO
FLUFXQVWkQFLD
FLUFXQVWkQFLD TXH KDELOLWH DOJXpP D REWHU DXPHQWDGR D SHQD DFUHVFHQGRD GH PXOWD VH VH FRP
FDUJR
FDUJRS~EOLFR
S~EOLFRLVHQomR
LVHQomRGH
GH{QXV
{QXVRX
RXGH
GHVHUYLoR SURYDUTXHRDXWRUGRGHOLWRDJLXFRPILQDOLGDGHGHREWHU
GHFDUiWHU
GHFDUiWHUS~EOLFR
S~EOLFRRX
RXTXDOTXHU
TXDOTXHURXWUDYDQWD OXFUR
JHP
1mRLPSRUWDVHRIDOVLILFDGRUFRQVHJXLXRXQmRROXFUR
3HQD
3HQD GHWHQomRGHWUrVPHVHVDGRLVDQRV RTXHLPSRUWDpTXHVXDLQVSLUDomRIRLDREWHQomRGH
OXFUR
$GLIHUHQoDHQWUHDIDOVLGDGHLGHROyJLFDHDPDWHULDOp
TXHQDSULPHLUDRGRFXPHQWRpPRGLILFDGR DGXOWHUDGR (VHQmRVHFRPSURYDUWDOPRWLYDomR OXFUR HQWmRQmR
HPVHXFRQWH~GRVHMDSHORDFUpVFLPRGHSDODYUDVHMDSHOD VHFDUDFWHUL]DUiDIRUPDTXDOLILFDGDPDVVLPDVLPSOHV
VXEVWLWXLomRVHMDSHODVXSUHVVmR RXVHMDDGRGRDUW&3

-iQDIDOVLGDGHPDWHULDODDomRFULPLQRVDLQFLGHVREUH 6XMHLWR$WLYR
6XMHLWR$WLYR
R LQVWUXPHQWR TXH FRUSRULILFD R GRFXPHQWR VHMD SRU TXDOTXHUSHVVRD FULPHFRPXPTXDQWRDRVXMHLWR 
UDVXUDULVFRUDVSDJHPDSDJDPHQWRRXPHVPRLQVHUomR
GH FDUDFWHUHV OHWUDV RX SDODYUDV  TXH PRGLILTXHP D 6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
DSDUrQFLDGRGRFXPHQWR
2EMHWRGD7XWHOD3HQDO
(QTXDQWRQHQKXPDSHUtFLDFRPSURYDDPDWHULDOLGDGH DIpS~EOLFDHVSHFLDOPHQWHDGDVFHUWLG}HVHDWHVWDGRV
GR IDOVR LGHROyJLFR SRUTXH HOH QmR p XP FRUSR DGXO
WHUDGRPDVVLPXPGRFXPHQWRSUHHQFKLGR
SUHHQFKLGR
SUHHQFKLGRFRP
FRPDSDUrQ $omR)tVLFD
$omR)tVLFD
FLD
FLDSHUIHLWDDIDOVLGDGHPDWHULDODRFRQWUiULRSRGHVHU
SHUIHLWD QHVWDDIDOVLGDGHpPDWHULDORDJHQWHIDOVLILFDQRWRGRRX
DSXUDGD SRU SHUtFLD WpFQLFD Mi TXH D PRGLILFDomR GR HPSDUWHRXDOWHUDRWHRUGHFHUWLGmRRXDWHVWDGRYHUGD
LQVWUXPHQWRREULJDWRULDPHQWHGHL[DYHVWtJLRVPDWHULDLV
GHLUR
7DPEpP D IDEULFDomR GH GRFXPHQWRV IDOVRV p GH
(OHPHQWR6XEMHWLYRGR,QMXVWR
QDWXUH]DPDWHULDOMiTXHRFRUSRpIDOVRVHMDQRSDSHO
RGROR,QH[LVWHIRUPDFXOSRVD
RXQRVFDULPERVRXQRIRUPXOiULRRXQDDVVLQDWXUDHWF
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
(QILP R GRFXPHQWR IDOVLILFDGR LGHRORJLFDPHQWH p
ERPGHFRUSRUXLPGHDOPDHQTXDQWRRGRFXPHQWR
IDOVLILFDGRPDWHULDOPHQWHpIRLHODERUDGRFRPDDOPDERD
PDVVHXFRUSRUXLPID]DSDUHQWDUXPDDOPDUXLP )DOVLGDGHGH$WHVWDGR0pGLFR

2TXHVHSUHWHQGHQHVWHSDUiJUDIRSULPHLURpSURWHJHU
GRFXPHQWRVHVSHFLDLVFRPRDWHVWDGRVGHERDFRQGXWDGH $UW 'DU
'DU R PpGLFR
PpGLFR QR H[HUFtFLR GD VXDSURILVVmR
PLVHUDELOLGDGHGHVHUYLoRVQD)(%GHWHUVHUYLGRFRPR DWHVWDGRIDOVR
DWHVWDGRIDOVR
MXUDGRGHVHUSURILVVLRQDOVLQGLFDOL]DGRHWFLPSRUWDQ
WHVSRUSHUPLWLUHPjVSHVVRDVVHKDELOLWDUHPDREWHUFDUJR 3HQD
3HQD GHWHQomRGHXPPrVDXPDQR
S~EOLFRMXVWLoDJUDWXLWDLVHQomRILVFDOSULVmRHVSHFLDOHP
FULPHFRPXPHRXWUDVYDQWDJHQVTXHDOHLFRQIHUH ~QLFR 6H R FULPH p FRPHWLGR FRP R ILPGHOXFUR
DSOLFDVHWDPEpPPXOWD
DSOLFDVHWDPEpPPXOWD
5HDILUPHVH TXHUVH HYLWDU TXH WDLV GRFXPHQWRV
GHYLGDPHQWH HPLWLGRV DOPD ERD  WHQKDP VHX FRUSR 6XMHLWR$WLYR
PRGLILFDGR FRUSR UXLP  SDUD DSDUHQWDU FRQWH~GR VRPHQWHRPpGLFR FULPHSUySULRTXDQWRDRVXMHLWR 
GLYHUVRGRYHUGDGHLUR
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
$ IDOVLILFDomR PDWHULDO GH SDUWH VH Gi SHOD UDVXUD
LQVHUomRGHOHWUDVRXSDODYUDVHWFQRFRUSRGRGRFX 2EMHWRGD7XWHOD3HQDO
PHQWRYiOLGRHQTXDQWRIDOVLILFDomRPDWHULDOGRWRGR D Ip S~EOLFD HVSHFLDOPHQWH FRP UHODomR DRV DWHVWDGRV
VHFRQILJXUDFRPDIDEULFDomRGHGRFXPHQWRDSDUHQWH PpGLFRV
PHQWHERPVHMDSHORHPSUHJRGHSDSHORXIRUPXOiULR
VHQmRDVVLQDWXUDVIDOVDVHQILPXPGRFXPHQWRTXHQmR $omR)tVLFD
IRLHPLWLGRSHOR3RGHU3~EOLFRPDVTXHWHPDSDUrQFLDGH pGDU IRUQHFHUHQWUHJDU DWHVWDGRIDOVR
WrORVLGR
 'LU 3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR
(OHPHQWR6XEMHWLYRGR,QMXVWR $omR)tVLFD
RGROR1mRKiPRGDOLGDGHFXOSRVD DFRQGXWDLQFULPLQDGDpID]HUXVR HPSUHJDUXWLOL]DU 
5HTXHUVH TXH R DJHQWH FRQKHoD D IDOVLGDGH GR GRFX
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO PHQWRTXHXVD1mRKDYHUiFULPHVHIDOWDUDRGRFXPHQWR
UHTXLVLWRQHFHVViULRjFRQILJXUDomRGRIDOVR

(OHPHQWR6XEMHWLYRGR,QMXVWR
5HSURGXomRRX$GXOWHUDomR RGROR1mRKiIRUPDFXOSRVD
GH6HORRX3HoD)LODWpOLFD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
$UW 5HSURGX]LU
5HSURGX]LU RX
RX DOWHUDU
DOWHUDU VHOR
VHOR RX SHoDILODWpOLFD
TXH
TXH WHQKD
WHQKD YDORU
YDORU SDUD
SDUD FROHomR
FROHomR VDOYR
VDOYR TXDQGR
TXDQGR D
UHSURGXomR
UHSURGXomR RX
RX D DOWHUDomR
DOWHUDomR HVWi
HVWi YLVLYHOPHQWH
6XSUHVVmRGH'RFXPHQWR
DQRWDGDQDIDFHRXQRYHUVRGRVHORRXSHoD
DQRWDGDQDIDFHRXQRYHUVRGRVHORRXSHoD

3HQDGHWHQomRGHXPDWUrVDQRVHPXOWD
3HQD $UW 'HVWUXLU VXSULPLU RX RFXOWDU HPEHQHItFLR
SUySULR
SUySULR RXGHRXWUHPRXHPSUHMXt]RDOKHLR
RXGHRXWUHPRXHPSUHMXt]RDOKHLR
~QLFR 1D PHVPD SHQD LQFRUUH TXHP SDUDILQVGH GRFXPHQWR
GRFXPHQWR S~EOL
S~EOLFR
FR RX SDUWLFXODU YHUGDGHLUR
RX SDUWLFXODU
FRPpUFLRID]XVRGRVHORRXSHoDILODWpOLFD
FRPpUFLRID]XVRGRVHORRXSHoDILODWpOLFD GHTXHQmRSRGLDGLVSRU
GHTXHQmRSRGLDGLVSRU

6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR 3HQD
3HQD UHFOXVmRGHGRLVDVHLVDQRVHPXOWDVHRGRFX
PHQWRpS~EOLFRHUHFOXVmRGHXPDFLQFRDQRV
6XMHLWR3DVVLYR HPXOWDVHRGRFXPHQWRpSDUWLFXODU
R(VWDGRSULPHLUDPHQWHHDSHVVRDSUHMXGLFDGDVHFXQ
GDULDPHQWH 6XMHLWR$WLYR
TXDOTXHUSHVVRDLQFOXLQGRRSURSULHWiULRGRGRFXPHQWR
2EMHWRGD7XWHOD3HQDO TXHQmRSRVVDGHOHGLVSRU
D Ip S~EOLFD HVSHFLDOPHQWH D WXWHOD GH VHORV H SHoDV
ILODWpOLFDV 6XMHLWR3DVVLYR
 SULPHLUDPHQWH R (VWDGR VHFXQGDULDPHQWH D SHVVRD
$omR)tVLFD SUHMXGLFDGDFRPDVXSUHVVmR
6mRD
D UHSURGX]LUE
D E DOWHUDU5HVVDOYDDOHLTXHDFRQGX
E
WDQmRVHUiFULPLQRVDTXDQGRDUHSURGXomRRXDOWHUDomR 2EMHWRGD7XWHOD3HQDO
HVWiYLVLYHOPHQWHDQRWDGDQDIDFHRXQRYHUVRGRVHORRX D Ip S~EOLFD HVSHFLDOPHQWH D VHJXUDQoD GR GRFXPHQWR
SHoD FRPRSURYD

(OHPHQWR6XEMHWLYRGR,QMXVWR $omR)tVLFD
RGROR1mRKiIRUPDFXOSRVD WUrVRVQ~FOHRVDOWHUQDWLYDPHQWHLQGLFDGRVD D GHVWUXLUE
D E
VXSULPLUHF
F 
F RFXOWDU'HVDSDUHFHDDQWLMXULGLFLGDGHTXDQ
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO GRRDJHQWHSRGHOLYUHPHQWHGHVID]HUVHGRGRFXPHQWR

(OHPHQWR6XEMHWLYR,QMXVWR
RGRORHRHOHPHQWRVXEMHWLYRGRWLSRUHODWLYRDRHVSHFLDO
8VRGH'RFXPHQWR)DOVR ILPGHDJLUILQDOLGDGHGHEHQHItFLRSUySULRRXGHRXWUHP
RXGHSUHMXt]RDOKHLR1mRKiPRGDOLGDGHFXOSRVD
$UW )D]HU
D]HU XVR
XVR GH
GH TXDOTXHU
TXDOTXHU GRV
GRV SDSpLVIDOVLILFDGRV
SDSpLVIDOVLILFDGRV
RX
RX DOWHUDGRV
DOWHUDGRV D TXH
TXH VH
VH UHIHUHP
UHIHUHP RVDUWVD $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO


+i TXH VH DWHQWDU TXH HVWH WLSR SHQDO HVWi LQVHUWR
3HQD
3HQD DFRPLQDGDjIDOVLILFDomRRXjDOWHUDomR GHQWUHRVTXHWXWHODPDIpS~EOLFDSDUWLFXODUPHQWHD
VHJXUDQoDFRQILDELOLGDGHGRVGRFXPHQWRVHSRULVVR
6XMHLWR$WLYR
6XMHLWR$WLYR QmRVHWUDWDGHFULPHSUySULRGHIXQFLRQiULRS~EOLFRH
TXDOTXHUSHVVRD7RGDYLDSUHGRPLQDRHQWHQGLPHQWRGH DVVLP SRGH VHU FRPHWLGR SRU TXDOTXHU SHVVRD H DWp
TXHRDXWRUGRIDOVRQmRSRGHUHVSRQGHUWDPEpPSHOR PHVPRSHORSUySULRGRQRGRGRFXPHQWRTXHQmRWHQGR
XVRRXYLFHYHUVD GLUHLWRGHXViORYHPDGHVWUXtORRXRVXSULPH
VXSULPHVHQmR
VXSULPH VHQmRR
HVFRQGH
HVFRQGH RFXOWD 
RFXOWD  SDUD
SDUD VH
VH EHQHILFLDU
EHQHILFLDU RX PHVPR SDUD
6XMHLWR3DVVLYR EHQHILFLDU
EHQHILFLDU RXWUDSHVVRD RXDSHQDVSDUDSUHMXGLFDU
RXWUDSHVVRD RXDSHQDVSDUDSUHMXGLFDU
R(VWDGRSULPHLUDPHQWHDSHVVRDSUHMXGLFDGDFRPRXVR RXWUDSHVVRD
VHFXQGDULDPHQWH
,QWHUHVVDQWHREVHUYDUDLQGDTXHRFULPHVHFDUDFWHUL]D
2EMHWRGD7XWHOD3HQDODIpS~EOLFD
2EMHWRGD7XWHOD3HQDO UiDSHQDVVHXPGRFXPHQWRYHUGDGHLURIRUGHVWUXtGRRX
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

VXSULPLGR VHQmR RFXOWDGR VH DOJXpP R IL]HU FRP XP e LPSRUWDQWH REVHUYDU WDPEpP TXH D OHL Vy SUHYr D
GRFXPHQWRIDOVLILFDGRRFULPHQmRVHFDUDFWHUL]DUiSRLVp SXQLomRGRFULPHGRORVRRXVHMDTXDQGRRDJHQWHDJLU
FLUFXQVWkQFLDHOHPHQWDUGRWLSRTXHDDomRUHFDLDVREUH FRPYRQWDGHOLYUHHFRQVFLHQWHGHGHVWUXLUVXSULPLURX
XPGRFXPHQWRYHUGDGHLUR RFXOWDURREMHWRPDWHULDOVHSRUDFLGHQWHDSHVVRDGHL[DU
FDLUWLQWDVREUHXPGRFXPHQWRWRUQDQGRRLQHOHJtYHOQmR
0DLVTXHLVVRKiGHVHUXPGRFXPHQWRYHUGDGHLURGH KDYHUiRFULPHSRLVDOHLQmRSUHYrDILJXUDFXOSRVD
TXHRDJHQWHFULPLQRVRQmRSRGLDGLVSRUDVVLPSH[VH
XPPRULEXQGRGHFLGHQmRUHFHEHUXPDQRWDSURPLVVyULD 
GHTXHHUDFUHGRUDLQGDTXHWHQKDHOHRLQWXLWRGHQDGD
GHL[DUSDUDDDOJXPSRWHQFLDOKHUGHLURRXTXHLUDEHQHIL
FLDURSDLGHXPDH[DPDQWHDGHVWUXLomRGHVVHGRFXPHQ
WRGHFUpGLWR YHUGDGHLUR pSHUIHLWDPHQWHYiOLGDMiTXH )DOVD,GHQWLGDGH
HOH WLQKD R GLUHLWR GH GLVSRU GHVVH FUpGLWR H UHVSHFWLYR
GRFXPHQWR
$UW $WULEXLUVH RX DWULEXLU IDOVD LGHQWLGDGHSDUD
2 WLSR GHVWH DUW&3 SRGH FHGHU OXJDU DR FULPH REWHU
REWHUYDQWDJHP
YDQWDJHPHP
HPSURYHLWRSUySULRRXDOKH
WULEXWiULRVHXPFRPHUFLDQWHHVFRQGHGHVWUyLRXVXSULPH LRRXSDUDFDXVDUGDQRDRXWUHP
LRRXSDUDFDXVDUGDQRDRXWUHP
DOJXPDVQRWDVILVFDLVSDUDIXJLUjUHVSHFWLYDWULEXWDomR
QmRFRPHWHUiRFULPHGH6XSUHVVmRGH'RFXPHQWR 3HQD
3HQD GHWHQomRGHWUrVPHVHVDXPDQRRXPXOWDVHR
PDVRFULPHGHVRQHJDomRILVFDOSUHYLVWRQD/HLQ IDWRQmRFRQVWLWXLHOHPHQWRGHFULPHPDLVJUDYH
GH
6XMHLWR$WLYR
6XMHLWR$WLYR
6XMHLWR$WLYR
'DPHVPDIRUDPQmRKDYHUiFULPHGH6XSUHVVmRGH TXDOTXHUSHVVRD FULPHFRPXPTXDQWRDRVXMHLWR 
'RFXPHQWRVHVHWUDWDUGHGRFXPHQWRMXGLFLDORXPHVPR
GHXPSURFHVVRVHDDomRIRUSUDWLFDGDSRUSURFXUDGRURX 6XMHLWR3DVVLYR
DGYRJDGRQHVVHFDVRKDYHUiFULPHGH6RQHJDomRGH3DSHO SULPHLUDPHQWH R (VWDGR VHFXQGDULDPHQWH D SHVVRD
RX 2EMHWR GH 9DORU 3UREDWyULR SUHYLVWR QR DUW&3 SUHMXGLFDGD
YHU DGLDQWH  5HJLVWUHVH D SURSyVLWR TXH Ki XPD
GHFLVmRSXEOLFDGDHP5HYLVWDGRV7ULEXQDLV YROQ 2EMHWRGD7XWHOD3HQDO
S HP TXHUHFRQKHFHTXHDVXSUHVVmRGHDXWRVGH D Ip S~EOLFD HVSHFLDOPHQWH HP UHODomR j LGHQWLGDGH
SURFHVVRFDUDFWHUL]DRFULPHGRDUWGR&yGLJR3HQDO SHVVRDO
'$06,2(-(686DQRWDYiULDVSDUWLFXODULGDGHVVREUH
$omR)tVLFD
D RULJLQDOLGDGH GR GRFXPHQWR TXH SRGHP DIHWDU D
D DomR SXQtYHO p DWULEXLUVH RX DWULEXLU D WHUFHLUR IDOVD
FDUDFWHUL]DomRGRFULPH2GRFXPHQWRGHYHVHURULJLQDO
LGHQWLGDGH$OHLFRQVLJQDTXHDDomRGHYHYLVDUDREWHU
-7$&ULP63   1mR PDLV H[LVWLQGR HVWH SRGH
KDYHU GHOLWR FRQWUD D FySLD DXWrQWLFD 1mR Ki FULPH YDQWDJHPHPSURYHLWRSUySULRRXDOKHLRRXFDXVDUGDQR
HQWUHWDQWRTXDQGRDFRQGXWDYLVDjFySLDDXWrQWLFDGR DRXWUHP
GRFXPHQWRTXHDLQGDH[LVWH1HVVHFDVRSHODIDFLOLGDGH
GHREWHQomRGHRXWURVWUDVODGRVFySLDVHFHUWLG}HVQmR (OHPHQWR6XEMHWLYR,QMXVWR
KiGDQRjIpS~EOLFDLQH[LVWLQGRSRULVVRRGHOLWRHP RGRORHRHOHPHQWRVXEMHWLYRGRWLSRUHODWLYRDRHVSHFLDO
WHOD SRGHQGR VXEVLVWLU RXWUR FRPR R GDQR H R IXUWR ILPGHDJLU1mRKiSXQLomRKiWtWXORGHFXOSD
1HVVHVHQWLGR57H5-7-63
'XSOLFDWDQmRKiFULPHHQTXDQWRVHPDYDORX $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
DFHLWH 57H VHQGRSRVVtYHO
DVXEVWLWXLomRSHODWULSOLFDWDQmRKiGHOLWRSRUDXVrQFLD
GHSUHMXt]R 7-63$&ULP57 9DORU $UW 8VDU FRPR SUySULR SDVVDSRUWH WtWXORGH
SUREDQWH 2 GRFXPHQWR GHYH VHU LQVXEVWLWXtYHO H VHP HOHLWRU
HOHLWRU FDGHUQHWD
FDGHUQHWD GH
GH UHVHUYLVWD
UHVHUYLVWD RX
RX TXDOTXHU
YDORUGHSURYD57H GRFXPHQWR GH LGHQWLGDGH DOKHLD RX FHGHU D
YY 7-63$&ULP5-7-63H RXWUHP
RXWUHP SDUD
SDUD TXH
TXH GHOH
GHOH VH
VH XWLOL]H
XWLOL]H GRFXPHQWR
GRFXPHQWR
5HVWDXUDomR GR GRFXPHQWR 6H SRVVtYHO QmR Ki FULPH GHVVDQDWXUH]DSUySULRRXGHWHUFHLUR
GHVVDQDWXUH]DSUySULRRXGHWHUFHLUR
57$VVLPQmRKiFULPHVHH[LVWHUHJLVWURTXH
SRVVLELOLWHDUHFRPSRVLomRGRGRFXPHQWR 7-635Y&ULP 3HQD
3HQD GHWHQomRGHTXDWURPHVHVDGRLVDQRVHPXOWDVH
 57   1mR p VXILFLHQWH HQWUHWDQWR D RIDWRQmRFRQVWLWXLHOHPHQWRGHFULPHPDLVJUDYH
PHUD SRVVLELOLGDGH GH UHVWDXUDomR e QHFHVViULR TXH VH
SURSLFLH D UHFRQVWLWXLomR 7-63 5Y&ULP  57 6XMHLWR$WLYR
6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
H 5DVJDUGXSOLFDWDQDSDUWHGRDFHLWH
RQGHDSRVWDDDVVLQDWXUD,QH[LVWrQFLDGHFULPHGLDQWHGD
6XMHLWR3DVVLYRR(VWDGR SULQFLSDO 
6XMHLWR3DVVLYR
SRVVLELOLGDGHGHHPLVVmRGHWULSOLFDWD 7-63$&ULP
 5-7-63    LQ &yGLJR 3HQDO $QRWDGR 
2EMHWRGD7XWHOD3HQDO
DSXG'LUHLWR,QIRUPDWL]DGR6DUDLYDQHGHP&'
520DQRWDomRDRDUW&3  DIpS~EOLFDQRTXHFRQFHUQHjLGHQWLGDGHSHVVRDO
 '
LU3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
7- 6mR3DXOR
$omR)tVLFD (LVDtRIXQGDPHQWRSDUDTXHRFRQFXUVRS~EOLFRVHMD
VmR GXDV DV FRQGXWDV SUHYLVWDV D 
D XVDU FRPR SUySULR HIHWLYDPHQWHGLVSXWDGRGHVHQYROYDVHFRPRXPSURFHVVR
TXDOTXHU GRFXPHQWR GH LGHQWLGDGH DOKHLD E  E FHGHU D GH VHOHomR UHDO H HILFLHQWH HP TXH VH SRVVD DSXUDU R
RXWUHPSDUDTXHGHOHVHXWLOL]HGRFXPHQWRGHVVDQDWXUH FRQKHFLPHQWRGRVFDQGLGDWRVHDSURYDURVPHOKRUHVRV
]DSUySULRRXGHWHUFHLUR GHPDLRU44XRFLHQWHGH,,QWHOLJrQFLDQXQFDRVGHLPRUDO4,4,
4
4XHP,,QGLFD
(OHPHQWR6XEMHWLYRGR,QMXVWR
pRGROR,QH[LVWHIRUPDFXOSRVD 2FRQWH~GRGDVSURYDVKiGHVHUVHPSUHVLJLORVRSDUD
TXHRFHUWDPHGLVSXWDFRQFRUUrQFLDVHMDKRQHVWR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO HVFRUUHLWRGLJQRGHFUpGLWRHOLYUHGHIUDXGHV

 $ SURFXUD SRU HPSUHJRV S~EOLFRV TXDOLILFDGRV SHOD


HVWDELOLGDGH GRV FDUJRV S~EOLFRV WHP DXPHQWDGR H
SURSRUFLRQDOPHQWH D GHVFRPSRVWXUD pWLFRPRUDO WHP
DOHQWDGRFDQGLGDWRVHSHVVRDVUHODFLRQDGDVDRPHFDQLVPR
'DV)UDXGHVHP&HUWDPHVGH,QWHUHVVH3~EOLFR GRSURFHVVRGHVHOHomRHFRQFXUVRV
,QFOXtGRSHOD/HLGH

2V WLSRV SHQDLV JHQpULFRV WXWHODQGR D $GPLQLVWUDomR


$UW$ 8WLOL]DU
8WLOL]DURX
RXGLYXOJDU
GLYXOJDULQGHYLGDPHQWH
LQGHYLGDPHQWHFRP
FRPRILP 3~EOLFD D GHYLRODomRGHVLJLORIXQFLRQDODSHQDGRFRP
GHEHQHILFLDUDVLRX
GHEHQHILFLDUDVLRXDRXWUHPRXGHFRPSUR GHWHQomRGHPHVHVDDQRV DUW&3 RX E RGH
PHWHU
HWHU D FUHGLELOLGDGH
FUHGLELOLGDGH GR
GR FHUWDPH
FHUWDPH FRQWH~GR
FRQWH~GR YLRODomRGHVLJLORGHSURSRVWDGHFRQFRUUrQFLDWDPEpP
SXQLGRFRPGHWHQomRGHPHVHVDDQR DUW&3
VLJLORVRGH
QmR DWHQGLDP D QHFHVVLGDGH GH UHSUHVVmR D WDO IUDXGH
HVSHFtILFDPRUPHQWHSRUTXHRVFRQFXUVRVS~EOLFRVQmR
, FRQFXUVRS~EOLFR
UDURVmRWHUFHLUL]DGRVDHPSUHVDVHVSHFLDOL]DGDV
,, DYDOLDomRRXH[DPHS~EOLFRV $/HLQQmRVyFULRXXPWLSRHVSHFtILFR
GHILQLQGRR FRPR FULPH FRQWUD D Ip S~EOLFD  FRPR
,,, SURFHVVR VHOHWLYR SDUD LQJUHVVR QRHQVLQR HVWDEHOHFHXSHQDPDLVJUDYRVD GHDDQRVGHUHFOX
VXSHULRURX VmR TXDOLILFDQGRRFULPHGHUHVXOWDUGDQRjDGPLQLVWUD
omR S~EOLFD SHQD GH UHFOXVmR GH  D  DQRV   H
,9 H[DPHRXSURFHVVRVHOHWLYRSUHYLVWRVHPOHL DGHPDLVDJUDYDQGRDVDQomRHPD XPWHUoR VHRFULPH
IRUFRPHWLGRSRUIXQFLRQiULRS~EOLFR
3HQD UHFOXVmRGH XP D TXDWUR DQRVHPXOWD
$FODUHVHTXHQDH[SUHVVmRFRQFXUVRS~EOLFRUHVWULQJH
 1DV PHVPDV SHQDV LQFRUUH TXHPSHUPLWHRX VHDRSURFHVVRGHVHOHomRGHSHVVRDOSDUDD$GPLQLVWUDomR
IDFLOLWDSRUTXDOTXHUPHLRRDFHVVRGHSHVVRDV S~EOLFD GLUHWD RX LQGLUHWD   QmR FRPSUHHQGHQGR R
QmRDXWRUL]DGDVjVLQIRUPDo}HVPHQFLRQDGDVQR FRQFXUVR PRGDOLGDGH GH OLFLWDomR SUHYLVWD QD /HL GDV
FDSXW /LFLWDo}HV /HLQ MiWXWHODGDHVSHFLILFDPHQWH
QRDUW&3
 6HGDDomRRXRPLVVmRUHVXOWDGDQRjDGPLQLV
WUDomRS~EOLFD 3RUILQDODLQFOXVmRGHIHUUDPHQWDVRXWUDVGHVHOHomR
SDUD FDUJRV RX YDJDV HP VHUYLoRV S~EOLFRV  HVWiJLR
3HQD UHFOXVmRGH GRLV D VHLV DQRVHPXOWD YHVWLEXODUGHLQJUHVVRHPIDFXOGDGHVHWF LQFLVRV,D,9 
VmRUHIHUrQFLDVH[HPSOLILFDWLYDVFRPRHYLGHQFLDRLQF,9
 $XPHQWDVHDSHQDGH XPWHUoR VHRIDWR DR DFODUDU TXH WDPEpP DEUDQJH TXDOTXHU H[DPH RX
pFRPHWLGRSRUIXQFLRQiULRS~EOLFR SURFHVVRVHOHWLYRSUHYLVWRVHPOHL
2EVDUWLJRLQFLVRVHLQFOXtGRVSHOD/HL

6DELGDPHQWHDWpSRULPSRUWDQWHjVUHODo}HVVRFLDLVH
VHU GLULJLGRjSRSXODomRRVHUYLoRS~EOLFRpUHJLGRSRU &ULPHVFRQWUDD
&ULPHV FRQWUDD
SULQFtSLRVpWLFRVHPRUDLVUtJLGRVRVVHUYLGRUHVS~EOLFRV
$GPLQLVWUDomR3~EOLFD
GHYHPVHUDQDWDGDQDomREUDVLOHLUD
&ULPHVSUDWLFDGRVSRU)XQFLRQiULR3~EOLFR
&ULPHVSUDWLFDGRVSRU)XQFLRQiULR3~EOLFR
2 REMHWLYR GRV FRQFXUVRV S~EOLFRV QmR p DSHQDV GH
JDUDQWLUDLJXDOGDGHGHDFHVVRDRVFDUJRVS~EOLFRVDWRGRV
RVEUDVLOHLURV
2V FULPHV TXH VHUmR WUDWDGRV HP VHJXLGD VmR WRGRV
FULPHVSUySULRVGHIXQFLRQiULRVS~EOLFRVFRQWUDDDGPLQLV
0XLWR DOpP GHVVD LJXDOGDGH EXVFDVH DSDUHOKDU D
WUDomRHPJHUDO3RULVVRVmRFKDPDGRVGHFULPHVIXQFLR
SUHVWDomRGRVVHUYLoRVS~EOLFRVFRPRVPHOKRUHVRVPDLV QDLV Mi TXH SUDWLFDGRV SHODV SHVVRDV TXH VH GHGLFDP j
DSWRVHRVPDLVSUHSDUDGRVVHUYLGRUHVGHVRUWHDDOFDQoDU UHDOL]DomRGDVIXQo}HVRXDWLYLGDGHVGR(VWDGR7DPEpP
DH[FHOrQFLDHDJDUDQWLUXPHOHYDGtVVLPRQtYHOGHTXDOLGD VmRFKDPDGRVGHFULPHVGHUHVSRQVDELOLGDGH
FULPHVGHUHVSRQVDELOLGDGH
FULPHVGHUHVSRQVDELOLGDGH
GH
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

3HUWHQFHP j FODVVH GRV FKDPDGRV FULPHV HVSHFLDLV FRQGXWDVGRORVDV TXDQGRDJHPSRUTXHUHU $FRQGXWD


SRUTXHH[LJHPXPDTXDOLGDGHGRVXMHLWRDWLYRQRFDVRD FXOSRVD TXDQGRSURGX]RUHVXOWDGRVHPTXHUHUPDV
GHVHUHOHIXQFLRQiULRS~EOLFR
IXQFLRQiULRS~EOLFR
IXQFLRQiULRS~EOLFR SRUQHJOLJrQFLDRXSRULPSUXGrQFLDRXSRULPSHUtFLD
Vy p FULPLQRVD TXDQGR D OHL HVSHFLILFDPHQWH D SUHYr
0DVRVSDUWLFXODUHVQmRSRGHPFRPHWHUXPGHVVHV FRPR FULPH 'HQWUH RV FULPHV FRQWUD D $GPLQLVWUDomR
FULPHV"""3RGHPHPFRDXWRULDLVWRpTXDQGRFRQFRU 3~EOLFDVyKiRGRDUWSUHYHQGRH[SUHVVDPHQ
UHUHPGHTXDOTXHUPRGRSDUDDSUiWLFDGHXPGHVVHVFUL WHRSHFXODWRFXOSRVR6LJQLILFDTXHRVGHPDLVFULPHVDTXL
PHVSRUXPIXQFLRQiULRS~EOLFRQHVVHFDVRDFRQGLomR HVWXGDGRVQmRVmRSXQLGRVQDPRGDOLGDGHFXOSRVD
SHVVRDOGRDJHQWH VHUIXQFLRQiULRS~EOLFR FRPXQLFDVH 6mRFULPHV
FULPHV
FULPHVFRQWUD
FRQWUDD$GPLQLVWUDomR
$GPLQLVWUDomR3~EOLFDSUDWLFDGDV
3~EOLFD
DRFRDXWRU F~PSOLFH SRUTXHID]SDUWHGRSUySULRFULPH HVSHFLDOPHQWH
HVSHFLDOPHQWH SHOR IXQ IXQFLRQiULR
FLRQiULR S~EOLFR
S~EOLFR R SHFXODWR
WLSRSHQDO HpLPSUHVFLQGtYHOSDUDDFDUDFWHUL]DomRGR VXEWUDLURXVHDSURSULDUGHFRLVDS~EOLFDDUW
GHOLWR DFLUFXQVWkQFLDHOHPHQWDUGHOH  H DUW GR &yG3HQDO  R H[WUH[WUDYLR
DYLR VRQHJDomR
VRQHJDomR RX
LQXWLOL]DomR
LQXWLOL]DomRGH
GHOLYUR
OLYURRX
RXGRFXPHQWR VXPLUFRPXPOLYUR
GRFXPHQWR
3RUWDQWR FRPHWHP FULPH FRQWUD D DGPLQLVWUDomR RXGRFXPHQWRGDUHSDUWLomRDUWGR&yG3HQDO R
S~EOLFDWDQWR D
D RIXQFLRQiULRS~EOLFRQRVHQWLGRHVWULWR HPSUHJRLUUHJXODUGHYHUEDVRXUHQGDVS~EOLFDV DSOL
HPSUHJRLUUHJXODUGHYHUEDVRXUHQGDVS~EOLFDV
FRPR EE TXDOTXHUSHVVRDTXHH[HUoDFDUJRHPSUHJRRX FDURGLQKHLURS~EOLFRGHIRUPDGLIHUHQWHjSUHYLVWDQDOHL
IXQomRS~EOLFDPHVPRTXHVHPUHPXQHUDomRRXWUDQVLWR DUW&yG3HQDO D FRQFXVVmR H[LJLU
FRQFXVVmR GLQKHLURRX
ULDPHQWHHDLQGDTXDOTXHUSDUWLFXODUHPFRDXWRULD YDQWDJHP HP UD]mR GD IXQomR  DUW&yG3HQDO  R
H[FHVVR
H[FHVVRGH
GHH[DomR
H[DomR FREUDUWULEXWRDOpPGRTXHDSHVVRD
(TXHPSRGHVHUFRQVLGHUDGRIXQFLRQiULRS~EOLFR""" GHYH RX GH IRUPD KXPLOKDQWH  DUW  &3  D
6yRFRQFXUVDGRRXWDPEpPRFRPLVVLRQDGRRWHPSRUi FRUUXSomR
FRUUXSomR SDVVLYD
SDVVLYD SHGLURXDFHLWDUFDL[LQKDDUW
D
ULRRV-Xt]HV3UHIHLWRV'HSXWDGRV0LQLVWURV3URPRWRU &3 DSUHYDULFDomR
SUHYDULFDomR
SUHYDULFDomR GHL[DUGHID]HURVHUYLoRSRUVHQ
HWF""" WLPHQWRRXLQWHUHVVHSHVVRDODUW&3 D FRQGHV
FHQGrQFLD
FHQGrQFLDFULPLQRVD GHL[DUGHUHVSRQVDELOL]DURVXERU
FULPLQRVD
4XHPGHILQHTXHPpIXQFLRQiULRS~EOLFRpR$UW GLQDGR LQIUDWRU  DUW&3  D DGYRFDFLD
DGYRFDFLD FULPLQRVD
TXHGHWHUPLQDTXHFRQVLGHUDVHIXQFLRQiULRS~EOLFRSDUD GHIHQGHULQWHUHVVHDOKHLRMXQWRGDDGPLQLVWUDomRDUW
HIHLWRV SHQDLV TXHP HPERUD WUDQVLWRULDPHQWH RX VHP &3  D YLROrQFLD
YLROrQFLD DUELWUiULD
DUELWUiULD SUDWLFDU YLROrQFLD QR
UHPXQHUDomRH[HUFHFDUJRHPSUHJRRX IXQomRS~EOLFD H[HUFtFLR GD IXQomR  DUW&3  R DEDQGRQR
DEDQGRQR GH
HVFODUHFHQGR VHX   TXH (TXLSDUDVH D IXQFLRQiULR IXQomR
IXQomR ODUJDUDEDQGRQDURFDUJRSRUPDLVGHGLDV
S~EOLFRTXHPH[HUFHFDUJRHPSUHJRRXIXQomRHPHQWLGDGH DUW&3 RH[HUFtFLR
H[HUFtFLRIXQFLRQDOLOHJDOPHQWHDQWHFLSD
H[HUFtFLRIXQFLRQDOLOHJDOPHQWHDQWHFLSD
SDUDHVWDWDO GR
GR RX
RX SURORQJDGR
SURORQJDGR H[HUFHU D IXQomR VHP DWHQGHU DV
H[LJrQFLDV OHJDLV  DUW&3  D YLRODomR
YLRODomR GH
GH VLJLOR
(KiFDVRVHPTXHDTXDOLGDGHGRIXQFLRQiULRS~EOLFR IXQFLRQDO FRQWDUVHJUHGRTXHVRXEHQRFDUJRDUW
IXQFLRQDO
DLQGDREULJDDXPDSHQDPHQWRPDLRUSRUTXHPDLRUpVXD &3 HDYLRODomR
YLRODomR
YLRODomRGH
GHVLJLOR
VLJLORGH
GHSURSRVWD
SURSRVWDGHGHFRQFRUUrQFLD
WUDLomR PDLV UHSURYiYHO p VXD FRQGXWD  FRPR R GHYDVVDURVHJUHGRGDVFDUWDVGHSURSRVWDVGHFRQFRUUrQ
GHWHUPLQDR$SHQDVHUiDXPHQWDGDGDWHUoDSDUWH FLDS~EOLFDDUW&3 
TXDQGR RV DXWRUHV GRV FULPHV SUHYLVWRV QHVWH FDStWXOR
IRUHP RFXSDQWHV GH FDUJRV HP FRPLVVmR RX GH IXQomR GH
GLUHomR RX DVVHVVRUDPHQWR GH yUJmR GD DGPLQLVWUDomR 3HFXODWR
GLUHWDVRFLHGDGHGHHFRQRPLDPLVWD HPSUHVDS~EOLFDRX $UWLJRHH&3
IXQGDomRLQVWLWXtGDSHORSRGHUS~EOLFR

$UD]mRGRDJUDYDPHQWRGDSHQDpSRUTXHRFULPHp $UW $SURSULDUVHRIXQFLRQiULRS~EOLFRGHGLQKHLUR


$SURSULDUVHRIXQFLRQiULRS~EOLFRGHGLQKHLUR
PDLVJUDYHHFHQVXUiYHOTXDQGRDOJXpPTXHRSUDWLTXH YDORU
YDORURX
RXTXDOTXHU
TXDOTXHURXWUR
RXWUREHP
EHPPyYHO
PyYHOS~EOLFR
S~EOLFRRX
VHMD DOJXpP TXH WLYHVVH FRQILDQoD GR (VWDGR RX GD SDUWLFXODU
SDUWLFXODU GH
GH TXH
TXH WHP
WHP D SRVVH
SRVVH HP
HP UD]mR
UD]mR GR
HQWLGDGHSDUDHVWDWDO$WUDLomRjFRQILDQoDGHSRVLWDGDQRV FDUJR
FDUJR RX
RX GHVYLiOR
GHVYLiOR HP SURYHLWR SUySULR RX
RFXSDQWHV GH FDUJRV HP FRPLVVmR RX GH IXQomR GH DOKHLR
GLUHomRHWFREULJDjPDLRUUHSURYDomRGDFRQGXWDH
jDSOLFDomRGHXPDSHQDPDLRU 3HQDUHFOXVmRGHGRLVDGR]HDQRVHPXOWD
3HQD

+iTXHVHWHUPXLWDDWHQomRDXPRXWURDVSHFWRHVWHV 6XMHLWR$WLYR
FULPHVVyVmRSXQLGRVQDPRGDOLGDGHGRORVD TXDQGRR R IXQFLRQiULR S~EOLFR VHQGR SRVVtYHO D SDUWLFLSDomR GH
DJHQWHRSUDWLFDTXHUHQGR
TXHUHQGRSUDWLFDU $VVLPSRUH[HPSOR
TXHUHQGR SHVVRDVTXHQmRRVHMDP
VHXPDSHVVRDLQXWLOL]DUVHP
VHP
VHPTXHUHU SRUDFLGHQWHRXSRU
TXHUHU
VHU HVWDEDQDGD  XP OLYUR RX SURFHVVR RX GRFXPHQWR  6XMHLWR3DVVLYR
TXHHVWDYDFRQILDGRjFXVWyGLDGHXPIXQFLRQiULRDTXHOD R(VWDGRHWRGD3HVVRD-XUtGLFDGH'LUHLWR3~EOLFRHYHQ
SHVVRDWHUiDJLGRFRPFXOSDVHUiREULJDGDDLQGHQL]DU WXDOPHQWHWDPEpPRSDUWLFXODUSUHMXGLFDGR
RSUHMXt]RTXHFDXVDUPDVQmRWHUiFRPHWLGRRFULPHGR
DUWLJR&3HPGLDQWH 2EMHWRGD7XWHOD3HQDO
RSDWULP{QLRGD$GPLQLVWUDomR3~EOLFDHPJHUDO
$ UHJUD JHUDO p TXH DV SHVVRDV Vy UHVSRQGHP SHODV
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
$omR)tVLFD 6XMHLWR$WLYR
D DomR p DSURSULDUVH GDQGR R IXQFLRQiULR DR REMHWR R IXQFLRQiULR S~EOLFR VHQGR SRVVtYHO D SDUWLFLSDomR GH
PDWHULDOGHVWLQDomRGLYHUVDGDTXHODTXHOKHIRUDFRQILDGD SHVVRDVTXHQmRRVHMDP

(OHPHQWR6XEMHWLYR,QMXVWRRGROR
(OHPHQWR6XEMHWLYR,QMXVWR 6XMHLWR3DVVLYR
R(VWDGRHWRGD3HVVRD-XUtGLFDGH'LUHLWR3~EOLFRHYHQ
$omR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGDLQGHSHQGHQWHPHQ
3HQDO WXDOPHQWHWDPEpPRSDUWLFXODUSUHMXGLFDGR
WHGDDSURYDomRGHFRQWDVSHORyUJmRFRPSHWHQWH
2EMHWRGD7XWHOD3HQDO
(VWH FULPH HP UHJUD Vy SRGHUi VHU FRPHWLGR SRU RSDWULP{QLRGD$GPLQLVWUDomR3~EOLFDHPJHUDO
IXQFLRQiULR S~EOLFR &RPHWHUi SHFXODWR R IXQFLRQiULR
S~EOLFRTXHILFDU SDUDHOHPHVPRRXGHVYLDUSDUDRXWUD $omR)tVLFD
SHVVRD FRPRGLQKHLUR RXTXDOTXHUEHP TXHUHFHEHX DVXEWUDomRSHORIXQFLRQiULRS~EOLFRRXVXDFRQFRUUrQFLD
HPUD]mRGHVHXFDUJR SDUDDVXEWUDomRDFRQGXWDSRGHVHUHPSURYHLWRSUySULR
RXDOKHLR
3RGHUiXPDSHVVRDFRPXP TXHQmRVHMDIXQFLRQiULR
S~EOLFR FRPHWHUHVVHFULPH"""([FHSFLRQDOPHQWHVLP (OHPHQWR6XEMHWLYR,QMXVWR
6HJXQGRRDUWGR&yGLJR3HQDOIXQFLRQiULRS~EOLFR RGROR$DomRFXOSRVDHVWiSUHYLVWDQR
pTXHPHPERUDWUDQVLWRULDPHQWHRXVHPUHPXQHUDomR
H[HUFHFDUJRHPSUHJRRXIXQomRS~EOLFDRTXHSHUPLWHD $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
FRQFOXVmR GH TXH D SHVVRD QRPHDGD SHOR -Xt]R FRPR
'HSRVLWiULRGHXPEHPHVWiSUHVWDQGRWUDQVLWRULDPHQWH 7UDWD R SDUiJUDIR WDPEpP GH FULPH GH SHFXODWR $
HVHPUHPXQHUDomRXPDIXQomRS~EOLFDRXVHMDJXDU PRGDOLGDGH SRUpP p GH SHFXODWRIXUWR &KDPDVH
GDQGRSDUDD-XVWLoDXPEHPTXHD-XVWLoDGHYHULDJXDU SHFXODWRIXUWR SRUTXH QHVWD KLSyWHVH R IXQFLRQiULR
GDUHFRQVHUYDU S~EOLFRQmRWHPDSRVVHGREHPYDORURXGLQKHLURPDV
VHYDOHGHVXDFRQGLomRGHIXQFLRQiULRHGDVIDFLOLGDGHV
$VVLPRGHSRVLWiULRpFRQVLGHUDGRQHVVDKLSyWHVHXP TXHHVWDFRQGLomROKHGiSDUDVXEWUDtOR
IXQFLRQiULRS~EOLFR$RGHVYLDUHPVHXSUySULRSURYHLWR
YHQGHQGRRHILFDQGRFRPRSUHoR REHPTXHD-XVWLoD 7DPEpPRFRUUHVHRIXQFLRQiULRS~EOLFRDRLQYpVGH
OKHHQWUHJDUDSDUDJXDUGDUFRPHWHUiRFULPHGHSHFXODWR VXEWUDLUDX[LOLDRXWUDSHVVRDDVXEWUDtOR1HVVHDX[tOLR
DUW&3  RIXQFLRQiULRS~EOLFRID]SUHYDOHFHUDIDFLOLGDGHTXHOKH
SURSRUFLRQDDTXDOLGDGHGHVHUIXQFLRQiULRS~EOLFR
$OpPGLVVRRSDUWLFXODUWDPEpPSRGHUiFRPHWHUHVVH
FULPHFRPRFRDXWRURXVHMDDMXGDQGRRIXQFLRQiULR DUW 6H R IXQFLRQiULR S~EOLFRFRQFRUUHFXOSRVD
S~EOLFRDSUDWLFiOR,PDJLQHTXHR'LUHWRUGHXPD(VFROD PHQWHSDUDRFULPHGHRXWUHP
UHFHEDPDWHULDLV FLPHQWRHWF SDUDDFRQVWUXomRGHXPD
TXDGUD HP VXD (VFROD  PDV DFHUFD FRP R 3HQDGHWHQomRGHWUrVPHVHVDXPDQR
3HQD
FDPLQKRQHLURWUDQVSRUWDGRUSDUDDPERVGHVYLDUHPSDUWH
GDPHUFDGRULDGHL[DQGRDFRPWHUFHLURGHTXHPUHFHEH 9LPRVTXHRVFULPHVSUySULRVGRVIXQFLRQiULRVS~EOLFRV
UmRXPGLQKHLURHGLYLGLUmRWDOOXFURHVVHFDPLQKRQHLUR VyVmRSXQLGRVQDPRGDOLGDGHGRORVDRXVHMDQmRKDYLD
VHUi FR DXWRU GR SHFXODWR FRPHWLGR SHOR 'LUHWRU GD SXQLomRVHRIXQFLRQiULRS~EOLFRQmRWLYHUDLQWHQomRGH
(VFRODHUHFHEHUiDPHVPDSHQDTXHHOH SUDWLFDU R FULPH LVWR p VH R SUDWLFDU VHP TXHUHU
FXOSRVDPHQWHRXSRULPSUXGrQFLDRXSRUQHJOLJrQFLD
$WHQomR
$WHQomR SHORTXHYLPRVDWpDJRUDVHXPDSHVVRDSHJDV RXSRULPSHUtFLD 
VHXPDPDWpULDSULPDSHUWHQFHQWHj8QLmRH
SURGX]LVVHDOJXPSURGXWRQRYRWHRULFDPHQWHWDOSHVVRD (VWD p D ~QLFD H[FHomR QRV GRLV FULPHV DQWHULRUHV R
HVWDULDFRPHWHQGRFULPHGHSHFXODWRMiTXHWDOPDWpULD IXQFLRQiULRS~EOLFRFRQVFLHQWHPHQWHDJHFRPDYRQWDGH
SULPDHPSUHJDGDQD SURGXomRGREHPHUDGHSURSULH GHVHDSURSULDUGREHPRXGHVXEWUDtOR'L]VHHQWmR
GDGHGRSRGHUS~EOLFR TXHHOHDJLXFRPGROR

0DVGHDFRUGRFRPXPDQRYD/HL/HLDGHQ
/HL Q
QGH
 4XDQGRWRGDYLDRIXQFLRQiULRQmRTXHUSDUWLFLSDUGR
IHYDUWVHXPDSHVVRDSURGX]LUEHQVRXH[SORUDU GHVYLRRXGDVXEWUDomRPDVDFDEDVHP
VHP
VHPTXHUHUDX[LOL
TXHUHU
PDWpULDSULPD SHUWHQFHQWHV j 8QLmR VHP D GHYLGD DQGR DOJXpP D GHVYLDU RX D VXEWUDLU VHMD SRUTXH IRL
DXWRUL]DomRQmRFRPHWHUiFULPHGHSHFXODWRHVLP LPSUXGHQWHVHMDSRUTXHIRLQHJOLJHQWHVHMD SRUTXHIRL
FULPHGHXVXUSDomR LPSHULWRHVWHIXQFLRQiULRWDPEpPUHVSRQGHSHORFULPH
GH SHFXODWR SRUpP QD PRGDOLGDGH FXOSRVD H QmR QD
DUW $SOLFDVH
$SOLFDVH D PHVPD SHQD VHRIXQFLRQiULR GRORVD
HPERUD
HPERUDQmR
QmRWHQGR
WHQGRDSRVVH
SRVVHGR
GRGLQKHLUR
GLQKHLURYDORU
RX
RXEHP
EHPRVXEWUDL
VXEWUDLRX
RXFRQFRUUH
FRQFRUUHSDUD
SDUDTXH
TXHVHMD &RPR R IXQFLRQiULR QmR WHYH GROR PDV Vy FXOSD
VXEWUDtGR HP SURYHLWR SUySULR RX DOKHLR LPSUXGrQFLDLPSHUtFLDRXQHJOLJrQFLD DSHQDpPHQRU
YDOHQGRVH
YDOHQGRVHGH
GHIDFLOLGDGH
IDFLOLGDGHTXH
TXHOKH
OKHSURSRUFLRQD WDQWRQDTXDQWLGDGH VyGHWUrVPHVHVDXPDQR TXDQWR
DTXDOLGDGHGHIXQFLRQiULR QDTXDOLGDGH HPYH]GHUHFOXVmRDSHQDVGHWHQomR 
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

DUW 1RFDVRGRSDUiJUDIRDQWHULRUDUHSDUDomR 6XMHLWR


6XMHLWR$WLYRRIXQFLRQiULRS~EOLFRSRVVtYHODSDUWLFL
$WLYR
GR
GR GDQR
GDQR VH
VH SUHFHGH
SUHFHGH j VHQWHQoD
VHQWHQoD LUUHFRUUtYHO SDomRGHSHVVRDVTXHQmRRVHMDP
H[WLQJXH D SXQLELOLGDGH VH OKH p SRVWHULRU
UHGX]GHPHWDGHDSHQDLPSRVWD 6XMHLWR
6XMHLWR3DVVLYRR(VWDGRHRXWUDV3HVVRDV-XUtGLFDVGH
3DVVLYR
'LUHLWR3~EOLFRHYHQWXDOPHQWHRSDUWLFXODUSUHMXGLFDGR
5HFRQKHFHQGR PDLV XPD YH] D PHQRU JUDYLGDGH GD
SDUWLFLSDomRGRIXQFLRQiULRS~EOLFRQRSHFXODWRFXOSRVR 2EMHWRGD7XWHOD3HQDO
R &yGLJR 3HQDO QHVWH SDUiJUDIR DLQGD SHUPLWH D HOH RSDWULP{QLRGD$GPLQLVWUDomR3~EOLFD
OLYUDUVHGDSHQDGHVGHTXHDQWHVGDFRQGHQDomRSDJXH
RSUHMXt]RjDGPLQLVWUDomR6HSDJDUGHSRLVDSHQDVUHGX] $omR)tVLFD
DSHQDQDPHWDGH DDomRpDSURSULDUVHPDVDSHQDVGRREMHWRTXHUHFHEHX
RXSRUHUURGHRXWUDSHVVRDRXQRH[HUFtFLRGHVHXFDUJR
2TXHpVHQWHQoDLUUHFRUUtYHO"eDTXHODDTXHQmR
FDEHPDLVQHQKXPUHFXUVRRXVHMDHVWiSURQWDSDUDVHU (OHPHQWR6XEMHWLYR,QMXVWRRGROR
(OHPHQWR6XEMHWLYR,QMXVWR
H[HFXWDGD$VHQWHQoDpSURIHULGDSHOR-XL]GH'LUHLWR
TXH MXOJRX R SURFHVVR 6H R UpX RX D DFXVDomR  QmR $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
JRVWRX SRGH LQWHUSRU XP UHFXUVR FKDPDGR DSHODomR
SHGLQGR DR 7ULEXQDO TXH UHYHMD R FDVR H Gr XPD QRYD
0XLWDVSHVVRDVSRUHUURjVYH]HVSDJDPj$GPLQLVWUD
GHFLVmR FKDPDVHDFyUGmR 
omR 3~EOLFD LPSRUWkQFLD LQGHYLGD RX DWp HVTXHFH GH
SHJDU XP ERP WURFR  $TXHOH TXH QR H[HUFtFLR GH XP
$VVLPTXDQGRR-XL]GH'LUHLWRMXOJDRFDVRHGHFODUD
FDUJR RX IXQomR S~EOLFD GH FDL[D SRU H[HPSOR  VH
TXHRUpXpFXOSDGRHVVDVHQWHQoDpUHFRUUtYHOSRUTXH
DSURYHLWD GHVVD VLWXDomR H VH DSURSULD GR GLQKHLUR RX
DLQGDpSRVVtYHOLQWHUSRUXPUHFXUVR1HVWHSDUiJUDIRD
XWLOLGDGHTXHUHFHEHXSRUHUURGDTXHODSHVVRDFRPHWHUi
SDODYUDVHQWHQoDHVWiHPSUHJDGDQRVHQWLGRGHGHFLVmR
SHFXODWRPHGLDQWHHUURGHRXWUHP
RX VHMD WDQWR D GHFLVmR GR -XL] GH 'LUHLWR VHQWHQoD 
FRPR D GHFLVmR GRV 7ULEXQDLV DFyUGmR  ( PHVPR D
GHFLVmR GR 7ULEXQDO WDPEpP p UHFRUUtYHO SRUTXH Ki 3RU VH WUDWDU GH XP  FULPH PHQRV JUDYH R SHFXODWR
7ULEXQDLVVXSHULRUHVTXHSRGHUmRUHYHURFDVRHSURIHULU GRORVRQRUPDO DUW MiTXHRIXQFLRQiULRIRLWHQWDGR
XPQRYRDFyUGmRLVVRDWpRFDVRFKHJDUDR6XSUHPR SRUXPDVLWXDomRDQRUPDODSHQDpPHQRUTXHDGDTXHOH
7ULEXQDO)HGHUDO D~OWLPDLQVWkQFLDHPQRVVR3DtV 
$TXL WDPEpP p QHFHVViULR SDUD D FDUDFWHUL]DomR GR
0DVSDUDUHFRUUHUpQHFHVViULRTXHDOHLSUHYHMDRFDEL FULPHTXHRIXQFLRQiULRS~EOLFRWHQKDWLGRDLQWHQomRGH
PHQWRGHXPUHFXUVRHTXHDSDUWHLQWHUHVVDGD RUpXRX VHDSURSULDUGRGLQKHLURRXVHMDTXHDMDFRPGRORVHR
D DFXVDomR  LQWHUSRQKDP R UHFXUVR QR SUD]R PDUFDGR WDO IXQFLRQiULR FDL[D QmR SHUFHEHX TXH ILFRX FRP R
SHOD OHL 4XDQGR D OHL QmR SUHYLU UHFXUVR RX D SDUWH GLQKHLURQmRFRPHWHUiWDOFULPH
LQWHUHVVDGD UpXRXDFXVDomR QmRUHFRUUHUQRSUD]ROHJDO
DVHQWHQoDVHWRUQDUiLUUHFRUUtYHO

6LJQLILFDSRLVTXHRUpX IXQFLRQiULRS~EOLFRTXHWHULD 3HFXODWRYLD,QIRUPiWLFD


FRPHWLGRSHFXODWRFXOSRVR WHUiXPWHPSmRSDUDSDJDU
H ILFDU OLYUH GD SHQD SRGHUi SDJDU D TXDOTXHU WHPSR
GHVGHTXHDQWHVGHVXDFRQGHQDomRVHWRUQDULUUHFRUUtYHO %HQID]HMD D UHIRUPD SHQD LQWURGX]LGD FRP D /HL Q
3RGHUiGLVFXWLUVXDFXOSDHPWRGDVDVLQVWkQFLDVHVHDR  GH GHVFUHYHQGRQRYDVFRQGXWDVWtSLFR
ILQDO SHUFHEHU TXH VHUi PHVPR FRQGHQDGR SDJDUi R SHQDLVFRQWUDD$GPLQLVWUDomR3~EOLFDFRQWUDULDQGRD
GpELWRHVHOLYUDUiGDUHVSRQVDELOL]DomRFULPLQDO YHOKD SUD[H GH VH HQFHUUDUHP RV WLSRV QD OHJLVODomR
HVSDUVDRSWDQGRSRUVXDLQFOXVmRQR&yGLJR3HQDODLQGD
$WHQomR
$WHQomR DH[WLQomRGDSXQLELOLGDGHSHORSDJDPHQWRVy TXHOKHDFUHVFHQGRVXEDUWLJRVSDUDVXDPHOKRUDGHTXD
pSRVVtYHOQRSHFXODWRFXOSRVR6HRIXQFLRQi omRQRVLVWHPDGHVVHFRGH[
ULRIRUDFXVDGRGHSHFXODWRGRORVRQmRILFDUi
OLYUHGDFRQGHQDomRSDJDQGRRSUHMXt]R 'RLV QRYRV WLSRV IRUDP DFUHVFHQWDGRV jV ILJXUDV
SHFXODWiULDV Mi GHVFULWDV DPEDV SUDWLFiYHLV SHOD YLD GD
LQIRUPiWLFDMiQmRVHPWHPSRSRLVQmRVmRSRXFRVRV
IXQFLRQiULRV TXH WrP DFHVVR DRV VLVWHPDV GH GDGRV H
3HFXODWR0HGLDQWH(UURGH2XWUHP FRPSXWDomR H FRP XPD VLPSOHV DOWHUDomR GD EDVH GH
GDGRVRXGRVLVWHPDGH,QIRUPDo}HVIRUWXQDVSRGHUmR
VHUGHVYLDGDVGRVFRIUHVS~EOLFRV
$UW $SURSULDUVH
$SURSULDUVHGH
GHGLQKHLUR
GLQKHLURRX
RXTXDOTXHU
TXDOTXHUXWLOLGDGH
TXH
TXHQR
QRH[HUFtFLR
H[HUFtFLRGR
GRFDUJR
FDUJRUHFHEHX
UHFHEHXSRU
SRUHUUR
HUURGH &RQILUDDVQRYDVGHVFULo}HVWtSLFDVTXHHVWmRYLJHQGR
RXWUHP GHVGH 287 HPERUD D OHL IRVVH SXEOLFDGD HP
HVWDEHOHFHXHODXPDYDFDWLROHJLVGHGLDV 
3HQD
3HQD UHFOXVmRGHXPDTXDWURDQRVHPXOWD
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
,QVHUomRGH'DGRV)DOVRV SDUWtFLSH  SUDWLFDP R PHVPtVVLPR FULPH RX VHMD p
HP KRPLFLGDTXHPGLVSDUDRUHYyOYHUHTXHPOKHHPSUHVWRX
6LVWHPDGH,QIRUPDo}HV R UHYyOYHU SDUD WDO ILP  2FRUUH SRUpP TXH HVWH WLSR
SHQDOpSUySULRGRIXQFLRQiULRDXWRUL]DGRRXVHMDVyHOH
$UW$ ,QVHULU
,QVHULURX
RXIDFLOLWDU
IDFLOLWDURIXQFLRQiULR
IXQFLRQiULRDXWRUL]DGRD FRPHWH HVWH GHOLWR $VVLP VH XP RXWUR IXQFLRQiULR
LQVHUomR
LQVHUomR GH
GH GDGRV
GDGRV IDOVRV
IDOVRV DOWHUDU RX H[FOXLU SUDWLFDUDDOWHUDomRGDEDVHGHGDGRVHVVHRXWURIXQFLR
LQGHYLGD
LQGHYLGDPHQWH
PHQWH GDGRV
GDGRV FRUUHWRV
FRUUHWRV QRV
QRV VLVWHPDV QiULR SUDWLFDUi R FULPH SUHYLVWR QR DUWLJR VHJXLQWH
LQIRUPDWL]DGRV
LQIRUPDWL]DGRV RXEDQFRVGHGDGRVGD$GPL DUW%&3 HQTXDQWRRIXQFLRQiULRDXWRUL]DGRTXH
QLVWUDomR
QLVWUDomR3~EOLFD
3~EOLFDFRP
FRPRILP
ILPGH
GHREWHU
REWHUYDQWDJHP IDFLOLWRXVHXDFHVVRDRVGDGRVHVWHSUDWLFDUiRFULPHGHVWH
LQGHYLGD
LQGHYLGDSDUD
SDUDVL
VLRX
RXSDUD
SDUDRXWUHP
RXWUHPRX
RXSDUD
SDUDFDXVDU DUW$&3HQmRRPHVPRFULPHGDTXHORXWUR
GDQR

3HQD
3HQD UHFOXVmRGH GRLV D GR]H DQRVH 0RGLILFDomRRX$OWHUDomR1mR$XWRUL]DGD
PXOWD GH6LVWHPDGH,QIRUPDo}HV

2 WLSR SHQDO HP VL PHVPR QmR RIHUHFH QRYLGDGH $UW% 0RGLILFDU
0RGLILFDURX
RXDOWHUDU
DOWHUDURIXQFLRQiULR
IXQFLRQiULRVLVWHPDGH
OLPLWDQGRVHjSUHYLVmRGDLQVHUomRGHGDGRVIDOVRVTXDO LQIRUPDo}HVRX
LQIRUPDo}HV RXSURJUDPDGHLQIRUPiWLFDVHP
SURJUDPDGHLQIRUPiWLFDVHP
DDOWHUDomRRXH[FOXVmRLQGHYLGDGHGDGRVFRUUHWRVQR DXWRUL]DomR
DXWRUL]DomRRX
RXVROLFLWDomR
VROLFLWDomRGH
GHDXWRULGDGH
DXWRULGDGHFRP
VLVWHPD LQIRUPDWL]DGR GD $GPLQLVWUDomR 3~EOLFD SHWHQWH
QDWXUDOPHQWH FRP R SURSyVLWR GH REWHU YDQWDJHP
LQGHYLGDSDUDVLRXSDUDRXWUHP 3HQD
3HQD GHWHQomR GH  WUrV  PHVHV D  GRLV
DQRVHPXOWD
+iGHVHHQWHQGHUDTXLSRUYDQWDJHPLQGHYLGDWDQWRD
REWHQomR RX H[WUDYLR GH UHFXUVRV RX FUpGLWRV FRPR D ~QLFR $V
$V SHQDV
SHQDV VmR
VmR DXPHQWDGDV GH XP WHUoRDWpD
OLEHUDomRGHGpELWRVRXGHVRQHUDomRGHTXDOTXHURUGHP PHWDGH
PHWDGHVH
VHGD
GDPRGLILFDomR
PRGLILFDomRRX
RXDOWHUDomR
DOWHUDomRUHVXOWD
SDWULPRQLDO GDQR
GDQR SDUD
SDUD D $GPLQLVWUDomR3~EOLFDRXSDUDR
$GPLQLVWUDomR3~EOLFDRXSDUDR
DGPLQLVWUDGR
2 ODQoDPHQWR GD ILJXUD WtSLFD GHQWUH RV WLSRV GH
SHFXODWRGHL[DFODURTXHDYDQWDJHPLQGHYLGDKiGHVHU 'XDV FDUDFWHUtVWLFDV GLVWLQJXHP HVWH WLSR SHQDO GR
SDWULPRQLDO DQWHULRU SULPHLUDPHQWH TXDOTXHU IXQFLRQiULR S~EOLFR
SRGHUiFRPHWrORGHVGHTXHQmRWHQKDDXWRUL]DomRSDUD
$GHVFULomRWtSLFDWHPH[DWDDGHTXDomRDRVHSLVyGLRV PH[HU QR VLVWHPD GH LQIRUPDo}HV RX QR SURJUDPD GH
RFRUULGRV QR '(75$163 RQGH DV PXOWDV DSOLFDGDV D LQIRUPiWLFDHPVHJXQGROXJDUHPERUDHVWHMDGHQWHRV
PRWRULVWDVHUDPH[FOXtGDVGREDQFRGHGDGRVOLYUDQGRRV FULPHVGHSHFXODWRTXHSUHVVXS}HLQWHQomRGHFRQTXLVWD
SURSULHWiULRVGHYHtFXORVGHVHXSDJDPHQWRTXDQGRGH GHYDQWDJHPPDWHULDO SDWULPRQLDO LQGHYLGDDSUiWLFD
VHXOLFHQFLDPHQWR GHVWH FULPH GR DUW% QmR p DVVRFLDGD j SUHWHQVmR
PDWHULDORXVHMDSDUDVXDFRQILJXUDomRQmRpQHFHVViULR
$VVLPVHRVHUYLGRUS~EOLFRDSHQDVGHOHWDVVH DSDJDVVH TXH R DJHQWH TXHLUD REWHU YDQWDJHP PDWHULDO LQGHYLGD
RVGDGRVSDUDOLYUDURPRWRULVWDLQIUDWRUGDSRQWXDomR QHPSDUDVLQHPSDUDRXWUHP
SXQLWLYDGR&7%QmRVHFRQILJXUDULDRFULPHDTXLSUHYLV
WRMiTXHDYDQWDJHPVHULDGHQDWXUH]DPHUDPHQWHPRUDO $VVLPSH[FRQILJXUDUVHiRFULPHRVLPSOHVIDWRGH
RXDGPLQLVWUDWLYDHQmRSDWULPRQLDO XP IXQFLRQiULR TXDOTXHU DFHVVDU R VLVWHPD S~EOLFR GH
GDGRVHGDOLH[FOXLU GHOHWDU RUHJLVWURGHXPDFRQGHQD
8PDFDUDFWHUtVWLFDGHVWDFDVHQRWLSRSHQDOWUDWDVHGH omRFULPLQDOWRUQDQGROLPSDVXDILFKDRXDGHRXWUHP
FULPHSUySULRMiTXHQmRSRGHVHUFRPHWLGRSRUTXDOTXHU ,JXDOPHQWH XP VHUYLGRU S~EOLFR TXDOTXHU TXH GHOHWDU
IXQFLRQiULRS~EOLFRPDVDSHQDVSHORIXQFLRQiULRDXWRUL DSDJDU RVGDGRVGRFDGDVWURGR'(75$1SDUDOLYUDU
]DGRRXVHMDDSHQDVDTXHOHTXHWHPDLQFXPErQFLD RX XPPRWRULVWDLQIUDWRUGDSRQWXDomRSXQLWLYDGR&7%2X
OLEHUGDGH SDUDHIHWXDURVODQoDPHQWRVGHGDGRVQRQRV RIXQFLRQiULRTXHSDUDVHYLQJDUGHXPDPLJRODQoDUVHX
VLVWHPDVLQIRUPDWL]DGRVRXEDQFRVGHGDGRVGD$GPLQLV QRPH RXGHVXDHPSUHVD QR&DGDVWURGH,QDGLPSOHQWHV
WUDomR3~EOLFD &$',1 FDXVDQGROKHHPEDUDoRV

$VVLPVHXPIXQFLRQiULRDEHOKXGRHVWUDQKRDRVHUYLoR 8PIXQFLRQiULRS~EOLFRWDPEpPFRPHWHUiRFULPHVH
DSURYHLWDUVHGHKDYHURIXQFLRQiULRDXWRUL]DGRLGR DRLQYpVGHDSDJDURXLQFOXLUGDGRVPRGLILFDURUHVSHFWL
DREDQKHLURLQYDGLURVHWRUHGLJLWDUGDGRVIDOVRVSDUD YRVRIWZDUHGHLQIRUPiWLFDSURJUDPDQGRRSDUDQXQFDOHU
REWHUYDQWDJHPLQGHYLGD SDUDVLRXSDUDRXWUHP QmR QmR GHWHUPLQDGRV GDGRV H FRP LVVR SUHVHUYDU LQWDFWRV RV
WHUi FRPHWLGR R FULPH SUHYLVWR QHVWH DUW$&3 GDGRV SRUpP RFXOWRV  R TXH VLJQLILFDULD GD PHVPD
FRPHWHUiRGRDUWLJRVHJXLQWH  IRUPDVRQHJDURFRQKHFLPHQWRGDLQIRUPDomRGRVLVWHPD

0DLV XP DVSHFWR PHUHFH GHVWDTXH Ki DTXL RXWUD 3HUFHEDVHTXHRREMHWLYRGDWXWHODSHQDOpDSUHVHUYD


H[FHomRDRSULQFtSLRGDXQLGDGHGRFULPHSHODUHJUDGD omRGRVGDGRVGRVVLVWHPDVGHLQIRUPDo}HVHGRVUHVSHFWL
FRDXWRULD DUW&3 RDXWRUHRF~PSOLFH FRDXWRURX YRVSURJUDPDVGHLQIRUPiWLFD
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

3RGHUi R IXQFLRQiULR DXWRUL]DGR SUDWLFDU R GHOLWR 7DPEpPHVWHGHOLWRYLVDjSURWHomRGDERDRUGHPGD


GHVWHDUWLJR"""1mRH6LP1mRVHDDOWHUDomRLQGHYLGD $GPLQLVWUDomR3~EOLFDDTXDOSDUDDOFDQoDUVXDVILQDOLGD
WLYHUSRUSURSyVLWRDREWHQomRGHYDQWDJHPLQGHYLGDRX GHVSUHFLVDJXDUGDUVHXVOLYURVHGRFXPHQWRVHWrORVj
D FDXVDomR GH GDQR KLSyWHVH HP TXH VH FRQILJXUDUi R GLVSRVLomRSDUDVXDVQHFHVVLGDGHV+iOLYURVGHUHJLVWURV
FULPHGRDUWLJRDQWHULRUH6LPVHHOHDJLXVHPLQWHQomR GHWRGDVDVDWLYLGDGHVS~EOLFDVEHPFRPRGRFXPHQWRV
GHFRQTXLVWDUDYDQWDJHPLQGHYLGDRXFDXVDUGDQR TXHFRPSURYDPWDLVDWLYLGDGHV

$QRWHVH RXWURVVLP TXH D FDXVDomR GH GDQR QmR p 2VOLYURVH GRFXPHQWRVVmRQHFHVViULRVWDQWRSDUDD


FLUFXQVWkQFLDHOHPHQWDUGRWLSRRXVHMDRFULPHUHVWDUi SUySULDDGPLQLVWUDomRS~EOLFDFRPSURYDUTXHVHXVDWRV
FRQILJXUDGRLQGHSHQGHQWHPHQWHGHRDJHQWHKDYHUWLGRRX VmRSUDWLFDGRVGHDFRUGRFRPDOHLTXDQWRSDUDH[SHGLU
QmRDLQWHQomRGHFDXVDUGDQRj$GPLQLVWUDomR3~EOLFDRX FHUWLG}HVDSDUWLFXODUHVTXHGHODSUHFLVHP
D DOJXP DGPLQLVWUDGR R HYHQWXDO UHVXOWDGR GDQRVR
IXQFLRQiULDDSHQDVFRPRFDXVDGHDXPHQWRGDSHQD GH
$JXDUGDGHWDLVOLYURVHGRFXPHQWRVQDWXUDOPHQWHVy
DD H[YLGR~QLFRGRDUWLJR
SRGHVHUIHLWDSRUIXQFLRQiULRVS~EOLFRV'HVVDIRUPDR
GHOLWRGHH[WUDYLRVRQHJDomRRXLQXWLOL]DomRGHOLYURRX
  3RU ILQDO PHUHFH DWHQomR TXH R UHVXOWDGR GDQRVR
GRFXPHQWRVySRGHVHUGRIXQFLRQiULRS~EOLFRHDLQGD
LPSRUWDUi DXPHQWR GH SHQD DSHQDV VH SUHMXGLFDU D  j
$GPLQLVWUDomR3~EOLFDRX E DRDGPLQLVWUDGRQmR QmRVH DVVLPRIXQFLRQiULRS~EOLFRTXHHVWHMDQRH[HUFtFLRGR
QmR
DXWRUL]DQGRDH[DVSHUDomRVHRSUHMXGLFDGRIRLWHUFHLUD FDUJRGHJXDUGDUROLYURRXRVGRFXPHQWRV
SHVVRDpTXHDOHLGLVWLQJXLXH[SUHVVDPHQWHQDFDXVDGH
DXPHQWR VH GD PRGLILFDomR RX DOWHUDomR UHVXOWD GDQR 3XQH SRUWDQWR D OHL DR IXQFLRQiULR S~EOLFR TXH QR
SDUDD$GPLQLVWUDomR3~EOLFDRXSDUDRDGPLQLVWUDGR
RDGPLQLVWUDGR
RDGPLQLVWUDGR H[HUFtFLRGDIXQomRGHJXDUGDUROLYURRXRVGRFXPHQWRV
WUDLUDFRQILDQoDGDDGPLQLVWUDomRS~EOLFDHDHODFDXVDU
)RVVH GD LQWHQomR GR OHJLVODGRU DJUDYDU D SXQLomR RSUHMXt]RGHWDOWLSRGHFRQGXWD
GLDQWHGHUHVXOWDGRGDQRVRDTXDOTXHUSHVVRDWHULDXVDGR
DH[SUHVVmRDPSODRXWUHPRXDWHUFHLURVHWFPDV 8VD D OHL YiULRV YHUERV SDUD GHILQLU D FRQGXWD GR
QmRVyHPSUHJRXGHQRPLQDomRHVSHFtILFDDGPLQLVWUDGR FULPLQRVRH[WUDYLDUpRPHVPRTXHGHVYLDURXVHMD
FRPR DLQGD R DUWLJR GHILQLGR R   $VVLP Vy KDYHUi R PXGDURGHVWLQRRXRILPSDUDRQGHHUDHQFDPLQKDGR
DXPHQWRGDSHQDVHRGDQRDIHWDUjTXHODSHVVRDDTXHP VRQHJDU VLJQLILFD D QmR DSUHVHQWDomR GR OLYUR p D
VH UHILUDP RV GDGRV DOWHUDGRV RX H[FOXtGRV H QmR D RFXOWDomR LQWHOHFWXDO RX IUDXGXOHQWD GR OLYUR RX GRV
TXDOTXHURXWUDSHVVRDFRPRSH[RVFRQVXOHQWHVTXH GRFXPHQWRVMiLQXWLOL]DUTXHUGL]HUWRUQDULPSUHVWiYHO
UHVXOWHPHQJDQDGRVSHORIDOVLGDGHGRUHJLVWURPRGLILFDGR ROLYURRXRVGRFXPHQWRVHVWUDJiORVDUUXLQiORV

3RUOLYURVFRPSUHHQGHPVHWRGRVRVOLYURVGHUHJLV
WURVQRWDVDWDVODQoDPHQWRVWHUPRVSURWRFRORV'RFX
([WUDYLR6RQHJDomRRX,QXWLOL]DomR
GH/LYURRX'RFXPHQWR PHQWRV VmR RV DUTXLYRV PXVHXV SURMHWRV SURYDV GH
FRQFXUVRV SDUHFHUHV UHODWyULRV DXWRV GH SURFHVVR
DGPLQLVWUDWLYRHVFULWXUDVHWF1HFHVVDULDPHQWHSRUpP
R OLYUR RX RV GRFXPHQWRV TXH VRIUHUHP R H[WUDYLR D
$UW ([WUDYLDU
([WUDYLDUOLYUR
OLYURRILFLDO
RILFLDORX
RXTXDOTXHUGRFXPHQWR
VRQHJDomR RX D LQXWLOL]DomR GHYHP WHU UHODomR FRP D
GH
GHTXH
TXHWHP
WHPDJXDUGD
JXDUGDHP
HPUD]mR
UD]mRGR
GRFDUJR
FDUJRVRQH
DGPLQLVWUDomRS~EOLFDSRXFRLPSRUWDQGRVHROLYURRXGR
JiORRXLQXWLOL]iORWRWDORXSDUFLDOPHQWH
FXPHQWRpS~EOLFRRXSDUWLFXODU
3HQD
3HQD UHFOXVmR GH XP D TXDWUR DQRV VH R IDWRQmR
FRQVWLWXLFULPHPDLVJUDYH
(PSUHJR,UUHJXODUGH9HUEDVRX5HQGDV3~EOLFDV
 6XMHLWR
6XMHLWR $WLYRRIXQFLRQiULRS~EOLFRVHQGRSRVVtYHOD
$WLYR
SDUWLFLSDomRGHSHVVRDVTXHQmRRVHMDP

6XMHLWR3DVVLYR $UW 'DU


DU jV
jV YHUEDV
YHUEDV RX UHQGDV S~EOLFDVDSOLFDomR
RX UHQGDV
R(VWDGRH3HVVRDV-XUtGLFDVGH'LUHLWR3~EOLFR GLYHUVDGDHVWDEHOHFLGDHPOHL

2EMHWRGD7XWHOD3HQDO  3HQDGHWHQomRGHXPDWUrVPHVHVRXPXOWD
3HQD
D$GPLQLVWUDomR3~EOLFDHPJHUDO
 6XMHLWR
6XMHLWR $WLYR
$WLYR R IXQFLRQiULR S~EOLFR FRP SRGHU GH
$omR
$omR)tVLFD
)tVLFDWUrVWLSRVGHDomRD H[WUDYLDUE VRQHJDU GLVSRUGDVYHUEDVUHQGDV
F LQXWLOL]DU WRWDORXSDUFLDOPHQWH 
 6XMHLWR
6XMHLWR 3DVVLYR
3DVVLYR R (VWDGR H DV 3HVVRDV -XUtGLFDV GH
(OHPHQWR6XEMHWLYR,QMXVWR 'LUHLWR3~EOLFR
RGROR1mR
1mRpFULPHDFRQGXWDFXOSRVD
1mR
 2EMHWR
2EMHWR GD
GD 7XWHOD
7XWHOD 3HQDODOHJDOLGDGHRUoDPHQWiULDGD
3HQDO
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO $GPLQLVWUDomR3~EOLFD
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
$omR)tVLFD 6XMHLWR
6XMHLWR3DVVLYRR(VWDGRD3HVVRD-XUtGLFDGH'LUHLWR
3DVVLYR
pGDUDSOLFDomRGLYHUVDGDHVWDEHOHFLGDHPOHLjVYHUEDVRX 3~EOLFRDSHVVRDTXHVHVXEPHWHXjH[WRUVmR
UHQGDVS~EOLFDVGHVYLDUGDSUHYLVmRRUoDPHQWiULDOHJDO
SDUDRXWUDQmRSUHYLVWD 2EMHWRGD7XWHOD3HQDO
DPRUDOLGDGHHFUHGLELOLGDGHGDDGPLQLVWUDomRS~EOLFD
(OHPHQWR6XEMHWLYR,QMXVWR
pRGROR1mR
1mRKiFULPHQDDomRFXOSRVD
1mR  $omR
$omR )tVLFD
)tVLFD p H[LJLU D YDQWDJHP LQGHYLGD SDUD VL RX
SDUDRXWUHPEDVWDDVLPSOHVH[LJrQFLDHRUHFHELPHQWR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO GDYDQWDJHPpPHURH[DXULPHQWRGRFULPH

$ DGPLQLVWUDomR S~EOLFD RXWUD FRLVD QmR ID] VHQmR (OHPHQWR6XEMHWLYR,QMXVWR


DSOLFDUGLQKHLURDUUHFDGDGRGRSRYReSULQFtSLRPRUDO RGROR1mR
1mRpFULPHDFRQGXWDFXOSRVD
1mR
TXHHVVHGLQKHLURGHYDVHUDSOLFDGRQRVH[DWRVWHUPRVGD
OHLLVWRpGHIRUPDUHJXODUQmRVHQGRDGPLWLGRQHQKXP $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
FDSULFKRGRVDGPLQLVWUDGRUHVS~EOLFRVTXHVmRHQFDUUH
JDGRVGHVVDDSOLFDomR eHVWHFULPHFRQKHFLGRFRPRDH[WRUVmRSUDWLFDGDSHOR
IXQFLRQiULRS~EOLFRQRH[HUFtFLRGDIXQomRRXDSUHWH[WR
2FRUUHTXHDOHLVHPSUHSUHYrDIRUPDHRVILQVHPTXH GHOD 2FRUUH TXDQGR R IXQFLRQiULR S~EOLFR H[LJH QmR
LPSRUWD VH SDUD VL PHVPR RX SDUD GDU D RXWUD SHVVRD
GHYHUmR  VHU JDVWDV DV YHUEDV S~EOLFDV $VVLP DIRUD
XPDYDQWDJHPLQGHYLGDGHDOJXpPDSURYHLWDQGRVHSDUD
GLVSRVLo}HVHVSHFLDLVGHUHJUDKiXPRUoDPHQWRDQXDO
IRUPXODU D H[LJrQFLD GH VHX FDUJR RX GD IXQomR TXH
HODERUDGR SHOR 3RGHU ([HFXWLYR H DSURYDGR SRU OHL GR
H[HUoD0HVPRTXHRIXQFLRQiULRQmRHVWHMDQRH[HUFtFLR
3RGHUOHJLVODWLYRSUHYHQGRWRGRVRVJDVWRVGDDGPLQLV
GDIXQomRRXQmRDWHQKDDLQGDDVVXPLGRVHDH[LJrQFLD
WUDomRS~EOLFDHPWRGRRDQRVHJXLQWHDRGDDSURYDomR
GHYDQWDJHPLQGHYLGDIRLHPUD]mRGDIXQomRFRQILJX
6H D SHVVRD TXH WHP R SRGHU DGPLQLVWUDWLYR GH JDVWDU
UDVHRFULPHGHFRQFXVVmR
DTXHODVYHUEDVHUHQGDVS~EOLFDVQmRDJDVWDUQRVILQVSUH
YLVWRV QR RUoDPHQWR SUDWLFDUi R FULPH GH HPSUHJR (VWH p R FULPH GH TXH VmR DFXVDGRV FRPXPHQWH
LUUHJXODUGHYHUEDVRXUHQGDVS~EOLFDV PXLWRVIXQFLRQiULRVGH'HOHJDFLDVGH7UkQVLWRH[LJLUHP
FDL[LQKDV RX SURSLQDV SDUD DSURYDUHP FDQGLGDWRV D
(YLGHQWHPHQWH HVWH FULPH WDPEpP Vy SRGHUi VHU FDUWHLUDGHPRWRULVWD
SUDWLFDGRSHORIXQFLRQiULRS~EOLFRTXHGLVSXVHUGRSRGHU
GHHPSUHJDUDVUHQGDVHYHUEDVS~EOLFDV$VVLPVHXP $WHQomR
$WHQomR VHRIXQFLRQiULRS~EOLFRFRPHWHUHVVDDomRH[
JRYHUQDGRUGHHVWDGRXVDUGRGLQKHLURGRSRYRSDUDGDU WRUVLYDWHQGRDHVSHFtILFDLQWHQomRGHGHL[DUGH
IHVWDVHGLVWULEXLUPHGDOKLQKDVGHL[DQGRGHDSOLFDUDV ODQoDURXFREUDUWULEXWRRXFRQWULEXLomRVRFLDO
YHUEDVQDTXLORTXHGHWHUPLQDRRUoDPHQWRWHUiSUDWLFDGR RXFREUiORVSDUFLDOPHQWHHOHQmR
QmRFRPHWHUi
QmR
WDOFULPH RFULPHGHVWHDUW&3HVLPXPXPRXWURFULPH
XPRXWUR FULPH

7DPEpP VH R RUoDPHQWR QmR SUHYLU D GRDomR GH QRYD/HLDGHQ


eTXHRDUWLQF,,GHXPDQRYD
QRYD /HL 
DPEXOkQFLDV D PXQLFtSLRV GH RXWURV HVWDGRV RX GR  '(= HVWDEHOHFHTXHQHVVDKLSyWHVHKDYHUi

PHVPR (VWDGR  PDV R *RYHUQDGRU SDUD FDSULFKR RX FULPH
FULPH
FULPH IXQFLRQDO
IXQFLRQDO FRQWUD
FRQWUD D RUGHP
RUGHP WULEXWiULD
WULEXWiULD H[LJLU
ERQGDGH VXD UHVROYHU ID]HU WDO GRDomR WHUi SRU LJXDO VROLFLWDU RX UHFHEHU SDUD VL RX SDUD RXWUHP GLUHWD RX
HPSUHJDGRDVYHUEDVS~EOLFDVLQGHYLGDPHQWH LQGLUHWDPHQWHDLQGDTXHIRUDGDIXQomRRXDQWHVGHLQLFLDU
VHXH[HUFtFLRPDVHPUD]mRGHODYDQWDJHPLQGHYLGDRX
9HUEDVVmRRVUHFXUVRVGHVWLQDGRVSHODOHLRUoDPHQWi DFHLWDUSURPHVVDGHWDOYDQWDJHPSDUD SDUDGHL[DUGHODQoDURX
SDUD
ULDSDUDDVGHVSHVDVGHVHUYLoRVRXLQYHVWLPHQWRVSUHYLVWRV FREUDU WULEXWR RX FRQWULEXLomR VRFLDO RX FREUiORV
QRRUoDPHQWR$VUHQGDVS~EOLFDVVmRRGLQKHLURTXHD SDUFLDOPHQWH
)D]HQGDS~EOLFDDXIHUHGLUHWDRXRULJLQDULDPHQWHSRUVXDV
DWLYLGDGHVOXFUDWLYDV 9HMDTXHDSHQDpEHPPDLVULJRURVDGHDDQRVGH
UHFOXVmRPDLVPXOWD

&RQFXVVmR
([FHVVRGH([DomR

$UW ([LJLU SDUD VL RX SDUD RXWUHP GLUHWDRX


LQGLUHWDP
LQGLUHWDPHQWH
HQWH DLQGD
DLQGD TXH
TXH  IRUD GD IXQomR RX DUW 6H
6H R IXQFLRQiULR
IXQFLRQiULR H[LJH
H[LJH WULEXWRRXFRQWULEXL
WULEXWRRXFRQWULEXL
DQWHV
DQWHVGH
GHDVVXPLOD
DVVXPLODPDV
PDVHPUD]mR
HPUD]mRGHOD
GHODYDQWD omRVRFLDO
omR VRFLDOTXH
TXHVDEHRXGHYHULDVDEHULQGHYLGR
VDEH
JHPLQGHYLGD RX
RX TXDQGR
TXDQGR GHYLGR
GHYLGR HPSUHJD
HPSUHJD QD FREUDQoD
PHLR
PHLR YH[DWyULR
YH[DWyULR RX
RX JUDYRVR TXH D OHL QmR
3HQDUHFOXVmRGHGRLVDRLWRDQRVHPXOWD
3HQD DXWRUL]D
DXWRUL]D

 6XMHLWR
6XMHLWR $WLYR
$WLYR IXQFLRQiULR S~EOLFR VHQGR SRVVtYHO D 3HQDUHFOXVmR
3HQD GH  WUrV  D  RLWR  DQRVH
SDUWLFLSDomRGHSDUWLFXODUHV PXOWD
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

6XMHLWR$WLYRRIXQFLRQiULRS~EOLFR
6XMHLWR$WLYR DUW 6H
6HRIXQFLRQiULR
IXQFLRQiULRGHVYLDHPSURYHLWRSUySULR
RXGHRXWUHP
RXGHRXWUHPRTXHUHFHEHXLQGHYLGDPHQWH
6XMHLWR
6XMHLWR3DVVLYR
3DVVLYRR(VWDGRD3HVVRD-XUtGLFDGH'LUHLWR SDUDUHFROKHUDRVFRIUHVS~EOLFRV
3~EOLFRRSDUWLFXODUSUHMXGLFDGR
3HQDUHFOXVmRGHGRLVDGR]HDQRVHPXOWD
3HQD
2EMHWRGD7XWHOD3HQDODDGPLQLVWUDomRS~EOLFD
2EMHWRGD7XWHOD3HQDO
6XMHLWR$WLYRRIXQFLRQiULRS~EOLFR
6XMHLWR$WLYR
 $omR)tVLFD
$omR)tVLFDGXDVGLVWLQWDV H[LJrQFLDLQGHYLGDH
R)tVLFD
FREUDQoDYH[DWyULD 6XMHLWR
6XMHLWR3DVVLYR
3DVVLYRR(VWDGRD3HVVRD-XUtGLFDGH'LUHLWR
VVLYR
3~EOLFRRSDUWLFXODUSUHMXGLFDGR
(OHPHQWR6XEMHWLYR,QMXVWR
RGRORQmR
QmRKDYHQGRIRUPDFXOSRVD
QmR 2EMHWRGD7XWHOD3HQDODDGPLQLVWUDomRS~EOLFD
2EMHWRGD7XWHOD3HQDO

$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO $omR)tVLFD
pGHVYLDURGLQKHLURGDDUUHFDGDomRGHLPSRVWRVWD[DVRX
$WHQomR
$WHQomR HVWHDUWLJRIRLPRGLILFDGRSHORDUWGD/HLQ HPROXPHQWRVUHFROKLGRVSRUH[LJrQFLDLQGHYLGD
 '(= TXHDOpPGHDFUHVFHQWDU
(OHPHQWR6XEMHWLYR,QMXVWR
XPDQRYDKLSyWHVH RXRX
RXGHYHULD
GHYHULDVDEHU
VDEHULQGHYLGR WDPEpP
LQGHYLGR
RGROR1mR
1mRKiWLSLFLGDGHFXOSRVD
1mR
WRUQRXDSHQDPXLWRPDLVJUDYHDQWHVDSHQDSULYDWLYDGH
OLEHUGDGHHUDDSHQDVGHGHWHQomRHKDYLDDDOWHUQDWLYDGH
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
SRGHUVHUDSOLFDGDH[FOXVLYDPHQWHDSHQDGHPXOWDDJRUD
DSHQDSULYDWLYDGHOLEHUGDGHMiQmRpDOWHUQDWLYD VHPSUH
(P YHUGDGH WHPVH DTXL PDLV XPD PRGDOLGDGH GH
YDLGDUFDGHLD pPDLVJUDYH GHDDQRVGHUHFOXVmR SHFXODWR(VWiWRGDYLDVRERQRPHGHH[FHVVRGHH[DomR
HDPXOWDpFXPXODWLYDREULJDWyULD SRUTXH R IXQFLRQiULR YDL VH DSURSULDU GHVYLDQGR HP
SURYHLWRSUySULRRXDOKHLRDLPSRUWkQFLDTXHUHFHEHUD
eGHYHUGHWRGRVRVIXQFLRQiULRVFREUDULPSRVWRVWD[DV LQGHYLGDPHQWH QR H[FHVVR GH H[DomR H TXH GHYHULD
HHPROXPHQWRV1mRSRGHSRUpPFREUDUTXDOTXHUGHVVHV UHFROKHUDRVFRIUHVS~EOLFRV
VHQmRIRUGHYLGR6HVDEHQGRTXHRLPSRVWRRXWD[DRX
HPROXPHQWR QmR p GHYLGR H PHVPR DVVLP FREUiOR R $SHQDREYLDPHQWHpPDLRUSRUTXHDOpPGRGDQRj
IXQFLRQiULRS~EOLFRFRPHWHUiFULPHGHH[FHVVRGHFREUDQ $GPLQLVWUDomR 3~EOLFD TXH VHUYLX GH LQVWUXPHQWR DR
oDRXVHMDH[FHVVRGHH[DomR VLQ{QLPRGHFREUDQoD  IXQFLRQiULRS~EOLFRSDUDTXHHVWHFREUDVVHYDORULQGHYLGR
GRSDUWLFXODUKiXPGDQRWDPEpPDRFRQWULEXLQWHTXH
3DUDDFDUDFWHUL]DomRGRFULPHHQWUHWDQWRpQHFHVViULR WHUiPXLWRPDLRUGLILFXOGDGHGHREWHUDUHVWLWXLomRMiTXH
TXHILTXHSURYDGRTXHRIXQFLRQiULR6$%,$TXHRLPSRVWR DLPSRUWkQFLDQmRHQWURXQRVFRIUHVS~EOLFRV
RXWD[DRXHPROXPHQWRTXHFREURXQmR QmR
QmR HUD
HUD GHYLGR(
HYLGR
DJRUDFRPDUHIRUPDGDOHLVHILFDUSURYDGRTXHHOHWLQKD 7DPEpP QHVWH FULPH R DJHQWH SUHFLVD WHU YRQWDGH
FRQGLo}HVGHVDEHURXVHMDVHSHODQDWXUH]DGHVXDIXQ LQWHQomR RGROR GHGHVYLDUDLPSRUWkQFLDHPSURYHLWR
omRHOHGHYHULD
GHYHULD
GHYHULD VDEHU
VDEHUTXHRLPSRVWRQmRHUDGHYLGRMi
HU SUySULRRXDOKHLR
VHUi R VXILFLHQWH SDUD TXH HOH VHMD UHVSRQVDELOL]DGR
FULPLQDOPHQWH FDVRH[LMDRSDJDPHQWRGHVVHWULEXWR (DWHQomR
DWHQomRRGLQKHLURDUUHFDGDGRLQGHYLGDPHQWHQmR
DWHQomR
LQGHYLGR SRGHUiFKHJDUDVHUUHFROKLGRDRVFRIUHVS~EOLFRV6HLVVR
RFRUUHURFULPHMiVHUiRGHSHFXODWR DUW&3 SRLV
3DUDH[HFXWDUTXDOTXHUFREUDQoDRIXQFLRQiULRS~EOLFR FRPRUHFROKLPHQWRRYDORUVHLQFRUSRUDUiDRSDWULP{QLR
GHYHVHUPRGHUDGRHQmRH[FHGHUDIRUPDSHUPLWLGDHP S~EOLFRHHVWHpTXHVHUiGHVIDOFDGR
OHLVHPSUHFRPUHVSHLWRjFRQGLomRKXPDQDGRFLGDGmR
TXHHVWiFREUDQGR6HRIXQFLRQiULRS~EOLFRQDFREUDQoD
GHTXDOTXHULPSRVWRWD[DRXHPROXPHQWRPHVPRTXH
&RUUXSomR3DVVLYD
GHYLGR VHLQGHYLGR
LQGHYLGRHVWDUHPRVGLDQWHGRFULPHDQWHULRU
LQGHYLGR
H[FHVVR GH H[DomR  HPSUHJDU PHLR YH[DWyULR TXH
KXPLOKHHQYHUJRQKHGHVRQUH RGHYHGRURXTXHWRUQH
RGpELWRPDLVFDURRXGLVSHQGLRVRRIXQFLRQiULRFRPHWH $UW 6ROLFLWDU
6ROLFLWDU RX
RX UHFHEHU
UHFHEHU SDUD VLRXSDUDRXWUHP
UiFULPHGHH[FHVVRGHH[DomRQHVVDVHJXQGDPRGDOLGD GLUHWD
GLUHWD RX LQGLUHWDPHQWH DLQGD TXH IRUD GD
GH IXQomR
IXQomR RX
RX DQWHV
DQWHV GH DVVXPLOD PDV HP UD]mR
GHODYDQWDJHP
GHODYDQWDJHPLQGHYLGD
LQGHYLGDRX
RXDFHLWDUSURPHVVD
GHWDOYDQWDJHP
3RUWDQWR R   GR DUW  FRQWpP GRLV WLSRV GH
FULPHVVRERPHVPRQRPHGHH[DomRXPGHFREUDQoDGH
3HQDUHFOXVmRGHGRLVDGR]HDQRVHPXOWD
3HQD
WULEXWRLQGHYLGRHRXWURGHWULEXWRGHYLGRSRUpPIHLWD D
FREUDQoD  GH PRGR YH[DWyULR RX PDLV JUDYRVR SDUD R 2EV D/HLQGHHOHYRXDSHQDPtQLPD
GHYHGRU &ODUR TXH D IRUPD GD FREUDQoD QmR SRGH VHU GHXPSDUDGRLVDQRVHDSHQDPi[LPDGHRLWR
DXWRUL]DGDSRUOHL6HIRUQmRVHFRQILJXUDUiRFULPH SDUD GR]H DQRV GH UHFOXVmR 2 FODUR REMHWLYR p R
FRPEDWHjFRUUXSomRGRVDJHQWHVS~EOLFRV
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
6XMHLWR
6XMHLWR$WLYRRIXQFLRQiULRS~EOLFRPHVPRTXHIRUDGD
$WLYR YDQWDJHPLQGHYLGDRXDFHLWDUSURPHVVDGHWDOYDQWDJHP
IXQomRRXDLQGDDQWHVGHDVVXPLODQHVVDVKLSyWHVHVR SDUD GHL[DU GH ODQoDU RX FREUDU WULEXWR RX FRQWULEXLomR
SDUD
IXQFLRQiULRGHYHUiSUDWLFDURFULPHHPUD]mRGDIXQomR VRFLDORXFREUiORVSDUFLDOPHQWH
S~EOLFD
(YHMDTXHDSHQDpEHPPDLVULJRURVDGHDDQRV
6XMHLWR
6XMHLWR3DVVLYRR(VWDGRD3HVVRD-XUtGLFDGH'LUHLWR
3DVVLYR GHUHFOXVmRPDLVPXOWD
3~EOLFRRSUHMXGLFDGR
DUW $SHQD
SHQDpDXPHQWDGD
DXPHQWDGDGH GHXP
XPWHUoR
WHUoRVH
VHHP
HPFRQ
2EMHWRGD7XWHOD3HQDO VHTrQFLD
VHTrQFLD GD
GD YDQWDJHP
YDQWDJHP RX SURPHVVD R
DFUHGLELOLGDGHHDPRUDOLGDGHGD$GPLQLVWUDomR3~EOLFD IXQFLRQiULR
IXQFLRQiULRUHWDUGD
UHWDUGDRX
RXGHL[D
GHL[DGH
GHSUDWLFDU
SUDWLFDUTXDO
TXHU
XHU DWR
DWR GH
GH RItFLR
RItFLR RX
RX R SUDWLFD
SUDWLFD LQIULQJLQGR
LQIULQJLQGR
$omR)tVLFD GHYHUIXQFLRQDO
WUrV D
D VROLFLWDU E
D E UHFHEHU
E DFHLWDUSURPHVVD
7UD]HVWHSDUiJUDIRXPDVLWXDomRGHDJUDYDPHQWRGD
(OHPHQWR6XEMHWLYR,QMXVWR SHQDGHFRUUXSomRSDVVLYDTXDQGRRIXQFLRQiULRS~EOLFR
RGROR1mR
1mRpFULPHDFRQGXWDFXOSRVD
1mR TXH VROLFLWDUD RX UHFHEHUD D YDQWDJHP RX DFHLWDUD D
SURPHVVDGHWDOYDQWDJHPDLQGDYHPDUHWDUGDU PXLWR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO FRPXP D RILFLDO GH MXVWLoD SHGLGRV H YDQWDJHQV SDUD
VHJXUDUPDQGDGRV RXGHL[DUGHSUDWLFDUTXDOTXHUDWRGH
'D PHVPD IRUPD FRPR D FRQFXVVmR p D H[WRUVmR GR RItFLR WDPEpPFRPXPDRILFLDOGHMXVWLoDSDUDQmRFLWDU
IXQFLRQiULRS~EOLFRDFRUUXSomRpRUXILDQLVPRSUDWLFD UpXV RX QmR HQFRQWUDU EHQV SDUD SHQKRUD HWF  RX
GRSHORVHUYLGRU3DUDVXDFDUDFWHUL]DomRQmRpQHFHVViULR SUDWLFDUDWRGHRItFLRLQIULQJLQGRGHYHUIXQFLRQDO FRPXP
TXH R IXQFLRQiULR UHFHED YDQWDJHP LQGHYLGD EDVWDQGR HPUHSDUWLo}HVEXURFUiWLFDVSHVVRDVFRUURPSHPIXQFLR
DSHQDVTXHVROLFLWH1mRID]GLIHUHQoDVHRVROLFLWDGRRX QiULRVSDUDVHUHPSDVVDGDVjIUHQWHGHRXWURV 
UHFHELGR VHMD XPD YDQWDJHP LQGHYLGD e VXILFLHQWH R
VHUYLGRUDFHLWDUDSURPHVVDGDYDQWDJHP DUW 6H
6HRIXQFLRQiULR
IXQFLRQiULRSUDWLFD
SUDWLFDGHL[DGHSUDWLFDURX
UHWDUGD
UHWDUGDDWR
DWRGH
GHRItFLR
RItFLRFRP
FRPLQIUDomR
LQIUDomRGHGHYHU
GHGHYHU
$ULJRUDJUDQGHPDLRULDGRVIXQFLRQiULRVS~EOLFRVGH IXQFLRQDO
IXQFLRQDOFHGHQGR
FHGHQGRDSHGLGR
SHGLGRGH
GHLQIOXrQFLD
LQIOXrQFLDGH
UHSDUWLo}HVEXURFUiWLFDVHVWiVHPSUHFRPHWHQGRFULPHGH RXWUHP
FRUUXSomRSDVVLYDDWUDYpVGHUHFHELPHQWRGDVIDPRVDV
FDL[LQKDVSDUDTXHXPGRFXPHQWRTXDOTXHUVDLDPDLV 3HQD
3HQD GHWHQomRGHWUrVPHVHVDXPDQRRXPXOWD
UDSLGDPHQWHRXDWUDYpVGDVSURPHVVDVGHFDIH]LQKRRX
FHUYHMLQKDFDVRDSURQWHPTXDOTXHUSDSHODGDFRPPDLRU 7UDWDVHDTXLGDFRUUXSomRSDVVLYDJUDWXLWDRXVHMD
SUHVWH]D DTXHODHPTXHDYDQWDJHPLQGHYLGDpUHSUHVHQWDGDSHOR
SX[DVVDTXLVPRRXDJUDGRDWHUFHLUDSHVVRD&RQILJX
3UHVWH PXLWD DWHQomR SDUD D VXWLO GLIHUHQoD HQWUH RV UDVHTXDQGRRIXQFLRQiULR SX[DVDFR SUDWLFDRXGHL[D
FULPHV GH FRQFXVVmR H GH FRUUXSomR SDVVLYD VH Ki GH SUDWLFDU RX UHWDUGDU D SUiWLFD GH DWR GH RItFLR LQ
H[LJrQFLDKiFRQFXVVmRPDVVHKiVLPSOHVVROLFLWDomR IULQJLQGRVHXGHYHUIXQFLRQDOSDUDDWHQGHUDSHGLGRRX
KDYHUiFRUUXSomRSDVVLYD SUHVVmR LQIOXrQFLD GHRXWUDSHVVRD,PDJLQHR2ILFLDO
GH-XVWLoDTXHDRLQYpVGHSURFHGHUjFLWDomRGHXPUpX
2 FULPH GH FRUUXSomR SDVVLYD WDQWR VH Gi FRP D
D  D QXPDDomRGHGHVSHMRSRUIDOWDGHSDJDPHQWRDWHQGHD
VROLFLWDomR FRPR FRP E E  R UHFHELPHQWR  4XDQGR R XPDPLJRTXHOKHSHGHSDUDVHJXUDURPDQGDGRSRUDO
IXQFLRQiULRSHGHRFRUUHDFRUUXSomRSDVVLYDPDVQmR JXPWHPSRSDUDTXHWDOUpXDUUXPHGLQKHLURSDUDSXUJDU
KDYHUi FRUUXSomR DWLYD DSHQDV TXDQGR R IXQFLRQiULR DPRUD SDJDURDOXJXHODWUDVDGR 
UHFHEH p TXH Ki R RXWUR ODGR GD PRHGD D FRUUXSomR
DWLYD MiTXHDOJXPSDUWLFXODUGHX RIHUHFHX WDOYDQWD 7HUiVHYHQGLGRUHFHEHQGRHPSDJDPHQWRDDPL]DGH
JHP7DLVSHTXHQDVGLIHUHQoDVMiIRUDPREMHWRGHTXHV RXJUDWLGmRGHVVHDPLJReWXGRTXHVWmRGHPRHGD+i
WLRQDPHQWRHPFRQFXUVR 6XPDUpQ  RV TXH VHJXUDP PDQGDGR SRUTXH TXHUHP DJUDGDU D
DOJXPDDXWRULGDGHRXDDOJXPULFDoRLQIOXHQWHHWF VmR
$WHQomR
$WHQomR VHRIXQFLRQiULRS~EOLFRVROLFLWDURXUHFHEHUD SX[DVDFRV YRFDFLRQDGRV TXH SURVWLWXHP R VHUYLoR
YDQWDJHPLQGHYLGDPDVRIL]HUFRPDHVSHFtIL S~EOLFRVHUYLQGRjVXDYRFDomR 
FD LQWHQomR
QWHQomR GH GHL[DU GH ODQoDU RX FREUDU WULEXWR
WULEXWR RX
FRQWULEXLomR
FRQWULEXLomRVRFLDORXFREUiORVSDUFLDOPHQWHHOHQmR
VRFLDO QmR
FRPHWHUi R FULPH SUHYLVWR QHVWH DUW&3 H VLP XP
FULPHFRPRXWUR
RXWURQRPH
RXWUR 3UHYDULFDomR

2DUWLQF,,GD/HLGHQ '(= HVWDEH


OHFHTXHQHVVDKLSyWHVHKDYHUiFULPHIXQFLRQDOFRQWUDD $UW 5HWDUGDU
5HWDUGDURXGHL[DUGHSUDWLFDULQGHYLGDPHQWH
RXGHL[DUGHSUDWLFDULQGHYLGDPHQWH
RUGHPWULEXWiULDH[LJLUVROLFLWDURXUHFHEHUSDUDVLRX DWR
DWR GH
GH RItFLR
RItFLR RX
RX SUDWLFiOR
SUDWLFiOR FRQWUD
FRQWUD GLVSRVLomR
SDUDRXWUHPGLUHWDRXLQGLUHWDPHQWHDLQGDTXHIRUDGD H[SUHVVD
H[SUHVVD GH
GH OHL
OHL SDUD
SDUD VDWLVID]HU
VDWLVID]HU LQWHUHVVH RX
IXQomRRXDQWHVGHLQLFLDUVHXH[HUFtFLRPDVHPUD]mRGHOD VHQWLPHQWRSHVVRDO
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

3HQD
3HQD GHWHQomRGHWUrVPHVHVDXPDQRHPXOWD RXVHIDOWDURVHQWLPHQWRSHVVRDORHUURGRIXQFLRQiULR
VHUiPHUDLQIULQJrQFLDGLVFLSOLQDU DGPLQLVWUDWLYD QmR
6XMHLWR$WLYRRIXQFLRQiULRS~EOLFR
6XMHLWR$WLYR KDYHUiFULPHGHSUHYDULFDomR

6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR +RXYH XPD TXHVWmR QXP FRQFXUVR GD &RPDUFD GH
3LUDVVXQXQJD Q DQXODGDSRUTXHPHQFLRQDYDXPD
2EMHWRGD7XWHOD3HQDOD$GPLQLVWUDomR3~EOLFD
2EMHWRGD7XWHOD3HQDO FRQGXWDHUUDGDGR2ILFLDOGH-XVWLoDPDVQmRPHQFLRQDYD
TXH HOH DJLUD SDUD VDWLVID]HU VHQWLPHQWR RX LQWHUHVVH
$omR)tVLFD SHVVRDO
WUrV D
D UHWDUGDULQGHYLGDPHQWHDWRGHRItFLR E
D E GHL[DU
E
GHSUDWLFDULQGHYLGDPHQWHDWRGHRItFLR
SUDWLFDURDWR $WHQomR
$WHQomR 9LPRVTXHRVHQWLPHQWRSHVVRDO TXDORLQWHUHV
FRPWUDQVJUHVVmRGHGLVSRVLomRH[SUHVVDGHOHL VHSHVVRDO pHVVHQFLDOSDUDDFDUDFWHUL]DomRGR
FULPHGHSUHYDULFDomR9LPRVDLQGDTXHpLQGLIHUHQWHD
(OHPHQWR6XEMHWLYR,QMXVWR QDWXUH]D QREUH RX RGLRVD  GHVVH VHQWLPHQWR  +i
RGROR1mR
1mRKiSXQLomRDWtWXORGHFXOSD
1mR HQWUHWDQWR XP WLSR GH VHQWLPHQWR TXH D OHL DERPLQD
FRQVLGHUDRWmRRGLRVRTXHHVWDEHOHFHTXHRFULPHQHP
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO VHUi GH SUHYDULFDomR PDV XP RXWUR
RXWUR FULPH
FULPH FRP SHQD
PXLWRPDLRU
eFULPHGHPDVLDGDPHQWHFRPHWLGRQRIXQFLRQDOLVPR
S~EOLFR 9HULILFDVH TXDQGR R IXQFLRQiULR S~EOLFR SRU 2DUWLQF,D9,GD/HLQGH287
TXDOTXHUVHQWLPHQWRSHVVRDO LQYHMDFL~PHVyGLRDPRU /HL GH 'LUHLWRV
'LUHLWRV GD
GD 3HVVRD
3HVVRD 3RUWDGRUD
3RUWDGRUD GH 'HILFLrQFLD 
'HILFLrQFLD
Gy HWF  RX SDUD VDWLVID]HU XP VHX LQWHUHVVH SHVVRDO HVWDEHOHFH
SURPRomR UHFHELPHQWR GH FRPLVVmR OHJDO RX YDQWDJHP
IXQFLRQDORXQDFDUUHLUDRXSURWHomRGHXPVHXGLUHLWRQD $UW
$UW &RQVWLWXLFULPHSXQtYHOFRPUHFOXVmRGH XP D
YLGD SDUWLFXODU RX GH XP VHX IDPLOLDU RX DPLJR HWF  TXDWUR DQRVHPXOWD
SUDWLFDDOJXPDWRFRQWUDULDPHQWHDXPDH[SUHVVDGLVSRVL
omRGDOHLRXUHWDUGDRXGHL[DGHSUDWLFDULQGHYLGDPHQ , UHFXVDU VXVSHQGHUSURFUDVWLQDUFDQFHODURX
WH XP DWR GH VHX RItFLR 3DUD D FDUDFWHUL]DomR GHVVH ID]HU FHVVDU VHP MXVWD FDXVD  D LQVFULomR GH
FULPHHQWUHWDQWRGHYHILFDUSURYDGRTXHRIXQFLRQiULR DOXQRHPHVWDEHOHFLPHQWRGHHQVLQRGHTXDOTXHU
S~EOLFRDJLXFRPDYRQWDGH GROR GHVDWLVID]HULQWHUHVVH FXUVRRXJUDXS~EOLFRRXSULYDGRSRUPRWLYRV
RXVHQWLPHQWRSHVVRDO GHULYDGRVGDGHILFLrQFLDTXHSRUWD

,QWHUHVVH
,QWHUHVVHpDUHODomRSVLFROyJLFDFRPTXHXPDSHVVRD
,QWHUHVVH  ,, REVWDU VHP MXVWD FDXVD R DFHVVRGHDOJXpPD
SUHWHQGH RFRUUD XP DWR RX XP IDWR RX FRP TXH VH TXDOTXHUFDUJRS~EOLFRSRUPRWLYRVGHULYDGRV
YLQFXODHODDXPREMHWRRXREMHWLYR$VVLPSRUH[HPSOR GHVXDGHILFLrQFLD
R 2ILFLDO GH -XVWLoD SHQKRUD LQVXILFLHQWH GH EHQV GR
([HFXWDGRGHL[DQGRGHSHQKRUDU XPEHPTXDOTXHU H ,,, QHJDUVHPMXVWDFDXVDDDOJXpPSRUPRWLYRV
QHFHVViULR SDUD D VXILFLrQFLD GD SHQKRUD  SRUTXH Mi GHULYDGRVGHVXDGHILFLrQFLDHPSUHJRRXWUDED
HVWDYDFRPSUDQGRSDUDVL RXSDUDVXDHVSRVD WDOEHP OKR
22ILFLDOGH-XVWLoDSUHYDULFRXSRLVGHL[RXGHSUDWLFDUR
DWRGHVHXRItFLR SHQKRUDURVEHQVVXILFLHQWHVDRSDJD  ,9 UHFXVDU UHWDUGDU RX  GLILFXOWDULQWHUQDomRRX
PHQWRGRSULQFLSDOFXVWDVKRQRUiULRVHWF SDUDDWHQGHU GHL[DUGHSUHVWDUDVVLVWrQFLDPpGLFRKRVSLWDODUH
D VHX LQWHUHVVH SHVVRDO GH DGTXLULU DTXHOH EHP TXH DPEXODWRULDOTXDQGRSRVVtYHODSHVVRDSRUWDGR
GHL[RXGHLQFOXLUQDSHQKRUD  UDGHGHILFLrQFLD

6HQWLPHQWR
6HQWLPHQWRpVLQ{QLPRGHHPRomRRXSDL[mReR
6HQWLPHQWR  9 GHL[DUGHFXPSULUUHWDUGDURXIUXVWUDUVHPMXVWR
DPRU R yGLR D SLHGDGH R SDUWLGDULVPR D YLQJDQoD D PRWLYRDH[HFXomRGHRUGHPMXGLFLDOH[SHGLGDQD
VXEVHUYLrQFLD SX[DVVDTXLVPR HWF(SRXFRLPSRUWDVH DomRFLYLODTXHDOXGHHVWD/HL
RVHQWLPHQWRpQREUH VROLGDULHGDGHKXPDQDDOWUXtVPR
SLHGDGHPDJQDQLPLVPRHWF RXQmR+DYHUiSUHYDULFD  9, UHFXVDU UHWDUGDU RX RPLWLUGDGRVWpFQLFRV
omRSRUH[HPSORVHR2ILFLDOGH-XVWLoDGHL[DUGHSUR LQGLVSHQViYHLVjSURSRVLWXUDGDDomRFLYLOREMHWR
FHGHUjFLWDomRGHXPUpXHPDomRGHGHVSHMRSRUIDOWDGH GHVWD /HL TXDQGR UHTXLVLWDGRV SHOR 0LQLVWpULR
SDJDPHQWRSRUTXHVHDSLHGRXFRPDPLVpULDRQ~PHUR 3~EOLFR
GHILOKRVRGHVHPSUHJRHWFGRPHVPR
&RQILUDTXHDVFRQGXWDVSUHYLVWDVQD/HLGH'LUHLWRVGD
0DV p LPSRUWDQWH QmR HVTXHFHU QmR EDVWD TXH R 3HVVRD3RUWDGRUDGH'HILFLrQFLD VmRWRGDVGHLGrQWLFDVj
IXQFLRQiULRWHQKDDJLGRHUUDGR SUDWLFDQGRRXGHL[DQGR GHSUHYDULFDomRPDVQmRQmRFRQVWLWXHPFULPHGHSUHYDUL
QmR
GHSUDWLFDURXUHWDUGDQGRDWRGHVHXRItFLRLQIULQJLQGR FDomRSRUTXHKiXPDSUHYLVmROHJDOHVSHFtILFD FRQILJX
VHXGHYHUIXQFLRQDO eLPSUHVFLQGtYHOTXHHOHDMDHUUDGR UDQGRXP
XP
XP RXWUR
RXWUR FULPH TXDQGRRVHQWLPHQWRSHVVRDOp
FULPH
HWHQKDDHVSHFtILFDLQWHQomRGHVDWLVID]HURXXPLQWHUHVVH RGHGLVFULPLQDomRFRQWUDDSHVVRDGHILFLHQWH
RXXPVHQWLPHQWRSHVVRDO6HIDOWDURLQWHUHVVHSHVVRDO
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
$UW$ 'HL[DU
'HL[DUR'LUHWRU
'LUHWRUGH
GH3HQLWHQFLiULD
3HQLWHQFLiULDHRX
HRXDJHQWH $omR)tVLFD
S~EOLFR
S~EOLFR GH
GH FXPSULU
FXPSULU VHX GHYHU GH YHGDU DR GXDV D 
D GHL[DU GH UHVSRQVDELOL]DU VXERUGLQDGR TXH
SUHVR
SUHVRRDFHVVR
DFHVVRDDSDUHOKR
DSDUHOKRWHOHI{QLFR
WHOHI{QLFRGH
GHUiGLR FRPHWHXLQIUDomRQRH[HUFtFLRGRFDUJR E QmROHYDUR
E
RX
RX VLPLODUTXHSHUPLWDDFRPXQLFDomRFRP
VLPLODUTXHSHUPLWDDFRPXQLFDomRFRP IDWRDRFRQKHFLPHQWRGDDXWRULGDGHFRPSHWHQWHTXDQGR
RXWURVSUHVRVRXFRPRDPELHQWHH[WHUQR OKHIDOWHFRPSHWrQFLD

3HQD
3HQD GHWHQomRGH WUrV PHVHVD XP DQR (OHPHQWR6XEMHWLYR,QMXVWR
RGROR1mR
1mRpFULPHDFRQGXWDFXOSRVD
1mR
2EVDUWLJRDFUHVFHQWDGRSHOD/HLQ

$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
'HVFUHYHVH DTXL XP WLSR HVSHFLDO GH SUHYDULFDomR
YLVDQGRDFULPLQDOL]DUHVSHFLILFDPHQWHDQHJOLJrQFLDRX
3URFXUDDOHLSUHYHQLUQHVWHGHOLWRRDFXPSOLFLDPHQWR
R DFXPSOLFLDPHQWR GR 'LUHWRU GH 3HQLWHQFLiULD RX GRV
GH FKHIHV FRP IXQFLRQiULRV S~EOLFRV RX R FKDPDGR
$JHQWHV3HQLWHQFLiULRVFRPRVSUHVRV
DSDGULQKDPHQWR (YLGHQWHPHQWH QD DGPLQLVWUDomR
S~EOLFDQmRKiXPGRQRGRQHJyFLRXPSDWUmRTXH
&XULRVRpTXHDSHQDGRWLSRHVSHFLDOpDPHVPtVVLPD
ILTXH DWHQWR DRV SUHMXt]RV PDWHULDLV RX PRUDLV TXH RV
SUHYLVWDSDUDRWLSRJHQpULFRDUHYHODUTXHVHQmRSUHWHQ
HPSUHJDGRVSUDWLTXHPWRGRVVmRHPSUHJDGRVGRSRYR
GHXDJUDYDUHVVDFRQGXWDDSHQDVDFODUDQGRDFULPLQR
VLGDGH GD FRQGXWD TXH HP YHUGDGH Mi VH LQVHULD QR
eQDWXUDOSRUWDQWRTXHRVIXQFLRQiULRVS~EOLFRVQmRVH
JrQHUR
LQVXUMDPQHPVHUHYROWHPQHPHQWUHJXHP GHQXQFLHP
GHODWHP XPFROHJDVHVRXEHUHPTXHHVWHYHPSUDWLFDQ
5HJLVWUHVH DLQGD TXH R QRYR WLSR SHQDO HPHUJH GD
GRLQIUDo}HVSUHMXGLFLDLVDRVLQWHUHVVHVS~EOLFRVGHUHJUD
FULVHGRVLVWHPDSHQLWHQFLiULRHVHXGRPtQLRSHODVRUJDQL
WRGRVVHRPLWHPSRUFROHJXLVPRQmRVHLPSRUWDQGRFRP
]Do}HVFULPLQRVDVFRPR3&&&RPDQGRVHWFHVyIRL
R SUHMXt]R S~EOLFR FRQVHTHQWH GD DomR GDQRVD GR
FRQVWUXtGRFRPRUHVSRVWDSROtWLFDjSUHVVmRVRFLDOFRQWUD
IXQFLRQiULR
WDOGHVJRYHUQR
3DUD]HODUFRQWUDWDLVFRQGXWDVOHVLYDVDRVLQWHUHVVHS~
6XMHLWR$WLYRGRFULPHpR'LUHWRUGH3HQLWHQFLiULDHRX
EOLFRVGHWHUPLQDDHVWUXWXUDDGPLQLVWUDWLYDTXHRV&KHIHV
&KHIHV
$JHQWH3~EOLFRHDGHPDLVDSHQDVDTXHOHTXHWHQKDR
SXQDP RV IXQFLRQiULRV LQIUDWRUHV RX VH QmR WLYHUHP
GHYHUGHYHGDURDFHVVRGRSUHVRDDSDUHOKRGHFRPXQLFD
FRPSHWrQFLDSDUDDSOLFDUDSXQLomRGHYHPWDLV &KHIHV
omRWUDWDVHSRLVGHFULPHSUySULR
FRPXQLFDUj$XWRULGDGHFRPSHWHQWHSDUDTXHHVWDWRPH
DVSURYLGrQFLDVFDEtYHLV
2XWURVVLP R SUHVR EHQHILFLiULR GD FRQGXWD QmR VHUi
SDUWtFLSHGRGHOLWROLPLWDQGRVHVXDFRQGXWDDVHFDUDFWH
2FRUUHHQWUHWDQWRTXHpPXLWRFRPXPTXH&KHIHV
&KHIHVQmR
&KHIHV
UL]DUFRPRIDOWDJUDYHGRFRQGHQDGRjSHQDSULYDWLYDGH
HQWUHJXHPVHXVSHL[LQKRVVHXVSURWHJLGRVRXPHVPR
OLEHUGDGH FDVR HOH WHQKD HP VXD SRVVH XWLOL]DU RX
IXQFLRQiULRV GH TXH WHQKDP Gy RX FRPSDL[mR H SRU
IRUQHFHU DSDUHOKR WHOHI{QLFR GH UiGLR RX VLPLODU TXH ERQGDGH LQGXOJrQFLD QHPOKHVDSOLFDPDSXQLomRQHP
SHUPLWDDFRPXQLFDomRFRPRXWURVSUHVRVRXFRPRDPELHQ FRPXQLFDPRIDWRDRVXSHULRUFRPSHWHQWH
WHH[WHUQR DUW/(3/HLQ 
1mRSHUPLWHSRUWDQWRDOHLSHQDOTXHR&KHIH
&KHIHWHQKD
&KHIH
FRPSDL[mRHVHMDERQ]LQKR LQGXOJHQWH FRPRIXQFLRQi
&RQGHVFHQGrQFLD&ULPLQRVD ULRTXHFRPHWHXLQIUDomRQRH[HUFtFLRGRFDUJR6HR& &KH
IHVIRULQGXOJHQWHHQmRHQWUHJDU GHQXQFLDU RIDWRj
IHV
DXWRULGDGH FRPSHWHQWH WDPEpP HOH &KHIH
&KHIH SUDWLFDUi R
FULPHGHFRQGHVFHQGrQFLDFULPLQRVD>R&KHIH &KHIHVyWHPD
&KHIH
$UW 'HL[DU
'HL[DURIXQFLRQiULR
IXQFLRQiULRS~EOLFR
S~EOLFRSRULQGXOJrQFLD
REULJDomRGHFRPXQLFDURIDWRjDXWRULGDGHFRPSHWHQWH
GH
GH UHVSRQVDELO
UHVSRQVDELOL]DU
L]DU VXERUGLQDGR
VXERUGLQDGR TXH
TXH FRPHWHX
TXDQGRQmRIRUHOHR&KHIH
&KHIHDSHVVRD DXWRULGDGH FRP
&KHIH
LQIUDomRQR
LQIUDomRQRH[HUFtFLR
H[HUFtFLRGR
GRFDUJR
FDUJRRXTXDQGROKH
SHWHQWHSDUDDSOLFDUDSHQD@
IDOWDU
IDOWDUFRPSHWrQFLD
FRPSHWrQFLDQmR
QmROHYDU
OHYDURIDWR
IDWRDR
DRFRQKH

FLPHQWRGDDXWRULGDGHFRPSHWHQWH
2EVHUYHVHTXHHVWHFULPHVyRFRUUHUiVHKRXYHUXPD

LQIUDomR FULPH RX IDOWD DGPLQLVWUDWLYD  PDV TXH GHYH
3HQD
3HQD GHWHQomR GH TXLQ]H GLDV D XPPrV
HVWDU UHODFLRQDGDV FRP D DGPLQLVWUDomR S~EOLFD LVWR p
RXPXOWD
OLJDGD DR H[HUFtFLR GR FDUJR $VVLP VH R IXQFLRQiULR
6XMHLWR$WLYR
S~EOLFRSUDWLFRXXPFULPHTXDOTXHU DGXOWpULREULJDQD
R IXQFLRQiULR KLHUDUTXLFDPHQWH VXSHULRU DR VHUYLGRU
UXDVHGXomRDERUWRIXUWRHWF TXHQDGDWHQKDFRPR
LQIUDWRU
H[HUFtFLRGHVXDIXQomRS~EOLFDVHX&KHIH
&KHIHQDGDWHUiQHP
&KHIH
DSXQLUQHPDFRPXQLFDU
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
$WHQomR
$WHQomR HVWHFULPHpPXLWRSDUHFLGRFRPRGHSUHYDULFD
2EMHWRGD7XWHOD3HQDO
omR1DYHUGDGHRFULPHGHFRQGHVFHQGrQFLD
DRUJDQL]DomRGLVFLSOLQDUGD$GPLQLVWUDomR3~EOLFD
FULPLQRVD p DSHQDV XPD IRUPD HVSHFLDO GR FULPH GH
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

SUHYDULFDomR  SRUTXH WDPEpP DTXL Ki XPD RPLVVmR HVWDEHOHFH TXH QHVVD KLSyWHVH KDYHUi FULPH IXQFLRQDO
GHL[DUGHSUDWLFDU FRPRREMHWLYRGHDWHQGHUDRVHQ FRQWUDDRUGHPWULEXWiULDSDWURFLQDUGLUHWDRXLQGLUHWD
WLPHQWRSHVVRDO LQGXOJrQFLDSLHGDGHFRQGHVFHQGrQFLD  PHQWHLQWHUHVVHSULYDGRSHUDQWHD$GPLQLVWUDomR)D]HQGi
ULDYDOHQGRVHGDTXDOLGDGHGHIXQFLRQiULRS~EOLFR(D
3RULVVRHPPXLWRVFRQFXUVRVMiKRXYHTXHVWmRH[SOR SHQDVHUiEHPPDLVULJRURVDGHDDQRVGHUHFOXVmR
UDQGR HVVD GHOLFDGD GLIHUHQoD  H FDQGLGDWRV DIRLWRV PDLVPXOWD
FRQIXQGLQGRRVGRLVFULPHVVHDTXHVWmRPHQFLRQDUTXH
R&KHIH
&KHIHGHL[RXGHUHVSRQVDELOL]DUXPIXQFLRQiULRLQIUDWRU
&KHIH $VVLPVHXP2ILFLDOGH-XVWLoDUHSUHVHQWDQGRXPD
SRULQGXOJrQFLD SRUGyFRPSDL[mR RFULPHVHUiRGH SHVVRD TXH WHP XP GpELWR WULEXWiULR  DSUHVHQWDVH j
FRQGHVFHQGrQFLDFULPLQRVD0DVVHR&KHIH
&KHIHQmRUHVSRQVD
&KHIH UHSDUWLomR ILVFDO SDUD ID]HU XP DFHUWR RX SDUFHODU R
ELOL]RXRIDOWRVRSRUTXHHVWHVHULDVXVSHQVRHVHQGRVHX GpELWRGDTXHOHFRQWULEXLQWHGHYHGRUWHQWDQGRVHSUHYDOH
LQTXLOLQRQmROKHSDJDULDRDOXJXHOHQWmRWHUiDJLGR FHUGRIDWRGHTXHIRLHOHTXHPFXPSULXRPDQGDGRGH
SRULQWHUHVVHSHVVRDOHWDOFRQGXWDQmRpFRQGHVFHQ FLWDomRQDUHVSHFWLYDH[HFXomRILVFDOHVWDUiFRPHWHQGR
GrQFLDFULPLQRVDHVLPDPDLVSXUDSUHYDULFDomR RFULPHIXQFLRQDOFRQWUDDRUGHPWULEXWiULDHQmRRFULPH
GHDGYRFDFLDDGPLQLVWUDWLYD
,PSRUWDQWHDGLIHUHQoDDWpSRUTXHDSHQDGRFULPHGH
SUHYDULFDomR p PDLV JUDYH GHWHQomR GH  PHVHV D XP
DQRRXPXOWD TXHDSUHYLVWDSDUDRFULPHGHFRQGHVFHQ ~QLFRDUW 6HRLQWHUHVVHpLOHJtWLPR
GrQFLD FULPLQRVD GHWHQomR GH  GLDV D XP PrV RX
PXOWD  3HQD
3HQD GHWHQomRGHWUrVPHVHVDXPDQRDOpPGDPXOWD

2 LQWHUHVVH GHIHQGLGR DGYRJDGR  SHOR IXQFLRQiULR


$GYRFDFLD$GPLQLVWUDWLYD S~EOLFRVHQ QmRIRUOHJtWLPR
mR OHJtWLPRDJUDYDUiDSHQDDXPHQWDQ
OHJtWLPR
GRDSDUDPHVHVDXPDQRDOpPGDPXOWD6HGHIHQGHU
LQWHUHVVHGHWHUFHLURVGHQWURGD$GPLQLVWUDomRMipHUUDGR
$UW 3DWURFLQDU
3DWURFLQDUGLUHWD
GLUHWDRXLQGLUHWDPHQWHLQWHUHVVH
RXLQGLUHWDPHQWHLQWHUHVVH VHUi RGLRVR VH WDO LQWHUHVVH DLQGD IRU FRQWUiULR j OHL
SULYDGR
SULYDGR SHUDQWH D DGPLQLVWUDomR S~EOLFD LOtFLWR 
YDOHQGRVHGDTXDOLGDGHGHIXQFLRQiULR

3HQDGHWHQomRGHXPDWUrVPHVHVRXPXOWD
3HQD 9LROrQFLD$UELWUiULD

6XMHLWR$WLYR
TXDOTXHUIXQFLRQiULRS~EOLFRSRVVtYHODSDUWLFLSDomRGH $UW 3UDWLFDU
3UDWLFDUYLROrQFLD
YLROrQFLDQR
QRH[HUFtFLR
H[HUFtFLRGH
GHIXQomR
IXQomRRXD
SDUWLFXODUHV SUHWH[WRGHH[HUFrOD

6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR 3HQD
3HQD GHWHQomRGHVHLVPHVHVDWUrVDQRVDOpP
GDSHQDFRUUHVSRQGHQWHjYLROrQFLD
2EMHWRGD7XWHOD3HQDOD$GPLQLVWUDomR3~EOLFD
2EMHWRGD7XWHOD3HQDO 6XMHLWR$WLYR
RIXQFLRQiULRS~EOLFRSRVVtYHODSDUWLFLSDomRGHSDUWLFX
$omR)tVLFD ODU
pSDWURFLQDUDGYRJDUUHLYLQGLFDULQWHUHVVHDOKHLRSULYDGR
LQWHUHVVH MXQWR j $GPLQLVWUDomR 3~EOLFD LQGHSHQGHQWH 6XMHLWR3DVVLYR
PHQWHGHVHUMXVWRRXOtFLWR R(VWDGRVHFXQGDULDPHQWHTXHPVRIUHDYLROrQFLD

(OHPHQWR6XEMHWLYR,QMXVWR 2EMHWRGD7XWHOD3HQDO
RGROR1mR
1mRKiIRUPDFXOSRVD
1mR R(VWDGRHDSHVVRDTXHVRIUHDYLROrQFLD

$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO $omR)tVLFD
SUDWLFDU D YLROrQFLD ItVLFD H[FOXtGD D YLROrQFLD PRUDO
0XLWRV IXQFLRQiULRV S~EOLFRV DSURYHLWDPVH GH VXD FRQWUDDSHVVRDYLVDGD
FRQGLomRGHIXQFLRQiULRSDUDHVWDQGRGHQWURGDDGPLQLV
WUDomRS~EOLFDGHIHQGHUHPLQWHUHVVHVGHWHUFHLUDVSHVVR (OHPHQWR6XEMHWLYR,QMXVWR
DV $TXHOH TXH R IL]HU FRPHWHUi R FULPH GH DGYRFDFLD RGROR1mR
1mRKiPRGDOLGDGHFXOSRVD
1mR
DGPLQLVWUDWLYD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO

$WHQomR
$WHQomR VH R IXQFLRQiULR S~EOLFR DWXDUGHQWUR
GD DGPLQLVWUDomR S~EOLFD ID]HQGiULD RX $ XUEDQLGDGH D OKDQH]D D JHQWLOH]D D FRUWHVLD R
VHMDQRVHWRUHPTXHRVFRQWULEXLQWHVGHGX]HPUHTXHUL UHVSHLWRDRSUy[LPRGHYHPVHUDW{QLFDGRWUDWDPHQWR
PHQWRVHSUHWHQV}HVILVFDLVHOHQmRFRPHWHUiRFULPH GLVSHQVDGRSHORIXQFLRQiULRS~EOLFRDWRGRVRVFLGDGmRV
SUHYLVWRQHVWHDUWHVLPXPRXWUR RXWURFULPHFRPRXWUR
RXWUR TXHVHUHODFLRQDUHPFRPDDGPLQLVWUDomRS~EOLFD
QRPH 2 DUW LQF,,, GD /HL Q  '(=
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
2IXQFLRQiULRS~EOLFRTXHVHMDQRH[HUFtFLRGHVXDV  6H
6HRIDWR
IDWRRFRUUH
RFRUUHHP
HPOXJDU
OXJDUFRPSUHHQGLGRQDIDL[D
IXQo}HVVHMDDSUHWH[WRGHH[HUFrODSUDWLFDUYLROrQFLD GHIURQWHLUD
ItVLFDFRQWUDTXDOTXHUDGPLQLVWUDGRFRPHWHUiRFULPHGH
YLROrQFLD DUELWUiULD H UHVSRQGHUi WDPEpP SHOD SHQD 3HQD
3HQD GHWHQomRGHXPDWUrVDQRVHPXOWD
UHODWLYDjYLROrQFLDItVLFD H[HPSOROHV}HVFRUSRUDLVDUW
&3  (VWH FULPH p PXLWR FRPHWLGR SRU ILVFDLV GH 6XMHLWR$WLYR
3UHIHLWXUDSROLFLDLVHWF RIXQFLRQiULRS~EOLFRHPH[HUFtFLRGHFDUJRS~EOLFR

&RUUHQWHPLQRULWiULD %(172'()$5,$HRXWURV HQWHQGH 6XMHLWR3DVVLYRR(VWDGR


6XMHLWR3DVVLYR
TXH D YLROrQFLD QmR SUHFLVDULD VHU ItVLFD EDVWDQGR D
YLROrQFLDPRUDOFRPRDKXPLOKDomRDLQM~ULDHWF 2EMHWRGD7XWHOD3HQDO
DFRQWLQXLGDGHHUHJXODULGDGHGRVVHUYLoRVGD$GPLQLVWUD
0DV D LQWHUSUHWDomR SUHGRPLQDQWH QD 'RXWULQD omR3~EOLFD
EDVHDQGRVH HP 1(/621 +81*5,$  XP GRV SDLV GR
&yGLJR 3HQDO  HQWHQGH TXH D H[SUHVVmR YLROrQFLD $omR)tVLFD
UHIHUHVHH[FOXVLYDPHQWHjYLROrQFLDItVLFDSRLVTXDQGR pDEDQGRQDUGHL[DUGHH[HUFHUGHH[HFXWDUDVIXQo}HV
TXLVVHUHIHULUjYLVFRPSXOVLYDDOHLSHQDOPHQFLRQDD GRFDUJRS~EOLFR
FRPRJUDYHDPHDoD
(OHPHQWR6XEMHWLYR,QMXVWR
(VVHHQWHQGLPHQWRWDPEpPGRPLQDDMXULVSUXGrQFLD
RGROR,QH[LVWHWLSLFLGDGHFXOSRVD
YDOHQGR FRPR H[HPSOR HVWH DFyUGmR GR 7ULEXQDO GH
-XVWLoD GH 6mR 3DXOR 9LROrQFLD VLPSOHVPHQWH PRUDO
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
FRQVWLWXtGD SHOD LQWLPLGDomR SRU DPHDoD QmR EDVWD DR
UHFRQKHFLPHQWRGRGHOLWRGRDUWGR&3VHPSUHMXt]R
(VWH FULPH YLVD D SURWHJHU R IXQFLRQDPHQWR D
GHHYHQWXDOFRQILJXUDomRGHH[HUFtFLRDUELWUiULRRXDEXVR
GHSRGHUeTXHVHPSUHTXHRHVWDWXWREiVLFRPHQFLRQD RUJDQL]DomR H D HVWDELOLGDGH DGPLQLVWUDWLYD FRQWUD D
DYLROrQFLDWRXWFRXUWTXHUUHIHULUVHjYLVFRUSRUDOLVRX GHVtGLDRXUHODSVLDIXQFLRQDO$VVLPRIXQFLRQiULRS~EOLFR
YLV SK\VLFD HPSUHJDGD FRQWUD D SHVVRD SRLV TXDQGR QmR SRGH DEDQGRQDU R FDUJR S~EOLFR TXH H[HUoD 6H R
WDPEpPWUDWDGDYLVFRPSXOVLYDXVDGDH[SUHVVmRJUDYH IL]HU D PHQRV TXH R WHQKD IHLWR HP VLWXDomR TXH D OHL
DPHDoD LQ-XULFULP)UDQFHVFKLQL  SHUPLWD HVWDUi  SUDWLFDQGR R FULPH GH DEDQGRQR GH
IXQomR
$VVLPDGHVSHLWRGDSROrPLFDVREUHRWHPDRFDQGLGD
WRTXHVWLRQDGRHPFRQFXUVRSXEOLFRGHYHUiUHVSRQGHU eQRSHULJRTXHUHSUHVHQWDRDEDQGRQRTXHUHVLGH
SHODLQVXILFLrQFLDGDYLROrQFLDPRUDOSDUDDFDUDFWHUL]DomR RFULPH6HWRGDYLDHVVHSHULJRVHFRQFUHWL]DURXVHMDVH
GRFULPH GRDEDQGRQRUHVXOWDUSUHMXt]RS~EOLFRDSHQDVHUiEHP
PDLRUWDQWRQDFDGHLDTXDQWRQDPXOWD
5HYRJDomR"
3UHYHQWLYDPHQWHDOHLFRPVDEHGRULDFRQVLGHUDQGR
3RUGHUUDGHLURHPERUDDOJXQVSRXFRVFRQVLGHUDVVHP TXHQDVIDL[DVGHIURQWHLUDDDGPLQLVWUDomRS~EOLFDGHYH
R DUW UHYRJDGR SHOD /HL Q  TXH GHILQH R VHU PDLV HIHWLYD PDLV DWHQWD PDLV SUHVHQWH SRUTXH
FULPH GH DEXVR GH DXWRULGDGH  D MXULVSUXGrQFLD VH UHSUHVHQWD D SUySULD JDUDQWLD GD VHJXUDQoD QDFLRQDO
DVVHQWRX SHOR HQWHQGLPHQWR GH TXH QmR
QmR VH RSHURX WDO GHILQHRDEDQGRQRGHIXQomRFULPHDLQGDPDLVJUDYHH
UHYRJDomRDWpSRUTXHRFULPHGHDEXVRGHSRGHUpFULPH SRUFRQVHJXLQWHDXPHQWDHPPXLWRDSHQDGHGHWHQomR
FRQWUDDDGPLQLVWUDomRGDMXVWLoDHQTXDQWRRGHYLROrQFLD HWDPEpPDPXOWD
DUELWUiULD p FULPH SUDWLFDGR SRU IXQFLRQiULR FRQWUD D
$GPLQLVWUDomR3~EOLFDHPJHUDOFRPRRGLVWLQJXLXH $WHQomR
$WHQomR DEDQGRQDU QmR p VLPSOHVPHQWH GHL[DU
MXOJRXR6XSUHPR7ULEXQDO)HGHUDO LQ57-YROS GHLUWUDEDOKDUeQHFHVViULRTXHWDOIDOWDVH
SURORQJXHSRUXPGHWHUPLQDGRWHPSRLQLQWHUUXSWDPHQ
WH 6HJXQGR R DUW  GR (VWDWXWR GRV )XQFLRQiULRV
3~EOLFRV&LYLVGR(VWDGRGH6mR3DXOR /HLQ
$EDQGRQRGH)XQomR VyKDYHUiRDEDQGRQRVHRIXQFLRQiULRLQWHUURPSHUR
H[HUFtFLRSRUPDLVGH WULQWD GLDVFRQVHFXWLYRVHR
DUW  GDTXHOD /HL GLVS}H TXH &RQVLGHUDU VHi
$UW $EDQGRQDU FDUJR S~EOLFR IRUD GRVFDVRV DEDQGRQRGHFDUJRRQmRFRPSDUHFLPHQWRGRIXQFLRQiULR
SHUPLWLGRVHPOHL SRUPDLVGH WULQWD GLDVFRQVHFXWLYRVH[YLGRDUWLJR

3HQD
3HQD GHWHQomR GH TXLQ]HGLDVDXPPrVRX 6LJQLILFD TXH Vy KDYHUi FULPH GH DEDQGRQR VH R
PXOWD IXQFLRQiULRIDOWDUGXUDQWHGLDVRXPDLV6HHOHIDOWDU
GLDV H[DWLQKRV HDSDUHFHUSDUDWUDEDOKDUQRGLDQmR
 6HGRIDWRUHVXOWDSUHMXt]RS~EOLFR KDYHUi WDO FULPH QDWXUDOPHQWH VHUi SXQLGR PDV VXD
LQIULQJrQFLD VHUi DSHQDV GLVFLSOLQDU QmR FRQVWLWXLQGR
3HQD
3HQD GHWHQomRGHWUrVPHVHVDXPDQRHPXOWD
FULPH 
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

(SUHVWHDWHQomR
DWHQomR
DWHQomR DVIDOWDVGHYHPVHUFRQVHFXWL -XVWLoDpUHPRYLGRSDUDRXWUD&RPDUFDHOHQmRSRGHUi
YDVRXVHMDVHHOHIDOWRX FXPSULURVPDQGDGRVTXHOKHKDYLDPVLGRFRQILDGRV
GLDVDSDUHFHXQR HWUDEDOKRX GHSRLVIDOWRXPDLV H TXH HOH DLQGD QmR FXPSULUD  SDUD DWXDOL]DU VHX
GLDVDSDUHFHXQRGLDGHSRLVVXPLXPDLVGLDVH VHUYLoRDQWHVGHLUHPERUD
YROWRXQRGLDHOHWHUiIDOWDGRGLDV PXLWRPDLV
TXHRVGLDV PDVQmRFRPHWHXFULPHGHDEDQGRQR 'DPHVPDIRUPDVHMiIRLPDQGDGRHPERUDHDLQGD
SRUTXHVXDVIDOWDVQmRIRUDPFRQVHFXWLYDV LQLQWHUUXSWDV  WLQKDPDQGDGRVDFXPSULU1mRSRGHUiPDLVFXPSULORV
VHUiSXQLGRDSHQDVGLVFLSOLQDUPHQWH ,GHQWLFDPHQWH VH IRL VXVSHQVR H HVWDYD FRP R VHUYLoR
DWUDVDGRQmRSRGHUiQHPDWXDOL]DUVHXVHUYLoRGXUDQWH
VXDVXVSHQVmRQHPSRGHUiDMXGDUDDOJXPFROHJXLQKD
TXHSUHFLVHGHDMXGD
([HUFtFLR)XQFLRQDO,OHJDOPHQWH
$QWHFLSDGRRX
$QWHFLSDGRRX3URORQJDGR
RX3URORQJDGR )XQFLRQiULR 3~EOLFR Vy DJH VH WHP D SRVVH H R
H[HUFtFLRGHVHXFDUJR

$UW (QWUDU
(QWUDU QR
QR H[HUFtFLR
H[HUFtFLR GH
GH IXQomR
IXQomR S~EOLFDDQWHV
GH
GHVDWLVIHLWDV
VDWLVIHLWDVDV
DVH[LJrQFLDV
H[LJrQFLDVOHJDLV
OHJDLVRX
RXFRQWLQX
DU
DU D H[HUFrOD VHP DXWRUL]DomR GHSRLV GH 9LRODomRGH6LJLOR)XQFLRQDO
VDEHU
VDEHURILFLDOPHQWHTXHIRLH[RQHUDGRUHPRYL
RILFLDOPHQWHTXHIRLH[RQHUDGRUHPRYL
GRVXEVWLWXtGRRXVXVSHQVR
$UW 5HYHODU
5HYHODUIDWR
IDWRGHTXHWHPFLrQFLDHPUD]mRGR
3HQD
3HQD GHWHQomR GH TXLQ]H GLDVDXPPrV FDUJR
FDUJRHTXH GHYDSHUPDQHFHU
TXHGHYD SHUPDQHFHUHP
HPVHJUHGR
VHJUHGRRX
RXPXOWD IDFLOLWDUOKHDUHYHODomR
6XMHLWR$WLYR
RIXQFLRQiULRS~EOLFRHDWpPHVPRRH[RQHUDGR 3HQD
3HQD GHWHQomRGHVHLVPHVHVDGRLVDQRVRX
PXOWDVHRIDWRQmRFRQVWLWXLFULPHPDLV
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR JUDYH

2EMHWRGD7XWHOD3HQDOD$GPLQLVWUDomR3~EOLFD
2EMHWRGD7XWHOD3HQDO  6XMHLWR
6XMHLWR $WLYR
$WLYR R IXQFLRQiULR S~EOLFR H WDPEpP R
IXQFLRQiULR DSRVHQWDGR RX SRVWR HP GLVSRQLELOLGDGH
 $omR
$omR )tVLFD
)tVLFD GXDV D 
D HQWUDU QR H[HUFtFLR GH IXQomR DLQGDYLQFXODGRjDGPLQLVWUDomR 
S~EOLFDDQWHVGHVDWLVIHLWDVDVH[LJrQFLDVOHJDLV E FRQ
E
WLQXDU D H[HUFrOD GHSRLV GH VDEHU RILFLDOPHQWH TXH IRL  6XMHLWR
6XMHLWR 3DVVLYRR(VWDGRHYHQWXDOPHQWHRSDUWLFXODU
3DVVLYR
H[RQHUDGRUHPRYLGRVXEVWLWXtGRRXVXVSHQVR SUHMXGLFDGRFRPDUHYHODomRGRVLJLOR

(OHPHQWR6XEMHWLYR,QMXVWR  2EMHWR
2EMHWR GD
GD 7XWHOD
7XWHOD 3HQDO
3HQDO D UHJXODULGDGH GH IXQFLRQD
RGROR,QH[LVWHIRUPDFXOSRVD PHQWRGDDGPLQLVWUDomRS~EOLFD

$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO $omR)tVLFD
GXDV D 
D UHYHODU RX FRPXQLFDU GDU FRQKHFLPHQWR D
$RFRQWUiULRGRFULPHDQWHULRUTXHSURFXUDHYLWDUR RXWUHPH E
E IDFLOLWDUDUHYHODomRSURSLFLDQGRRDFHVVRDR
E
YD]LR  QD DGPLQLVWUDomR S~EOLFD R GHOLWR SUHYLVWR DTXL VHJUHGR
SURFXUDHYLWDUTXHRIXQFLRQiULRTXHMiWHQKDVLGRH[RQH
UDGR DIDVWDPHQWRQmRSXQLWLYR RXUHPRYLGR WUDQVIHUL (OHPHQWR6XEMHWLYR,QMXVWR
GR VXEVWLWXtGRRXVXVSHQVR FRQWLQXHDH[HUFLWDUVXDV pRGROR1mR
1mRKiSXQLomRDWtWXORGHFXOSD
1mR
IXQo}HVVHQmRHVWLYHUDXWRUL]DGRDID]rOR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
7DPEpP RFRUUH WDO FULPH TXDQGR R IXQFLRQiULR
S~EOLFR FRPHoD D H[HUFLWDU IXQomR S~EOLFD DQWHV GH 2(VWDGRWHPQHFHVVLGDGHVGHPDQWHUVHJUHGRVD
VDWLVID]HU DV H[LJrQFLDV OHJDLV SH[ D SRVVH HYHQWXDLV ILPGHTXHSRVVDHPFHUWRVFDVRVUHDOL]DUFRPHILFiFLD
LQVSHomRPpGLFDFRPSURYDomRGHTXLWDomRFRPRVHUYLoR VXDVWDUHIDVHFXPSULUSURSyVLWRVGHLQWHUHVVHS~EOLFR6H
PLOLWDUFHUWLILFDGRGHERPSURFHGLPHQWRILDQoDHWF  pYHUGDGHTXHGHPRFUDWLFDPHQWHRVDWRVDGPLQLVWUDWLYRV
GHYHPVHUS~EOLFRVQmRpPHQRVYHUGDGHTXHDLQGDTXH
e R IXQFLRQDPHQWR UHJXODU H QRUPDO GD DWLYLGDGH WHPSRUiULDRXWUDQVLWRULDPHQWHFHUWDVSURYLGrQFLDVVmR
DGPLQLVWUDWLYDTXHVHSURFXUDSURWHJHUFRQWUDDLQGpELWD VLJLORVDV
LQWURPLVVmRGRIXQFLRQiULRS~EOLFRTXHDLQGDQmRSRGH
H[HUFHURFDUJRRXTXHMiQmRPDLVRSRGHULD $RIXQFLRQiULRTXHSRUVHXFDUJRGHODVSDUWLFLSHRX
TXHDVFRQKHoDLQFXPEHJXDUGDUVLJLORQmRDVUHYHODQ
( YHMD EHP PHVPR TXH R IXQFLRQiULR WHQKD ERD GR QHP IDFLOLWDQGR TXH VHMDP UHYHODGDV 6H IRIRFDU
LQWHQomR HOH QmR SRGHUi FRQWLQXDU D H[HUFHU D IXQomR FRPHWHUiRFULPHGHYLRODomRGHVLJLORIXQFLRQDO
S~EOLFDVHPDXWRUL]DomR$VVLPSH[VHXP2ILFLDOGH
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
$WHQomR HVSHOKDQGR R GLUHLWR FRQVWLWXFLRQDO JDUDQ  6HQmRKiVHJUHGRGHMXVWLoDQmRKiGHYHUGHVLJLOR
WLGRSHORKDEHDVGDWDIRLHGLWDGDD/ /HLQ
HL 1mR KDYLD HIHWLYDPHQWH VLJLOR D VHU SUHVHUYDGR $OLiV
 
 TXH HVWDEHOHFHX TXH 7RGRV WrP GLUHLWR D FRQTXDQWR KDMD DOJXQV SURFHVVRV FRP tQVLWD H LQHUHQWH
UHFHEHU GRV yUJmRV S~EOLFRV LQIRUPDo}HV GH VHX LQWHUHVVH QHFHVVLGDGHGHVLJLOR>DUW,,GR&yG3URF&LYLO IRUD
SDUWLFXODU RX GH LQWHUHVVH FROHWLYR RX JHUDO FRQWLGDV HP GRSURJUDPD HHVSHFLDOPHQWHVHMDDSOLFiYHODRSURFHVVR
GRFXPHQWRVGHDUTXLYRVTXHVHUmRSUHVWDGDVQRSUD]RGD GH EXVFD H DSUHHQVmR p GH VH REVHUYDU TXH DSHQDV
DSHQDV $
OHLVRESHQDGHUHVSRQVDELOLGDGHUHVVDOYDGDVDTXHODVFXMR MXVWLILFDomR SUpYLD IDUVHi HP VHJUHGR GH MXVWLoD VH IRU
VLJLOR VHMD LPSUHVFLQGtYHO j VHJXUDQoD GD 6RFLHGDGH H GR LQGLVSHQViYHO>DUW&3&LY@
(VWDGREHPFRPRjLQYLRODELOLGDGHGDLQWLPLGDGHGDYLGD
SULYDGDGDKRQUDHGDLPDJHPGDVSHVVRDV>DUW@HHP 1RXWUDVSDODYUDVVyKDYHULDGHYHUGHVLJLORVHR-XL]
VHX DUW SUHYLX TXH )LFD UHVJXDUGDGR R GLUHLWR GH DGHWHUPLQDVVH VHDFRQVLGHUDVVHLQGLVSHQViYHO $OpP
LQGHQL]DomR SHOR GDQR PDWHULDO RX PRUDO GHFRUUHQWH GD GLVVRDMXVWLILFDomRSUHFHGHDRGHIHULPHQWRGRSHGLGR
YLRODomR GR VLJLOR VHP SUHMXt]R GDV Do}HV SHQDO FLYLO H &RPR D TXHVWmR GL]LD TXH IRL PDQWLGR R UpX FRPR
DGPLQLVWUDWLYD GHSRVLWiULRVLJQLILFDTXHMiVHVXSHUDUDDIDVHGDMXVWLIL
FDomRHSRUWDQWRGRVLJLOR'HILQLWLYDPHQWHDVVLPQmR
$VVLPWRGRVRVGRFXPHQWRVDUTXLYDGRVQDVUHSDUWL
KDYLDFRPRIDODUVHHPFULPHGHYLRODomRGHVLJLORIXQFLR
o}HVS~EOLFDVSRGHPVHUFRQVXOWDGRVSRUTXDOTXHUSHVVRD
QDO
GHVGHTXHKDMDFRPSURYDGDPHQWHXPLQWHUHVVHGHVVD
SHVVRDRXXPLQWHUHVVHJHUDO FROHWLYRS~EOLFR 
9LRODomRGH6LJLOR)XQFLRQDO9LD,QIRUPiWLFD
0DVYHMDEHP2VGRFXPHQWRVFXMDGLYXOJDomRSRQKD
HPULVFRDVHJXUDQoDGDVRFLHGDGHHGR(VWDGREHPFRPR
DTXHOHV QHFHVViULRV DR UHVJXDUGR GD LQYLRODELOLGDGH GD
LQWLPLGDGH GD YLGD SULYDGD GD KRQUD H GD LPDJHP GDV $UW 1DV PHVPDV SHQDV GHVWHDUWLJRLQFRUUH
SHVVRDVVmRRULJLQDULDPHQWHVLJLORVRV>DUW/HLQ TXHP
@HRVLJLORVHUiSUHVHUYDGRGXUDQWHDQRVVH
IRUUHODWLYRjVHJXUDQoDGDVRFLHGDGHHGR(VWDGRHVHIRU , SHUPLWH
SHUPLWHRX
RXIDFLOLWD
IDFLOLWDPHGLDQWH
PHGLDQWHDWULEXLomRIRUQHFL
UHIHUHQWHjLQYLRODELOLGDGHGDLQWLPLGDGHGDYLGDSULYDGD PHQWR
PHQWRHHPSUpVWLPR
HPSUpVWLPRGHGHVHQKD
VHQKDRX
RXTXDOTXHU
TXDOTXHURXWUD
GDKRQUDHGDLPDJHPGDVSHVVRDVGHYHQGRVHUSUHVHUYD IRUPD R DFHVVR GH SHVVRDV QmR DXWRUL]DGDV D
GRGXUDQWHDWpDQRVDFRQWDUGDGDWDGHVXDSURGX VLVWHPDV
VLVWHPDV GHLQIRUPDo}HVRXEDQFRGHGDGRVGD
GHLQIRUPDo}HVRXEDQFRGHGDGRVGD
omR $GPLQLVWUDomR3~EOLFD
1R SUySULR &yGLJR GH 3URFHVVR &LYLO Ki SUHYLVmR
H[SUHVVDGHDOJXQVSURFHVVRVHPTXHVHGHYHUiREVHUYDU ,, VHXWLOL]DLQGHYLGDPHQWHGRDFHVVRUHVWULWR
R VHJUHGR GH -XVWLoD DTXHOHV D
D  HP TXH R H[LJLU R
LQWHUHVVH S~EOLFR EE  TXH GL]HP UHVSHLWR D FDVDPHQWR 7DPEpPHVWHSDUiJUDIRpUHVXOWDGRGDPRGHUQL]DomRGR
ILOLDomR VHSDUDomR GRV F{QMXJHV FRQYHUVmR GHVWD HP &yGLJR3HQDOLQWURGX]LGDSHOD/HLQTXHSUHYLX
GLYyUFLRDOLPHQWRVHJXDUGDGHPHQRUHV DUW,H,,GR D SUiWLFD GH YHOKRV FULPHV DWUDYpV GRV PHFDQLVPRV GD
&yG3URF&LYLO 4XDQWRDRLQWHUHVVHS~EOLFRQDWXUDOPHQ LQIRUPiWLFD
WHTXHPRGHFODUDUiSDUDIXQGDPHQWDUHLPSRURVHJUHGR
GH-XVWLoDVHUiR-XL]GH'LUHLWR $EDVHGHLQIRUPDo}HV GDGRV pKRMHYDOLRVRSDWULP{
QLRSRUTXDQWRRFRQKHFLPHQWRGHLQIRUPDo}HVVLJLORVDV
$VVLPVHXPFXULRVRFKHJDUQXPFDUWyULRHTXLVHU SRGHJHUDUQHJyFLRVYXOWRVRVLPDJLQHSH[TXHPVDLED
YHUXPDDomRGHDOLPHQWRVRXGHLQYHVWLJDomRGHSDWHUQL TXHXPDDYHQLGDDVIDOWDGDFUX]DUiXPDGHWHUPLQDGD]RQD
GDGHRXTXDOTXHURXWUDDomRTXHLPSOLTXHYLRODomRGD UXUDOHPGRLVDQRVFHUWDPHQWHSURFXUDUiRVID]HQGHLURV
LQWLPLGDGH GDV SHVVRDV  R FXULRVR QmR SRGHUi WHU DGTXLULUiWHUUDVSDJDQGRSUHoRVDDOTXHLUHVHIXWXUDPHQ
DFHVVRjTXHOHVDXWRV PHVPRTXHVHLQWLWXOHDGYRJDGR WH RV ORWHDUi YHQGHQGR ORWHV SRU P REWHQGR OXFUR
VDOYRVHMiRpQRPHVPRSURFHVVR  IDEXORVR QLQJXpP LJQRUD RV HVFkQGDORV QDFLRQDLV GD
PD[LGHVYDORUL]DomR GR 5HDO H PD[LYDORUL]DomR GR
2GLUHLWRGHFRQVXOWDURVDXWRVHGHSHGLUFHUWLG}HV
GyODU HRVDVWURQ{PLFRVOXFURVREWLGRVSRUEDQTXHLURVH
GH VHX DWRV p UHVWULWR jV SDUWHV H DV VHXV SURFXUDGRUHV
F~PSOLFHVGHDXWRULGDGHVJRYHUQDPHQWDLV
DUW~QLFRGR&3&L 6HR(VFUHYHQWH RXR2ILFLDO
GH-XVWLoD OKHHQWUHJDURV DXWRVFRPHWHUiRFULPHGR
$SUHVHUYDomRGRVLJLORGHLQIRUPDo}HVpIXQGDPHQWDO
DUW&3
j RUGHP HFRQ{PLFD j PRUDO H j OLFLWXGH  GDV UHODo}HV
4XHVWmR FXULRVD IRL HODERUDGD HP XP FRQFXUVR VRFLDLVHVXDGHYDVVDKRMHSRGHVHUIHLWDSHORVLPSOHV
S~EOLFRHPTXHVHSUHWHQGLDVHVDEHUVHIDOVDRXYHUGD DFHVVR D EDQFR GH GDGRV RQGH WDLV LQIRUPDo}HV VmR
GHLUDDDVVHUWLYD(PEXVFDHDSUHHQVmRGHYHtFXORQmR DUPD]HQDGDV
GHIHULGR H[SUHVVDPHQWH R VHJUHGR GH -XVWLoD DR UHYpV
PDQWLGR RUpXFRPRGHSRVLWiULRQmRFRPHWHYLRODomRGH (VVDDUD]mRSHODTXDOWXWHODRVLVWHPDGHLQIRUPDo}HV
VLJLORIXQFLRQDORHVFULYmRGRIHLWRVHDQWHVGRFXPSULPHQWR RXREDQFRGHGDGRVGD$GPLQLVWUDomR3~EOLFDFRQWUDR
GDOLPLQDUHGDFLWDomRRIHUHFHXRDGYRJDGRGRUpXFRQWHV DFHVVRHVS~ULRGHSHVVRDVQmRDXWRUL]DGDVSXQLQGRR
WDomRPi[LPHVHMiDMXL]DUDFRPLQDWyULDYHUVDQGRVREUHR IXQFLRQiULRTXHRSHUPLWDRXIDFLOLWHGHTXDOTXHUPRGR
PHVPRREMHWRHFRQWUDRDXWRUGDEXVFDHDSUHHQVmR
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

,JXDOPHQWH R IXQFLRQiULR TXH WLYHU FUHGHQFLDPHQWR QDVFRPSUDVRXVXEIDWXUDGRVQDVYHQGDVHFRPLVVRVH


SDUD DFHVVR UHVWULWR DR VLVWHPD GH LQIRUPDo}HV RX DR HQULTXHFHQGRHVSHUWDOK}HV TXHQmRUDURSDJDPFRPLV
EDQFRGHGDGRVVySRGHUiXWLOL]iORFRQVHQWDQHDPHQWH V}HVSDUDIXQFLRQiULRVS~EOLFRVTXHRVDMXGDPRXTXH
FRPRVLQWHUHVVHVGRVHUYLoRS~EOLFRVHXWLOL]DULQGHYLGD FRPHOHVVHDMXVWDP 
PHQWHGHVVHVHXDFHVVRLJXDOPHQWHFRPHWHUiRFULPH
(PWRGDFRQFRUUrQFLDS~EOLFDKiDDSUHVHQWDomRGRV
$UW                                    SUHoRVHFRQGLo}HVGHSDJDPHQWRTXDOLGDGHGRSURGXWR
HWF &DGD FRQFRUUHQWH GHQWUR GH XP SUD]R DSUHVHQWD
 6H
6H GD
GD DomR
DomR RX
RX RPLVVmR
RPLVVmR UHVXOWDGDQRj$GPLQLV
UHVXOWDGDQRj$GPLQLV VXD SURSRVWD TXH p PDQWLGD HP VHJUHGR VH XP QmR
WUDomR3~EOLFDRXDRXWUHP VRXEHU D SURSRVWD GR RXWUR WRGRV VH HPSHQKDUmR HP
DSUHVHQWDUDPHOKRUSURSRVWDSRVVtYHO DWpTXHQXPGLD
3HQD UHFOXVmRGH GRLV D VHLV DQRVHPXOWD SUpGHWHUPLQDGRWRGDVDVSURSRVWDVVmRDEHUWDVHDQD
OLVDGDVJDQKDQGRDFRQFRUUrQFLDDPHOKRUSURSRVWD
'HILQHVHDTXLXPWLSRTXDOLILFDGRVHGDYLRODomRGR
VLJLORYLDLQIRUPiWLFDUHVXOWDUTXDOTXHUWLSRGHGDQR &RQILUDSRUWDQWRTXHRVHJUHGRpIXQGDPHQWDOFRP
SUHMXt]R j$GPLQLVWUDomR3~EOLFDRXDRXWUHP HQWmR HOHVHREWpPRPHOKRUSUHoRVFRQGLo}HVHVHLPSHGHD
RGHOLWRVHUiRXWURHPXLWRPDLVJUDYHFRPRRUHYHODD IUDXGHGHXPFRQFRUUHQWH TXHLULDDSUHVHQWDUXPSUHoR
SHQDFRPLQDGD EHPEDL[LQKR DSUHVHQWDUXPDSURSRVWDVyXPSRXTXLQKR
PHOKRU TXH D GRV GHPDLV R VXILFLHQWH SDUD JDQKDU D
'HIDWRDRLQYpVGDGHWHQomRDSHQDVHUiGHUHFOXVmR FRQFRUUrQFLD
HQmRPDLVGHDSHQDVPHVHVDDQRVPDVGHDDQRV
HDVDQomRSHFXQLiULDQmRPDLVVHUiDOWHUQDWLYD RX H 6HUi FULPLQRVR DUW&3  H SRGHUi SHJDU FDGHLD
VLPFXPXODWLYDFRPRRUHYHODDFRQMXQomRDGLWLYDH GHWHQomR GH  PHVHV D  DQR H PXOWD  R IXQFLRQiULR
S~EOLFRTXHGHYDVVDURVLJLOR DQWLJDPHQWHSXQKDPVHRV
HQYHORSHV VHODGRV QR ELFR GH XPD FKDOHLUD HVWHV VH
GHVFRODYDP OLDPVH DV SURSRVWDV H RV HQYHORSHV HUDP
9LRODomRGH6LJLORGH3URSRVWDGH&RQFRUUrQFLD QRYDPHQWHFRODGRVRF~PSOLFHGRIXQFLRQiULRSRUVXD
YH] DSUHVHQWDYD VXD SURSRVWD Mi VDEHQGR TXDO HUD D
PHQRUSURSRVWDGRFRQFRUUHQWHHDVVLPJDUDQWLDVHGD
$UW 'HYDVVDU
'HYDVVDURVLJLOR
VLJLORGH
GHSURSRVWD
SURSRVWDGH
GHFRQFRUUrQFLD YLWyULD FRP XP SUHoR jV YH]HV DSHQDV XP WRVWmR]LQKR
S~EOLFD
S~EOLFD RX
RX SURSRUFLRQDUDWHUFHLURRHQVHMR
SURSRUFLRQDUDWHUFHLURRHQVHMR PHQRUTXHRGRVRXWURV 
GHGHYDVViOR
$WHQomR
$WHQomR D/HL
/HL
/HL Q
Q 
 HP
HP VHX
VHX DUWSUHYLXD
DUW
3HQD GHWHQomRGHWUrVPHVHVDXPDQRH VHJXLQWHFRQGXWDFULPLQRVD'HYDVVDURVL
PXOWD JLORGHSURSRVWDDSUHVHQWDGDHPSURFHGLPHQWROLFLWDWyULR
RX SURSRUFLRQDO D WHUFHLUR R HQVHMR GH GHYDVViOR 3HQD
3HQD
 6XMHLWR
6XMHLWR $WLYR
$WLYR R IXQFLRQiULR S~EOLFR FXMDV IXQo}HV VH 'HWHQomRGH GRLV D WUrVDQRV HPXOWD
YLQFXODPjVFRQFRUUrQFLDV
&RQILUD WUDWDUVH GD PHVPtVVLPD
PHVPtVVLPD FRQGXWD SUHYLVWD
 6XMHLWR
6XMHLWR 3DVVLYR
3DVVLYR R (VWDGR WDPEpP RV FRQFRUUHQWHV QHVWHDUW&3PDVFRPDSHQDEHPDXPHQWDGD$QWHV
QHVWH DUW&3
HYHQWXDOPHQWHSUHMXGLFDGRV HUDGHGHWHQomRGHWUrVPHVHVDXPDQRHPXOWDHDJRUD
SDVVD D VHU GH GHWHQomR GH  GRLV  D  WUrV  DQRV H
2EMHWRGD7XWHOD3HQDO PXOWD(QILPHVWiUHYRJDGRRDUW&3
(QILPHVWiUHYRJDGRRDUW&3
(QILPHVWiUHYRJDGRRDUW&3
D PRUDOLGDGH OLVXUD H LJXDOGDGH QDV FRQFRUUrQFLDV
S~EOLFDV $WHQomR
$WHQomR DSHQDGHPXOWD
PXOWDQmRVHUiDSUHYLVWDRUGLQD
PXOWD
ULDPHQWHSHOR&yGLJR3HQDO6HJXQGRRDUW
$omR)tVLFD GD /HL
/HL Q
Q $SHQDGHPXOWDFRPLQDGDQRV

GXDVD
D GHYDVVDUFRQKHFHURFRQWH~GRE
D E SURSRUFLRQDU
E DUW D  GHVWD /HL FRQVLVWH QR SDJDPHQWR GH TXDQWLD
RGHYDVVDPHQWRGDUHQVHMRDTXHWHUFHLURGHYDVVH IL[DGDQDVHQWHQoDHFDOFXODGDHPtQGLFHVSHUFHQWXDLVFXMD
EDVH FRUUHVSRQGHUi DR YDORU GD YDQWDJHP HIHWLYDPHQWH
(OHPHQWR6XEMHWLYR,QMXVWR REWLGDRXSRWHQFLDOPHQWHDXIHUtYHOSHORDJHQWH
RGROR,QH[LVWHPRGDOLGDGHFXOSRVD

$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
&RQFHLWRGH)XQFLRQiULR3~EOLFR
$$GPLQLVWUDomR3~EOLFDVySRGHDGTXLULURX DOLHQDU
EHQVID]HQGRRPHOKRUQHJyFLRSRVVtYHOWDQWRQDTXDOL
GDGHFRPRQRSUHoRHFRQGLo}HVGHSDJDPHQWR(VVHp $UW &RQVLGHUDVH IXQFLRQiULR S~EOLFR SDUDRV
RREMHWLYRGDFRQFRUUrQFLDS~EOLFDHYLWDUTXHRGLQKHLUR HIHLWRVSHQDLVTXHPHPERUDWUDQVLWRULDPHQWH
S~EOLFRVHMDHVEDQMDGRMRJDGRIRUDSRUPDXVDGPLQLVWUD RX
RX VHP
VHP UHPXQHUDomR H[HUFH FDUJR
UHPXQHUDomR H[HUFH FDUJR S~EOLFR
GRUHV RX PHVPR SRU IDOFDWUXDV SUHoRV VXSHUIDWXUDGRV HPSUHJRRXIXQomRS~EOLFD
 '
LU3HQDO (VFUHYHQWH7pFQLFR-XGLFLiULR7-6
7- 6mR3DXOR
 (TXLSDUDVH
(TXLSDUDVHDIXQFLRQiULR
IXQFLRQiULRS~EOLFRTXHPH[HU DIXQomRpSHUPDQHQWHRXWUDQVLWyULDVHpUHPXQHUDGD
FH
FH FDUJR
FDUJR HPSUHJR
HPSUHJR RX IXQomR HP HQWLGDGH RX JUDWXLWD 6H D SHVVRD HVWi H[HUFHQGR XPD IXQomR
SDUDHVWDWDO H TXHP WUDEDOKD SDUD HPSUHVD S~EOLFDVHUiFRQVLGHUDGDIXQFLRQiULRS~EOLFRHUHVSRQGH
SUHVWDGRUD
SUHVWDGRUDGH
GHVHUYLoR
VHUYLoRFRQWUDWDGD
FRQWUDWDGDRX
RXFRQYHQLDGD UiSHORVFULPHVTXHFRPHWHUQHVVDTXDOLGDGH
SDUDDH[HFXomR
SDUD H[HFXomRGH
GHDWLYLGDGH
DWLYLGDGHWtSLFD
WtSLFDGD
GD$GPLQLV
WUDomR3~EOLFD
WUDomR3~EOLFD  )LQDOPHQWH UHJLVWUHVH TXH WDO HTXLSDUDomR Vy p
$SDUWHGHVWDFDGD LWiOLFR GHVWHIRLDOWHUDGRSHOD/HLQ GH
YiOLGDSDUDDVXMHLomRDWLYD
DWLYD DTXHOHTXHFRPHWHRFULPH 
DWLYD
 HPYLJRUGHVGH; RXVHMDQmR
QmRWHPYDORUSDUDDVXMHLomRSDVVLYD
QmR SDVVLYD DTXHOHTXH
SDVVLYD
VRIUHRFULPH $VVLPVHXPDSHVVRDRIHQGHUXP*HUHQWH
$ H[WHQVmR GR FRQFHLWR GH IXQFLRQiULR S~EOLFR SDUD
GR %DQFR GR %UDVLO IXQomR GH GLUHomR  QmR FRPHWHUi
HIHLWRVSHQDLVYLVDjPHOKRUSURWHomRSHQDOGD$GPLQLV FULPH GH GHVDFDWR RIHQVD VRIULGD SHOR IXQFLRQiULR S~
WUDomR3~EOLFDMiTXHDWHUFHLUL]DomRHDSDUFHULDVmRKRMH EOLFR QR H[HUFtFLR GD IXQomR RX HP UD]mR GHOD  YHU
IHQ{PHQRV SHORV TXDLV HVWDEHOHFHVH XPD LQYDVmR GH DUW&3 MiTXHWDO*HUHQWHQmRpHTXLSDUDGR SDUD
SDUWLFXODUHV QmR GHWHQWRUHV GH FDUJRV RX IXQo}HV ILQVGHVXMHLomRSDVVLYD DIXQFLRQiULRS~EOLFR0DVHVVH
S~EOLFDV  WDQWR QR DFHUYR GH EHQV PDWHULDLV FRPR QR PHVPR *HUHQWH FRPHWHUi SHFXODWR DUW&3  VH
FRPSOH[R GH LQIRUPDo}HV H UHJLVWURV GD $GPLQLVWUDomR PHWHUDPmRQRGLQKHLURGR%DQFR
3~EOLFD

'HFRQVHJXLQWHWRGRVRVDJHQWHVGDVHPSUHVDVSUHVWD
GRUDV GH VHUYLoR RX GH HQWLGDGHV FRQYHQLDGDV SDUD 8VXUSDomRGH)XQomR
H[HFXomRGHDWLYLGDGHWtSLFDGD$GPLQLVWUDomR3~EOLFD
WRGRVSRGHUmRVHUVXMHLWRVDWLYRVGHFULPHVSUySULRVGRV
IXQFLRQiULRVS~EOLFRV 2IXQFLRQiULRS~EOLFRTXHH[HUFHUIXQomRTXHQmRpGH
VXDFRPSHWrQFLDRXVHMDTXHQmRGL]UHVSHLWRDRVHX
 $SHQD
SHQDVHUi
VHUiDXPHQWDGD
DXPHQWDGDGD
GDWHUoDSDUWHTXDQGR FDUJRHVWDUiFRPHWHQGRRFULPHGHXVXUSDomRGHIXQomR
RV
RV DXWRUHV
DXWRUHV SUHYLVWRV
SUHYLVWRV QHVWH
QHVWH FDStWXOR
FDStWXOR IRUHP
RFXSDQWHVGHFDUJRVHPFRPLVVmRRXGHIXQ $UW 8VXUSDURH[HUFtFLRGHIXQomRS~EOLFD
8VXUSDURH[HUFtFLRGHIXQomRS~EOLFD
omR
omRGH
GHGLUHomR
GLUHomRRX
RXDVVHVVRUDPHQWR
DVVHVVRUDPHQWRGH
GHyUJmR
yUJmRGD
DGPLQLVWUDomRGLUHWD
DGPLQLVWUDomRGLUHWDVRFLHGDGHGHHFRQRPLD 3HQD
3HQD GHWHQomR GH  WUrV  PHVHV D  GRLV  DQRVH
PLVWD
PLVWDHPSUHVD
HPSUHVDS~EOLFD
S~EOLFDRX
RXIXQGDomR
IXQGDomRLQVWLWXtGD PXOWD
SHORSRGHUS~EOLFR
~QLFR 6HGRIDWRRDJHQWHDXIHUHYDQWDJHP
6HGRIDWRRDJHQWHDXIHUHYDQWDJHP
,PSRUWDQWtVVLPRFRQVLGHUDUDTXLRTXDQWRpH[WHQVLYR
RFRQFHLWROHJDOGHIXQFLRQiULRS~EOLFR3DUDR&yGLJR 3HQD
3HQD UHFOXVmRGH GRLV D FLQFR DQRVHPXOWD
3HQDOYHUGDGHLUDPHQWHQmRLPSRUWDTXHDSHVVRDVHMD
HIHWLYDPHQWH XP IXQFLRQiULR S~EOLFR p LQGLVSHQViYHO (QVLQDQRVR3URI)(51$1'2&$3(=TXHRIDWRWtSLFR
VLP TXH H[HUoD XPD IXQomR S~EOLFD  RX VHMD DTXHOD FRQVXEVWDQFLDVHQRYHUERXVXUSDULVWRpWRPDUDSRGHUDU
DWLYLGDGH WtSLFD H SUySULD GR 3RGHU 3~EOLFR PHVPR VH1RFDVRRSDUWLFXODUH[HFXWDLOHJLWLPDPHQWHDWRVGH
TXDQGRH[HUFLGDSRUXPDSHVVRDHVWUDQKDj$GPLQLVWUD RItFLRVHPTXHWHQKDDTXDOLGDGHGHIXQFLRQiULRS~EOLFR
omR3~EOLFD LVWRpVHPTXHWHQKDVLGROHJDOPHQWHLQYHVWLGRQDIXQomR
S~EOLFD1mREDVWDWmRVRPHQWHTXHRSDUWLFXODUVHLQWLWXOH
3RULVVRTXHRV-XUDGRVRHOHLWRU TXHWUDEDOKDQR IXQFLRQiULRS~EOLFRpQHFHVViULRTXHHIHWLYDPHQWHSUDWLTXH
SURFHVVRHOHLWRUDOHPGLDGHHOHLomR RMXL]GHSD]HWF DOJXP DWR IXQFLRQDO $ PHUD DWULEXLomR GD TXDOLGDGH GH
VmRIXQFLRQiULRVS~EOLFRVSDUDHIHLWRVSHQDLV IXQFLRQiULRS~EOLFRFRQILJXUDRGHOLWRGRDUWGD/HLGDV
&RQWUDYHQo}HV3HQDLV7UDWDVHGHFULPHFRPXP4XDOTXHU
2EVHUYHTXHWDPEpPRVIXQFLRQiULRVGDV$XWDUTXLDV XP SRGH SUDWLFiOR 6HJXQGR +XQJULD QDGD LPSHGH
%DQFR&HQWUDO,166HWF VmRFRQVLGHUDGRVIXQFLRQiULRV LQFOXVLYHTXHRIXQFLRQiULRS~EOLFRXVXUSHIXQomRHVWUDQKD
S~EOLFRVSDUDHIHLWRVSHQDLVMiTXHR&yGLJRDWDQWRHTXL jVXDLVWRpH[HUoDIXQomRS~EOLFDDOKHLD5HVVDOYD1RUR
SDUDTXHPH[HUFHFDUJRHPSUHJRRXIXQomRHPHQWLGDGH QKDTXHpSUHFLVRTXHDVIXQo}HVVHGLVWLQJDPHHVWUHPHP
SDUDHVWDWDO LQ&XUVRGH'LUHLWR3HQDOSDUWHHVSHFLDOYROHG(G6DUDLYD
SS

(DOJXPDVSHVVRDVTXHWUDEDOKDPHP6RFLHGDGHVGH
(FRQRPLD 0LVWD %DQFR GR %UDVLO %DQFR GR (VWDGR
3HWUREUiV7HOHVS&((63HWF RXHP(PSUHVDV3~EOLFDV
&RUUHLRV HWF  RX HP )XQGDomR 3~EOLFD &ULPHVFRQWUDD$GPLQLVWUDomR3~EOLFD
7Y&XOWXUD)XQGDomR3H$QFKLHWD WDPEpPSRGHUmR
VHUUHVSRQVDELOL]DGDVFULPLQDOPHQWHFRPRVHIXQFLRQiUL &ULPHVSUDWLFDGRVSRU3DUWLFXODU
&ULPHVSUDWLFDGRVSRU3DUWLFXODU
RVS~EOLFRVIRVVHPDTXHODVSHVVRDVTXHH[HUFHPFDUJRV
HPFRPLVVmRRXGHIXQomRGHGLUHomRRXDVVHVVRUDPHQWR
DSHQDVHVWDVLVWRpRIXQFLRQiULRFRPXPQmR  (VWHVFULPHVFRPREHPVDOLHQWDRWtWXORGRFDStWXOR
SRGHPVHUSUDWLFDGRVSRUSDUWLFXODUSHORHVWUDQKRDR
eLPSRUWDQWHDWHQWDUSDUDRVHJXLQWHSRXFRLPSRUWDVH TXDGURDGPLQLVWUDWLYR
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

2IXQFLRQiULRS~EOLFRHQWUHWDQWRWDPEpPSRGHUiVHU 6XMHLWR3DVVLYRR(VWDGRVHFXQGDULDPHQWHRIXQFLR
 6XMHLWR 3DVVLYR
VXMHLWRDWLYRGHVVHVFULPHV(PWRGRFULPHKiVHPSUHXP QiULR RX D SHVVRD TXH R DX[LOLD QD H[HFXomR GR DWR
D VXMHLWRDWLYRH E
D E XPVXMHLWRSDVVLYR2VXMHLWRDWLYR
E DGPLQLVWUDWLYROHJDO
pDTXHOHTXHFRPHWHRFULPHHRVXMHLWRSDVVLYRpDTXHOH
TXHVRIUHDDomRFULPLQRVDRXVHMDRWLWXODUGREHPRX  2EMHWRGD7XWHOD3HQDODDGPLQLVWUDomRS~EOLFD
2EMHWRGD7XWHOD3HQDO
LQWHUHVVHDTXHDOHLHVWiSURFXUDQGRSURWHJHU1RVFULPHV
SUHYLVWRVQRVDUWLJRVVHJXLQWHVRVXMHLWRDWLYRpTXDOTXHU  $omR
$omR)tVLFDpRSRUVHFRQWUDSRUVH
)tVLFD RIHUHFHUUHVLVWrQFLD
SHVVRD WDQWR SRGHQGR VHU XP SDUWLFXODU FRPR DWp
SRGHQGRVHURSUySULRIXQFLRQiULRS~EOLFR  (OHPHQWR
(OHPHQWR 6XEMHWLYR,QMXVWR
6XEMHWLYR,QMXVWR
,QMXVWR R GROR ,QH[LVWHIRUPD
FXOSRVD
0DVRVXMHLWRSDVVLYRVHUiVHPSUHR(VWDGR
(VWDGR $GPLQLVWUD
(VWDGR
omR3~EOLFDVHMDDIHGHUDORXDHVWDGXDORXDPXQLFLSDO  $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
TXHVHUiVHPSUHDYtWLPDGDDomRFULPLQRVD$VVLPQR
FULPHGHUHVLVWrQFLDHPERUDDHYHQWXDODomRItVLFDGR 2 (VWDGR WHP REULJDo}HV SDUD FRP D VRFLHGDGH H DV
VXMHLWR DWLYR VHMD GLUHFLRQDGD FRQWUD XP IXQFLRQiULR H[HFXWDSRULQWHUPpGLRGRVIXQFLRQiULRVS~EOLFRV&RPR
S~EOLFRpD$GPLQLVWUDomR3~EOLFDTXHpSUHMXGLFDGDSRU HPWRGRDWRDGPLQLVWUDWLYRVHSUHVXPHTXHKDMDOHJDOLGD
QmRSRGHUH[HFXWDUVHXDWR GHHLQWHUHVVHS~EOLFRDQHQKXPSDUWLFXODUpSHUPLWLGR
RSRUVHjH[HFXomRGHDWRDGPLQLVWUDWLYROHJDO VHRDWR
1R FULPH GH GHVREHGLrQFLD D RUGHP OHJDO p GH XP IRULOHJDOQmRKiFULPH 
IXQFLRQiULRPDVHOHDSHQDVDJHSDUDTXHVHFXPSUDXP
LQWHUHVVH S~EOLFR GD $GPLQLVWUDomR 3~EOLFD TXH VHUi D $OpPGDQHFHVVLGDGHTXHRDWRVHMDOHJDOpWDPEpP
SUHMXGLFDGD LQGLVSHQViYHOTXHRIXQFLRQiULRTXHRHVWHMDH[HFXWDQGR
WDPEpPVHMDFRPSHWHQWH LQYHVWLGRGDDXWRUL]DomROHJDO
'D PHVPD IRUPD QR GHVDFDWR D RIHQVD p GLULJLGD SDUDRH[HUFtFLRGDTXHODDWLYLGDGHRXIXQomR 
FRQWUDXPIXQFLRQiULRPDVHOHpDSHQDVSDUWHGHXPWRGR
$GPLQLVWUDomR3~EOLFD TXHpDWLQJLGRGLUHWDPHQWHSHOR 0DVYHMDEHPVHRDWRSUDWLFDGRSHORIXQFLRQiULRQmR
PHQRVFDERSHODKXPLOKDomRVHQGRGHVUHVSHLWDGDeR IRUOHJDO
OHJDOTXHPUHVLVWHDHOHQmRFRPHWHUiFULPH6HSRU
OHJDO
TXHDFRQWHFHHPWRGRVRVGHPDLVFULPHVDTXLSUHYLVWRV H[R2ILFLDOGH-XVWLoDUHFHEHXPFKHTXHGHXPDPLJRH
YDLFREUiORSUHWHQGHQGRSHQKRUDU SHJDU DOJXPEHP
eUHOHYDQWHWDOFRQVLGHUDomRSRUTXHQXPFRQFXUVR GRGHYHGRUHVWHGHYHGRUGHYHUiQmRVyUHVLVWLUFRPRDWp
S~EOLFRSHUJXQWRXVHVREUHDVXMHLomRSDVVLYDGRFULPHGR SRGHUiGDUXPDVSRUUDGDV EHPGDGDV QHVVH2ILFLDOGH
DUWGR&RG3HQDO FULPHGHH[SORUDomRGHSUHVWtJLR  -XVWLoD
WDPEpP p R (VWDGR $GPLQLVWUDomR 3~EOLFD  TXH VH
SUHMXGLFDFRPHVVDDomRFULPLQRVD 'DPHVPDIRUPDQmRKDYHUiFULPHVHRDWRIRUOHJDO
PDV R IXQFLRQiULR QmR WLYHU FRPSHWrQFLD  DWULEXLomR
1HVVHFDVRDOHLTXHUSURWHJHURUHVSHLWRSUHVWtJLRH OHJDO  SDUD SUDWLFiOR $VVLP SRU H[HPSOR TXHP GHYH
FUpGLWRGD$GPLQLVWUDomRGH-XVWLoD ID]HU XP DUUHVWR p R 2ILFLDO GH -XVWLoD 6H DSDUHFHU QR
ORFDO R VHUYHQWH GR )yUXP RX PHVPR XP HVFUHYHQWH
(VVDWDUHIDpSUHVWDGDSHOD$GPLQLVWUDomR3~EOLFDHOD TXDOTXHU HSUHWHQGHUSHJDUTXDOTXHUEHPDSHVVRDSRGH
SRLVpDYtWLPD VXMHLWRSDVVLYR  HDWpGHYHOKHGDUXPDVSRUUDGDVSRUTXHHOHQmRWHP
SRGHUSDUDWDODWR6HOKHGHUWDLVERDVHPHUHFLGDVSRU
UDGDV LPSHGLQGRR GH SURFHGHU DR DUUHVWR WHUi IHLWR
PXLWREHPHQmRFRPHWHUiFULPHGHUHVLVWrQFLD (VVD
5HVLVWrQFLD UHVLVWrQFLDVyVHUiFULPLQRVDVHRSDUWLFXODUVHHPSHQKDU
FRPYLROrQFLDRXJUDYHDPHDoD,PDJLQHVHTXHRSDUWLFX
ODU SUHVHQFLDQGR XP 2ILFLDO GH -XVWLoD GHVSHMDU XPD
$UW 2SRUVH j H[HFXomR GH DWR OHJDOPHGLDQWH IDPtOLD PLVHUiYHO DSHQDV RUGHQH QmR IDoD LVVR RX
YLROrQFLDRXDPHDoDDIXQFLRQiULRFRPSHWHQWH VXSOLTXHQmRIDoDLVVRSRUIDYRU2EMHWLYDPHQWHHVWiVH
SDUD
SDUDH[HFXWiOR
H[HFXWiORRX
RXDTXHP
TXHPOKH
OKHHVWHMD
HVWHMDSUHVWDQ RSRQGR D TXH R IXQFLRQiULR H[HFXWH VHX DWR OHJDO 6XD
GRDX[tOLR UHVLVWrQFLDWRGDYLDQmRpFULPLQRVD1mRKiTXHVHIDODU
HPGHVREHGLrQFLDSRUTXHRIXQFLRQiULRQmRHVWiGDQGR
3HQD
3HQD 'HWHQomRGHGRLVPHVHVDGRLVDQRV TXDOTXHURUGHPDRSDUWLFXODU

 6H R DWR HP UD]mR GH UHVLVWrQFLDQmRVH 0XLWDVYH]HVRIXQFLRQiULRS~EOLFRYDOHVHGRDX[tOLRGH


H[HFXWD RXWUHP 6H D DPHDoD RX D YLROrQFLD IRU FRQWUD HVWH
DX[LOLDGRUWDPEpPFDUDFWHUL]DUiRFULPHGHUHVLVWrQFLD
3HQD
3HQD UHFOXVmRGHXPDWUrVDQRV ([RRILFLDOGHMXVWLoDTXHpRXDJUHGLGRRXDPHDoDGR
SDUDQmRUHDOL]DUXPGHVSHMR2XRFDPLQKRQHLURTXH
 $V
$VSHQDV
SHQDVGHVWH
GHVWHDUWLJR
DUWLJRVmR
VmRDSOLFiYHLVVHPSUH
DSOLFiYHLVVHPSUH DX[LOLD R RILFLDO GH MXVWLoD QR GHVSHMR H p DJUHGLGR RX
MXt]RGDVFRUUHVSRQGHQWHVjYLROrQFLD DPHDoDGRSDUDQmRWUDQVSRUWDURVEHQVGRGHVSHMRDILP
GHTXHDVVLPVHHYLWHDUHDOL]DomRGRGHVSHMR
 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
6H HP UD]mR GD UHVLVWrQFLD R DWR QmR VH UHDOL]DU D HVWiGDQGRXPDRUGHPTXHGHYHUiVHUREHGHFLGDSHOD
SHQD VHUi PDLRU (P TXDOTXHU FDVR Ki DLQGD D SHQD WHVWHPXQKD6HDWHVWHPXQKDVHUHFXVDUDFRPSDUHFHUDR
FRUUHVSRQGHQWHjYLROrQFLDVHHVWD YLROrQFLD VHFRQFUHWL )yUXPQRGLDHKRUDPDUFDGRHVWDUiFRPHWHQGRFULPHGH
]RX$VVLPVHDSHVVRDSDUDLPSHGLURGHVSHMRGHXXQV GHVREHGLrQFLD
PXUURV QR 2ILFLDO GH -XVWLoD RX QR FDPLQKRQHLUR 
OHVLRQDQGRR PDFKXFDQGR  HOH VHUi FRQGHQDGR SHOR &ODUR TXH VH HVVH PHVPR -XL] GH 'LUHLWR PDQGDU R
FULPH GH UHVLVWrQFLD H SRU FULPH GH OHV}HV FRUSRUDLV 2ILFLDOGH-XVWLoDFKDPDUXPPHFkQLFRSDUDFRQVHUWDUVHX
DUW&3  RX VHMD SHOD YLROrQFLD SUDWLFDGD 6H IRL DXWRPyYHOWDOPHFkQLFRVyLUiVHTXLVHUR-XL]GH'LUHLWR
DOpPHPDWRX  XPGRVGRLVUHVSRQGHUiSHORKRPLFtGLR QmR WHPSRGHUHVSDUDWDQWRHDVVLPVHRPHFkQLFRR
DUW HSHORFULPHGHUHVLVWrQFLD PDQGDUjVIDYDVQHQKXPFULPHWHUiFRPHWLGRSRUTXH
WDORUGHPQmRpOHJDO

4XHVWmRLQWHUHVVDQWtVVLPDIRLIRUPXODGDQXP&RQFXUVR
'HVREHGLrQFLD 3DWURFtQLR3DXOLVWDQ &LWDGRSHOR2ILFLDOGH-XVWLoD
QXPD H[HFXomR SDUD SDJDU R GpELWR RX QRPHDU EHQV j
SHQKRUDRGHYHGRU QmRID]QHPXPDFRLVDQHPRXWUD
$UW 'HVREHGHFHU RUGHP OHJDO GHIXQFLRQiULR SHUJXQWDQGR VH FRPHWHULD FULPH GH GHVREHGLrQFLD
S~EOLFR UHVLVWrQFLDRXGHVDFDWR

3HQD GHWHQomRGHTXLQ]HGLDVDVHLVPHVHVHPXOWD 1mR Ki FULPH GH GHVREHGLrQFLD SRUTXH D OHL FLYLO
GHWHUPLQDFRPRSHQD VDQomR DREULJDomRGHRSUySULR
6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR 2ILFLDOGH-XVWLoDSHQKRUDURVEHQVQmRKiUHVLVWrQFLD
SRUTXHHVWHQmRHPSUHJRXTXDOTXHU YLROrQFLDSDUDLP
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR SHGLUTXDOTXHUDomRGRIXQFLRQiULRS~EOLFRPXLWRPHQRV
KDYHULDGHVDFDWRSRUTXHQmRIRLPHQFLRQDGDTXDOTXHU
2EMHWRGD7XWHOD3HQDO RIHQVDFRQWUDR2ILFLDOGH-XVWLoD
D LPSHUDWLYLGDGH H D H[HFXWRULHGDGH GDV RUGHQV GD
DGPLQLVWUDomRS~EOLFD $TXHVWmRpLQWHOLJHQWHH[LJLQGRGRFDQGLGDWRFRQKHFL
PHQWRVREUHWUrVILJXUDVSHQDLV WUrVFULPHV HRUDFLRFt
$omR)tVLFD QLRVREUHXPDVLWXDomRGHIDWR)LTXHDWHQWR
p GHVREHGHFHU GHL[DU GH VH VXEPHWHU j RUGHP OHJDO GH
IXQFLRQiULRS~EOLFR
$WHQomR
$WHQomR VH XPD SHVVRD GHL[DU GH DWHQGHU DXPD
RUGHP MXGLFLDO RX D XPD UHTXLVLomR GR
(OHPHQWR6XEMHWLYR,QMXVWR 0LQLVWpULR3~EOLFRUHODWLYDD/HL
/HL
/HLGH
GH'LUHLWRV
'LUHLWRVGD
GD3HVVRD
RGROR1mR
1mRpFULPHDFRQGXWDFXOSRVDGRGHOLWR
1mR 3RUWDGRUD
3RUWDGRUD GH
GH 'HILFLrQFLD
'HILFLrQFLD  QmR
QmR FRPHWHUi FULPH GH
GHVREHGLrQFLD
GHVREHGLrQFLDPDVXPFULPHHVSHFLDOHPXLWRPDLV
GHVREHGLrQFLD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO JUDYHeRTXHHVWDEHOHFHRDUWLQF,D9,GD/HLQ
 GH287 
(VWHGHOLWRpXPDHVSpFLHGRGHUHVLVWrQFLDHPTXHR
DJHQWHYDLVHRSRUDXPDWROHJDOSRUpPVHPPROHVWDUR  &RQVWLWXLFULPHSXQtYHOFRPUHFOXVmRGH XP D TXDWUR DQRV
IXQFLRQiULR S~EOLFR QHP R DPHDoDQGR QHP GLULJLQGR HPXOWD
YLROrQFLD FRQWUD HOH /LPLWDVH D SDVVLYDPHQWH QmR 
FXPSULUDRUGHPOHJDOGDGDSHORIXQFLRQiULRS~EOLFR$OHL 9 GHL[DUGHFXPSULUUHWDUGDURXIUXVWUDUVHPMXVWRPRWLYR
SUHYrDSRVVLELOLGDGHGHRVIXQFLRQiULRVS~EOLFRV -XL] DH[HFXomRGHRUGHPMXGLFLDOH[SHGLGDQDDomRFLYLOD
'HOHJDGR3ROLFLDLV2ILFLDLVGH-XVWLoDHWF GDUHP RX TXHDOXGHHVWD/HL
WUDQVPLWLUHPRUGHQVDVHUHPFXPSULGDVSRUSDUWLFXODUHV
RX PHVPR IXQFLRQiULRV S~EOLFRV RXWURV TXH D GHYDP 9, UHFXVDUUHWDUGDURXRPLWLUGDGRVWpFQLFRVLQGLVSHQViYHLV
FXPSULU  j SURSRVLWXUD GD DomR FLYLO REMHWR GHVWD /HL TXDQGR
UHTXLVLWDGRVSHOR0LQLVWpULR3~EOLFR
6HRGHVWLQDWiULRGDRUGHPQmRDFXPSULUFRPHWHUi
FULPHGHGHVREHGLrQFLD7RGDYLDVHSDUDQmRFXPSULU
DLQGDHPSUHJDUYLROrQFLDRXDPHDoDRFULPHVHUiRGH
UHVLVWrQFLDVHPSUHMXt]RGHUHVSRQGHUWDPEpPSHORFULPH 'HVDFDWR
UHODWLYRjYLROrQFLD

0DVYHMDEHPVyKDYHUiFULPHGHGHVREHGLrQFLDVHD $UW 'HVDFDWDU


'HVDFDWDUIXQFLRQiULR
IXQFLRQiULRS~EOLFR
S~EOLFRQR
QRH[HUFtFLR
H[HUFtFLRGD
RUGHP GDGD SHOR IXQFLRQiULR S~EOLFR IRU XPD RUGHP IXQomRRXHPUD]mRGHOD
OHJDORXVHMDEDVHDGDHPOHLTXHOKHGrSRGHUHVSDUDGDU
OHJDO
DRUGHP$VVLPTXDQGRXP-XL]GH'LUHLWRLQWLPD YLD 3HQD GHWHQomRGHVHLVPHVHVDGRLVDQRV
2ILFLDOGH-XVWLoDSRUPDQGDGR XPDSHVVRDDFRPSDUH RXPXOWD
FHUHP-Xt]RSDUDSUHVWDUGHSRLPHQWRWDO-XL]GH'LUHLWR
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR 2EV$UHGDomRGHVWHDUWLJRIRLDOWHUDGDSHOD/
2EV /HL
HL Q
Q 
GH $UHGDomRDQWHULRUHUD 2EWHUSDUDVLRX
SDUDRXWUHPYDQWDJHPRXSURPHVVDGHYDQWDJHPDSUHWH[WRGH
6XMHLWR3DVVLYR
LQIOXLUHPIXQFLRQiULRS~EOLFRQRH[HUFtFLRGDIXQomR
R(VWDGRWDPEpPRIXQFLRQiULRRIHQGLGR
$VVLPIRUDPLQFOXtGRVQRWLSRSHQDOWUrVQRYRVWLSRVGH
2EMHWRGD7XWHOD3HQDO
FRQGXWD D DomR GH VROLFLWDU EDVWD DSHQDV SHGLU  D GH
RUHVSHLWRjIXQomRS~EOLFDHjDGPLQLVWUDomRS~EOLFD
H[LJLU LPSRVLomRFRDWLYD HDGHFREUDU UHFODPDUSRVWHUL
RUPHQWHDYDQWDJHPDQWHVSURPHWLGDRXDMXVWDGD 2XWUD
$omR)tVLFD
DOWHUDomR IXQGDPHQWDO IRL R DXPHQWR
DXPHQWR GD SHQD
SHQD PtQLPD
pGHVDFDWDUPHQRVFDEDQGRRIHQGHQGRHKXPLOKDQGR
DQWHVHUDGHDSHQDV XP DQRHDJRUDIRLDJUDYDGDSDUD
 GRLV DQRVGHUHFOXVmR
(OHPHQWR6XEMHWLYR,QMXVWR
RGROR,QH[LVWHIRUPDFXOSRVD
$OWHURXVHDLQGDDIUDomRGHDXPHQWR
DXPHQWRGDSHQDUHODWLYR
DXPHQWR
jYHQGDHGLIDPDomRGRIXQFLRQiULRS~EOLFR$QWHVDSHQD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
HUDDXPHQWDGDGHDSHQDVOHDJRUDVHUiDXPHQWDGDGD
PHWDGH FDVRRDJHQWHFULPLQRVRDOHJXH RXDSHQDV
(VWHpRFULPHGHLQM~ULDFRQWUDIXQFLRQiULRS~EOLFR
LQVLQXH TXHSDUWHGRGLQKHLURVHUiHQWUHJXHSDUDFRUURP
TXHHVWiQRH[HUFtFLRGDIXQomRRXTXDQGRDRIHQVDVy
SHURIXQFLRQiULR
OKHpGLULJLGDSRUTXHWHPDIXQomRS~EOLFD$PRUDOGR
IXQFLRQiULR S~EOLFR QR H[HUFtFLR GH VXD IXQomR RX HP
(HVSHFLDOPHQWHSDUDILQVGHFRQFXUVRREVHUYHVHTXH
UD]mRGHODGHYHVHUSURWHJLGDSHODOHLPDLVGRTXHRSUy
RQRPHPMXULVGDILJXUDWtSLFD QRPHGRFULPH WDPEpP
SULR FLGDGmR SRUTXH D GHVPRUDOL]DomR GR IXQFLRQiULR
IRL PXGDGR DQWHV FKDPDVH H[SORUDomR GH SUHVWtJLRH
S~EOLFRpRGHVDFUHGLWDPHQWRGDSUySULD$GPLQLVWUDomR
GRUDYDQWHpGHQRPLQDGRGHWUiILFRGHLQIOXrQFLD
WUiILFRGHLQIOXrQFLD
3~EOLFD
6XMHLWR$WLYR
eSRULVVRTXHDLQM~ULDFRQWUDIXQFLRQiULRS~EOLFRTXH
TXDOTXHUSHVVRD LQFOXVLYHRIXQFLRQiULRS~EOLFR 
HVWHMDWUDEDOKDQGRRXDLQM~ULDSURIHULGDFRQWUDHOHSRU
FDXVD GH VHX WUDEDOKR IXQomR  p YLVWD FRPR FULPH
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
HVSHFLDOHQmRFRPRFULPHGHLQM~ULD'HVVDIRUPDDDomR
SHQDOpS~EOLFDMiTXHRLQWHUHVVHpS~EOLFRGD$GPLQLV
2EMHWRGD7XWHOD3HQDOD$GPLQLVWUDomR3~EOLFD
2EMHWRGD7XWHOD3HQDO
WUDomR3~EOLFDHQmRSHVVRDODSHQDVGRIXQFLRQiULR
$omR)tVLFD
'HVDFDWRpRIHQVDKXPLOKDomRHVSH]LQKDomRDJUHV
IRUDP LQFOXtGRV QR WLSR SHQDO WUrV QRYDV IRUPDV GH
VmRTXDOTXHUDomRTXHRIHQGDDGLJQLGDGHRSUHVWtJLRH
FRQGXWD D DomR GH VROLFLWDU EDVWD DSHQDV SHGLU  D GH
RGHFRURGDIXQomRS~EOLFD
H[LJLU LPSRVLomRFRDWLYD HDGHFREUDU UHFODPDUSRVWHUL
RUPHQWHDYDQWDJHPDQWHVSURPHWLGDRXDMXVWDGD 
1mRpSUHFLVRTXHRVHUYLGRUS~EOLFRVHVLQWDRIHQGLGR
EDVWDQGR TXH R IDWR VHMD LQVXOWXRVR SDODYU}HV JHVWRV
(OHPHQWR6XEMHWLYR,QMXVWR
REVFHQRVYDLDDPHDoDHPSXUU}HVERIHWDGDVRFRDJUHV
pRGRORHVSHFtILFR1mRKiPRGDOLGDGHFXOSRVD
VmRHWFWXGRLVVRGLVSHQVDTXHVWLRQDUVHVHRIXQFLRQiULR
VHVHQWLXRIHQGLGR
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
$WHQomR QmRpSRVVtYHOGHVDFDWR
QmR VHP
VHP D SUHVHQoDGR
SUHVHQoD
+iWUDSDFHLURVTXHDODUGHDQGRSUHVWtJLRJDEDQGRVH
IXQFLRQiULRS~EOLFR
GHSRVVXtUHPLQIOXrQFLDMXQWRj$GPLQLVWUDomRH[S}HP
DRGHVFUpGLWRJHUDORSUHVWtJLRDFRQVLGHUDomRHRUHVSHLWR
TXHHODGHYDVHUMXQWRjFROHWLYLGDGH
7UiILFRGH,QIOXrQFLD
(VWHFULPHYLVDDSXQLUWRGRVDTXHOHVTXHDSUHWH[WRGH
XVDUHPGHVXDLQIOXrQFLD
LQIOXrQFLDMXQWRDIXQFLRQiULRQRH[HUFtFLR
LQIOXrQFLD
$UW 6ROLFLWDU H[LJLU FREUDU RX REWHU SDUD VLRX GH IXQomR YHQKDP D REWHU YDQWDJHP RX SURPHVVD GH
SDUD
SDUDRXWUHP
RXWUHPYDQWDJHP
YDQWDJHPRX RXSURPHVVD
SURPHVVDGHGHYDQWD YDQWDJHP9LVDSRLVDSXQLURVTXHYHQGHPDDGPLQLV
JHP
JHP D SUH
SUHWH[WR
WH[WR GH
GH LQIOXLU
LQIOXLU HP
HP DWR
DWR SUDWLFDGR WUDomR
SRUIXQFLRQiULRS~EOLFRQRH[HUFtFLRGDIXQ
omR 6HWDOWUDSDFHLURSDUDPHOKRUYHQGHUVXDLQIOXrQFLD
DLQGD DOHJDU RX LQVLQXDU TXH R IXQFLRQiULR S~EOLFR
3HQD UHFOXVmRGH GRLV DFLQFRDQRVHPXOWD
3HQD WDPEpPUHFHEHUiXPDSDUWHGR3UHoRDSHQDHQWmRVHUi
DXPHQWDGD GD PHWDGH
PHWDGH
WDGH H QmR PDLV DSHQDV GH D XP
~QLFR $SHQD
SHQDpDXPHQWDGD
DXPHQWDGDGD
GDPHWDGH
PHWDGHVH
VHRDJHQWH WHUoR  XPWHUoR FRQIRUPHDOWHUDomRLPSRVWDSHOD/HL
DOHJD
DOHJD RX
RX LQVL
LQVLQXD
QXD TXH
TXH D YDQWDJHP
YDQWDJHP p WDPEpP Q
GHVWLQDGDDRIXQFLRQiULR
$LQGDUHFHQWHPHQWHDXWRHVFRODVFREUDYDPGHDOXQRV
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
FDL[LQKDV SDUD DSURYDomR HP H[DPH GH PRWRULVWD H
DOHJDYDPTXHWDLVFDL[LQKDVVHULDPGDGDVDRVH[DPLQD ,PSHGLPHQWR3HUWXUEDomRRX
GRUHV&RPHWLDPSRLVRFULPHGHH[SORUDomRGHSUHVWt )UDXGHGH&RQFRUUrQFLD
JLRTXHGHYHUiWHUDSHQDDJUDYDGDGDPHWDGH

$UW ,PSHGLU SHUWXUEDU RX IUDXGDUFRQFRUUrQFLD


S~EOLFD
S~EOLFDRX
RXYHQGD
YHQGDHP
HPKDVWD
KDVWDS~EOLFD
S~EOLFDSURPRYLGD
&RUUXSomR$WLYD SHOD
SHODDGPLQLVWUDomR
DGPLQLVWUDomRIHGHUDO
IHGHUDOHVWDGXDO
HVWDGXDORX
RXPXQL
FLSDORXSRUHQWLGDGH
FLSDORXSRU HQWLGDGHSDUDHVWDWDO
SDUDHVWDWDODIDVWDU
DIDVWDURX
SURFXUDU
SURFXUDUDIDVWDU
DIDVWDUFRQFRUUHQWH
FRQFRUUHQWHRX
RXOLFLWDQWH
OLFLWDQWHSRU
$UW 2IHUHFHU
2IHUHFHU RX
RX SURPHWHU
SURPHWHU YDQWDJHP LQGHYLGDD PHLR
PHLR GH
GH YLROrQFLD
YLROrQFLD JUDYH
JUDYH DPHDoD
DPHDoD IUDXGH
IUDXGH RX
IXQFLRQiULR
IXQFLRQiULR S~EOLFR
S~EOLFR SDUD GHWHUPLQiOR D RIHUHFLPHQWRGHYDQWDJHP
SUDWLFDURPLWLURXUHWDUGDUDWRGHRItFLR
3HQD
3HQD GHWHQomRGHVHLVPHVHVDGRLVDQRVRXPXOWD
3HQDUHFOXVmRGHGRLVDGR]HDQRVHPXOWD
3HQD DOpPGDSHQDFRUUHVSRQGHQWHjYLROrQFLD
2EV D/HLQGHHOHYRXDSHQDPtQLPDGH
XP SDUD GRLV DQRV H D SHQD Pi[LPD GH RLWR SDUD ~QLFR ,QFRUUH QD PHVPD SHQD TXHP VHDEVWpPGH
GR]H DQRV GH UHFOXVmR 2 FODUR REMHWLYR p R FRPEDWH j FRQFRUUHU
FRQFRUUHU RX OLFLWDU HP UD]mR GD YDQWDJHP
FRUUXSomRGRVDJHQWHVS~EOLFRV RIHUHFLGD
RIHUHFLGD
~QLFR $ SHQD p DXPHQWDGD GH XP WHUoRVHHP 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
UD]mRGDYDQWDJHPRXSURPHVVDRIXQFLRQi
UD]mRGDYDQWDJHPRXSURPHVVDRIXQFLRQi
ULR
ULRUHWDUGD
UHWDUGDRX
RXRPLWH
RPLWHDWR
DWRGH
GHRItFLR
RItFLRRX
RXDSUDWLFD
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
LQIULQJLQGRGHYHUIXQFLRQDO
 2EMHWR
2EMHWR GD
GD 7XWHOD
7XWHOD 3HQ
3HQDO
DO D DGPLQLVWUDomR S~EOLFD
6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
SULQFLSDOPHQWHRVHXSDWULP{QLR
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
$omR)tVLFD
GXDVGLYHUVDVKLSyWHVHV $
$ LPSHGLPHQWRSHUWXUEDomRRX
$
2EMHWRGD7XWHOD3HQDO
IUDXGH GD FRQFRUUrQFLD RX KDVWD S~EOLFD RQGH HVWmR
DPRUDOLGDGHGDDGPLQLVWUDomRS~EOLFD
SUHYLVWRVRVVHJXLQWHVQ~FOHRV  LPSHGLU
  SHUWXUEDU

$omR)tVLFD  IUDXGDU %
 % DIDVWDPHQWRRXWHQWDWLYDGHDIDVWDPHQWR
%
GXDVDOWHUQDWLYDV D
D RIHUHFHUH E
E SURPHWHU GH FRQFRUUHQWH RX OLFLWDQWH DV Do}HV LQFULPLQDGDV VmR
D E
DIDVWDURXSURFXUDU WHQWDU DIDVWDU1R~QLFRSXQHVHR
(OHPHQWR6XEMHWLYR,QMXVWR FRQFRUUHQWHRXOLFLWDQWHTXHVHDEVWpPRXVHMDGHL[DGH
RGRORHVSHFtILFR1mR
1mRKiFULPHFXOSRVR
1mR SDUWLFLSDURXGHVLVWHGDSDUWLFLSDomRHPUD]mRGDYDQWD
JHPRIHUHFLGD$DEVWHQomRSRUPRWLYRGLYHUVRpDWtSLFD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
(OHPHQWR6XEMHWLYR,QMXVWR
&RPR WRGD PRHGD D FRUUXSomR WDPEpP WHP GRLV R GROR 1D  VHJXQGD ILJXUD Ki DLQGD R HOHPHQWR
ODGRVRGRIXQFLRQiULRS~EOLFRTXHFRPRYLPRVFRPHWH VXEMHWLYRGRWLSRUHYHODGRSHORHVSHFLDOILPGHDJLURFRUUH
FULPHGHFRUUXSomRSDVVLYDHRGRSDUWLFXODUTXHFRPHWH RPHVPRQR~QLFR ILJXUDGRORJHQpULFRILJXUD
GHOLWRGHFRUUXSomRDWLYD H~QLFRGRORHVSHFtILFR ,QH[LVWHSXQLomRDWtWXORGH
FXOSD
2 SDUWLFXODU TXH RIHUHFHU RX SURPHWHU YDQWDJHP
FDL[LQKDFDIH]LQKRFHUYHMLQKDKRUDH[WUDHWF LQGHYLGD $omR3HQDO
$omR3HQDO S~EOLFDLQFRQGLFLRQDGD
DR IXQFLRQiULR SDUD TXH HVWH SUDWLTXH RX GHL[H GH
SUDWLFDU RX DWUDVH D SUiWLFD GH XP DWR GH VHX RItFLR
FRPHWHUiFULPHGHFRUUXSomRDWLYD
,QXWLOL]DomRGH(GLWDORX6LQDO
9HMDEHPEDVWDRRIHUHFLPHQWRRXSURPHVVD6HR
IXQFLRQiULRS~EOLFRFDLUQDFDQWDGDHUHWDUGDURXRPLWLU
RXSUDWLFDURDWRLQIULQJLQGRGHYHUIXQFLRQDODSHQDGR $UW 5DVJDU RX GH TXDOTXHU IRUPD LQXWLOL]DURX
FRUUXSWRUDWLYRVHUiDXPHQWDGDGHXPWHUoR FRQVSXUFDU
FRQVSXUFDUHGLWDO
HGLWDODIL[DGR
DIL[DGRSRU
SRURUGHP
RUGHPGH
GHIXQFL
RQiULR
RQiULR S~EOLFR
EOLFR YLRODU
YLRODU RX
RX LQXWLOL]DU
LQXWLOL]DU VHOR
VHOR RX
0DVYHMDEHPDFRUUXSomRDWLYDSUHVVXS}HRVXERUQR VLQDO
VLQDO HPSUHJDGR
HPSUHJDGR SRUGHWHUPLQDomROHJDORX
GRIXQFLRQiULRSDUDRPLWLURXUHWDUGDUDWRGHRItFLR6H SRU
SRURUGHP
RUGHPGHIXQFLRQiULRS~EOLFRSDUDLGHQ
XPSDUWLFXODUGiDXPIXQFLRQiULRS~EOLFRXPDFDL[LQKD WLILFDURXFHUUDUTXDOTXHUREMHWR
WLILFDURXFHUUDUTXDOTXHUREMHWR
SDUD HOH QXP GRPLQJR SROLU VHX FDUUR QmR KDYHUi
TXDOTXHU FULPH HVVH GHWDOKH Mi IRL TXHVWLRQDGR HP 3HQD
3HQD GHWHQomRGHXPPrVDXPDQRRXPXOWD
FRQFXUVRS~EOLFR 
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR HRIL]HUQmR
QmRVHYDOHQGRGDVYDQWDJHQVGHVHXFDUJRGH
QmR
IXQFLRQiULRS~EOLFRGR(VWDGRWHUiSUDWLFDGRHVWHGHOLWR
6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR GRDUWLJRHQmR
QmRRGRDUWLJRGR&yGLJR3HQDO
QmR

2EMHWRGD7XWHOD3HQDODDGPLQLVWUDomRS~EOLFD
2EMHWRGD7XWHOD3HQDO eQHFHVViULRTXHQmRVHHVTXHoDTXHROLYURRXGRFX
PHQWRGHYHUiHVWDUVREDFXVWyGLD JXDUGDGHSyVLWR GH
$omR
$omR)tVLFD
)tVLFDGXDV
 HGLWDODVDo}HVSUHYLVWDVVmR D
 D XPIXQFLRQiULRS~EOLFR6HHVWLYHUFRPXPSDUWLFXODUQmR
UDVJDU E
E LQXWLOL]DUH
E FRQVSXUFDU  VLQDORXVHOR
 KDYHUiRFULPHGHVWHDUWLJRDPHQRVTXHWDOSDUWLFXODU
D YLRODU E
D E LQXWLOL]DU
E HVWHMDHPVHUYLoRS~EOLFR

(OHPHQWR6XEMHWLYR,QMXVWR $WHQomRWDPEpPHVWHFULPHVypSXQLGRQDPRGDOLGD
HPDPEDVDVILJXUDVpRGROR,QH[LVWHSXQLomRDWtWXORGH GHGRORVD TXDQGRRDJHQWHRSUDWLFDTXHUHQGRSUDWLFDU 
FXOSD $VVLPVHXPDSHVVRDLQXWLOL]DUVHPTXHUHU SRUDFLGHQWH
RXSRUVHUHVWDEDQDGR XPOLYUR RXSURFHVVRRXGRFX
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO PHQWR TXHHVWDYDFRQILDGRjFXVWyGLDGHXPIXQFLRQi
ULR DTXHOD SHVVRD WHUi DJLGR FRP FXOSD QHJOLJrQFLD
LPSUXGrQFLD LPSHUtFLD  VHUi REULJDGD LQGHQL]DU R
SUHMXt]RTXHFDXVDUPDVQmRWHUiFRPHWLGRRFULPHGRDU
6XEWUDomRRX,QXWLOL]DomRGH/LYURRX'RFXPHQWR WLJR&3DGLDQWH7DOGHOLFDGRDVSHFWRMiIRLTXHVWLRQD
GRQXPFRQFXUVR

$UW 6XEWUDLURXLQXWLOL]DUWRWDORXSDUFLDOPHQWH
OLYUR
OLYURRILFLDO
RILFLDOSURFHVVR
SURFHVVRRX
RXGRFXPHQWR
GRFXPHQWRFRQILDGR
jFXVWyGLD
FXVWyGLDGH
GHIXQFLRQiULR
IXQFLRQiULRHP
HPUD]mR
UD]mRGH
GHRItFLR
&ULPHVFRQWUDD$GPLQLVWUDomRGD-XVWLoD
RXGHSDUWLFXODUHPVHUYLoRS~EOLFR

3HQD
3HQD UHFOXVmRGHGRLVDFLQFRDQRVVHRIDWRQmRFRQV
WLWXLFULPHPDLVJUDYH 3UHYrHPVHQHVWDHVSpFLHGHFULPHVDVFRQGXWDVTXH
DIHWDUmRDSUHVWDomRGRVHUYLoRMXULVGLFLRQDOSHOR(VWDGR
6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR

6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR 'HQXQFLDomR&DOXQLRVD
2EMHWR
2EMHWRGD
GD7XWHOD
7XWHOD3HQDO$RUJDQL]DomRHRVUHJLVWURVGD
3HQDO
$GPLQLVWUDomR3~EOLFD
$UW 'DU
'DUFDXVD
FDXVDDLQVWDXUDomR
LQVWDXUDomRGH
GHLQYHVWLJDomR
LQYHVWLJDomRSROLFL
DO
DO RX
RX GH
GH SURFHVVR
SURFHVVR MXGLFLDO
MXGLFLDO LQVWDXUDomR
QVWDXUDomR GH
 $omR
$omR )tVLFD
)tVLFD TXDOTXHU XPD GDV GXDV VHJXLQWHV D
LQYHVWLJDomR
LQYHVWLJDomR DGPLQ
DGPLQLVWUDWLYDLQTXpULWRFLYLORX
LVWUDWLYDLQTXpULWRFLYLORX
VXEWUDLU UHWLUDU E 
E LQXWLOL]DU WRUQDU LPSUHVWiYHO RX
DomR GH LPSURELGDGH
LPSURELGDGH FRQWUD DOJXpP
LQ~WLO WRWDO RX SDUFLDOPHQWH 3DUD D WLSLILFDomR Ki D
LPSXWDQGROKHFULPHGHTXHRVDEHLQRFHQWH
LPSXWDQGROKHFULPHGHTXHRVDEHLQRFHQWH
QHFHVVLGDGHGHTXHRREMHWRHVWHMDFRQILDGRDRIXQFLRQi
ULR HP UD]mR GH RItFLR RX GH SDUWLFXODU HP VHUYLoR
2EV GHVWDTXHHPLWiOLFRDFUHVFLGRSHOD/HLQ
S~EOLFR
3HQDUHFOXVmRGHGRLVDRLWRDQRVHPXOWD
3HQD
(OHPHQWR
(OHPHQWR6XEMHWLYR,QMXVWRRGROR1mR
6XEMHWLYR,QMXVWR 1mRKiWLSLFLGDGH
1mR
FXOSRVD  $ SHQD p DXPHQWDGD GH VH[WD SDUWH VHR
DJHQWH
DJHQWH VH
VH VHUYH
VHUYH GH
GH DQRQLPDWR
DQRQLPDWR RX
RX GH
GH QRPH
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO VXSRVWR
VXSRVWR
2FULPHSUHYLVWRQRDUWLJRpSUySULRGHIXQFLRQiULR  $SHQDpGLPLQXtGDGHPHWDGHVHDLPSXWD
S~EOLFRHQTXDQWRRSUHYLVWRQHVWHDUWLJRpFRPHWLGRSRU omRpGHSUiWLFDGHFRQWUDYHQomR
omRpGHSUiWLFDGHFRQWUDYHQomR
TXDOTXHU SHVVRD 2 IXQFLRQiULR S~EOLFR Vy SUDWLFDUi R
FULPHSUHYLVWRQHVWHDUWLJRDWXDQGRFRPRFRDXWRULVWRp  6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
DX[LOLDQGRRXDMXGDQGRRSDUWLFXODUDSUDWLFDURFULPH
 6XMHLWR
6XMHLWR3DVVLYRR(VWDGR SULPHLUDPHQWH HDSHVVRD
DVVLYR
2 IXQFLRQiULR S~EOLFR SRGHUi SUDWLFDU HVVH GHOLWR DFXVDGDFDOXQLRVDPHQWH
WDPEpPVHDWXDUFRPRHVWUDQKRLVWRpQmRFRPRIXQ
FLRQiULRS~EOLFRTXHUGL]HUVHPVHYDOHUGHVXDFRQGLomR  2EMHWR
2EMHWRGD
GD7XWHOD
7XWHOD3HQDORLQWHUHVVHGDMXVWLoDSULPHL
3HQDO
GHIXQFLRQiULRS~EOLFRVHPVHDSURYHLWDUGHVHXFDUJR UDPHQWHHDKRQUDGDSHVVRDDFXVDGDVHFXQGDULDPHQ
3H[VHXPIXQFLRQiULRGH(VWDGRUHVROYHUVXEWUDLUXP WH
OLYURRXLQXWLOL]DUXPGRFXPHQWRGDSUHIHLWXUDPXQLFLSDO
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
 $omR
$omR)tVLFD3XQHVHDDJHQWHTXHGiFDXVDDLQVWDXUD
)tVLFD
omRGHLQYHVWLJDomRSROLFLDORXGHSURFHVVRMXGLFLDO &RPXQLFDomR)DOVDGH&ULPHRX&RQWUDYHQomR
RX D LQVWDXUDomR GH LQYHVWLJDomR DGPLQLVWUDWLYD
LQTXpULWRFLYLORXDomRGHLPSURELGDGHQRYDVKLSyWHVHV
DFUHVFLGDV/HL
/HL
/HLQ
QGHMiTXHKRMH
 $UW 3URYRFDU
3URYRFDUDDomR
DomRGDDXWRULGDGHFRPXQLFDQGR
QmR VmR SRXFDV DV GHQ~QFLDV FRQWUD DJHQWHV S~EOLFR OKH
OKHDRFRUUrQFLD
RFRUUrQFLDGH
GHFULPH RXGH
FULPHRX GHFRQWUDYHQomR
PRWLYDQGRDLQVWDXUDomRGHLQYHVWLJDomRDGPLQLVWUDWLYD TXHVDEHQmRVHWHUYHULILFDGR
TXHVDEHQmRVHWHUYHULILFDGR
LQTXpULWRFLYLORXDomRGHLPSURELGDGHPXLWDVYH]HV
LPSXWDQGROKHV FULPHV RX LQIUDo}HV VDELGDPHQWH 3HQD
3HQD GHWHQomRGHXPDVHLVPHVHVRXPXOWD
LQRFRUUHQWHV
 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
 (OHPHQWR 6XEMHWLYR,QMXVWR p R GROR GLUHWRQmR  6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
EDVWDQGRRGRORHYHQWXDOSRLVRDJHQWHSUHFLVDVDEHU
VHPG~YLGDTXHRLPSXWDGRpLQRFHQWHRFULPHQmR  2EMHWRGD7XWHOD3HQDODGPLQLVWUDomRGDMXVWLoD
2EMHWRGD7XWHOD3HQDO
SXQLGRDWtWXORGHFXOSD
 $omR
$omR)tVLFDpSURYRFDU,QFULPLQDVHRFRPSRUWDPHQWR
)tVLFD
 $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO GH TXHP SURYRFD D DomR GH DXWRULGDGH SROLFLDO RX
MXGLFLiULD FRPXQLFDQGROKHDRFRUUrQFLDGHFULPHRX
$WHQomRRDUWGD/HLQ OHLGDLPSUREL GHFRQWUDYHQomRTXHVDEHQmRVHWHUYHULILFDGR
GDGH DGPLQLVWUDWLYD  SUHYr TXH &RQVWLWXL FULPH
ULPH D
UHSUHVHQWDomR SRU DWR GH LPSURELGDGH FRQWUD DJHQWH  (OHPHQWR 6XEMHWLYR,QMXVWR R GROR GLUHWR 1mRKi
S~EOLFR RX WHUFHLUR EHQHILFLiULR TXDQGR R DXWRU GD IRUPDFXOSRVDGRGHOLWR
GHQ~QFLDRVDEHLQRFHQWHFRPLQDQGRSDUDRGHOLWRD
SHQDGHGHWHQomRGHVHLVDGH]PHVHVHPXOWD $omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO

2SURSyVLWRGHVVDSUHYLVmRFULPLQDOpHYLWDUDOHYLDQGD
GH GH SHVVRDV TXH GHVHMDP DWLQJLU D KRQUD GR DJHQWH
S~EOLFRRXGHWHUFHLUDSHVVRDFRQVSXUFDUVHXQRPHGH $XWR$FXVDomR)DOVD
RX FDXVDUOKH HPEDUDoR   VHMD SRU LQWHUHVVH SROtWLFR
DGYHUViULRV  RX SDUWLGiULR HOHLo}HV  RX VHMD SRU
VHQVDFLRQDOLVPR MRUQDOLVPR  RX RXWUR LQWHUHVVH TXDO $UW $FXVDUVH SHUDQWH D DXWRULGDGH GHFULPH
TXHU LQH[LVWHQWHRXSUDWLFDGRSRURXWUHP
LQH[LVWHQWHRXSUDWLFDGRSRURXWUHP

( VH R 0LQLVWpULR 3~EOLFR SURPRYHU  D DomR FLYLO 3HQD GHWHQomRGHWUrVPHVHVDGRLVDQRVRXPXOWD


3HQD
S~EOLFDRXDDomRSHQDORXUHTXLVLWDULQVWDXUDomRGH
LQTXpULWRSROLFLDO DUW/HLQ SDUDDSXUDUD 6XMHLWR$WLYRTXDOTXHUSHVVRD
6XMHLWR$WLYR
UHVSRQVDELOLGDGHFULPLQDOGRDJHQWHS~EOLFRHRXWHUFHLUD 6XMHLWR3DVVLYRR(VWDGR
6XMHLWR3DVVLYR
SHVVRDGHQXQFLDGRSRUTXHPRVVDELDLQRFHQWHV"""
2EMHWRGD7XWHOD3HQDODGPLQLVWUDomRGDMXVWLoD
2EMHWRGD7XWHOD3HQDO
5HVSRQGHUi R FDOXQLRVR SHOR FULPH GHVVH DUW RX
SHORFULPHGRDUW&3"""  $omR
$omR )tVLFD
)tVLFDSXQHVHDFRQGXWDGHDFXVDUVHGHFULPH
VLFD
LQH[LVWHQWHRXSUDWLFDGRSRURXWUHPeLQGLVSHQViYHO
$ SUHYLVmR GR WLSR SHQDO HVSHFLDO DUW GD /HL Q SRUpPTXHDDXWRDFXVDomRVHMDIHLWDSHUDQWHDXWRULGD
 SDUHFHULDH[FOXLUDUHVSRQVDELOLGDGHSHORFULPH GH SROLFLDORXMXGLFLDO HQmRDTXHPQmRGHWHQKDWDO
GH GHQXQFLDomR FDOXQLRVD TXH p GH QDWXUH]D JHUDO DXWRULGDGH
DUW&3 RTXHVHULDXPFRQWUDVHQVRMiTXHEHQHILFL
DULDRLQIUDWRUSRLVDSHQDGRSULPHLURpPXLWRLQIHULRUj  (OHPHQWR
(OHPHQWR6XEMHWLYR,QMXVWR
6XEMHWLYR,QMXVWRpRGROR,QH[LVWHPRGDOL
GHVWHVHJXQGR UHFOXVmRGH GRLV D RLWR DQRVH GDGHFXOSRVD
PXOWD 
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
'LVWLQJDVH SRUpP TXH RV GRLV WLSRV SHQDLV WrP
SURSyVLWRGLVWLQWRRSULPHLUR DUW/HLQ
YLVWD D SURWHJHU D KRQRUDELOLGDGH SHVVRDO GR DJHQWH
S~EOLFR RX GH WHUFHLUD SHVVRD  HQTXDQWR R VHJXQGR )DOVR7HVWHPXQKRRX)DOVD3HUtFLD
WXWHOD D $GPLQLVWUDomR GD -XVWLoD SDUD TXH VH QmR
GHVSUHVWLJLHHODFRPDSXUDo}HVLQIXQGDGDV
$UW )D]HU
)D]HU DILUPDomR IDOVD RX QHJDU RX FDODU D
'HFRQVHJXLQWHRDJHQWHUHVSRQGHUiSHORVGRLVGHOLWRV
YHUGDGH
YHUGDGH FRPR WHVWHPXQKD SHULWR FRQWDGRU
RQWDGRU
HPFRQFXUVR
FRQFXUVR
FRQFXUVRIRUPDO4XDQGRRDJHQWHPHGLDQWHXPDVy
IRUPDO WUDGXWRURXLQWpUSUHWHHPSURFHVVRMXGLFLDORX
DomRRXRPLVVmRSUDWLFDGRLVRXPDLVFULPHVLGrQWLFRVRX
DGPLQLVWUDWLYR
DGPLQLVWUDWLYRLQTXpULWR
LQTXpULWRSROLFLDO
SROLFLDORX
RXHP
HPMXt]R
QmR DSOLFDVHOKH D PDLV JUDYH GDV SHQDV FDEtYHLV RX VH
DUELWUDO
LJXDLVVRPHQWHXPDGHODVPDVDXPHQWDGDHPTXDOTXHU
FDVRGHXPVH[WRDWpPHWDGH DUW&3  3HQD
3HQD UHFOXVmRGH GRLV D TXDWUR DQRVHPXOWD
(FUHYHQWH7pFQLFR-XGLFLiULR7-6
 7- 6mR3DXOR 'LU3HQDO 

$WHQomR
$WHQomR RFDSXWGHVWHDUWVRIUHXGXDVSHTXHQD $SHVVRDTXHGHL[DUGHGL]HUDYHUGDGHVHMDPHQWLQGR
DOWHUDo}HVSHOD/HLQSULPHL H[SUHVVDPHQWH PXGDQGRRVIDWRV RXQHJDQGR GL]HQGR
UDPHQWHLQFOXLXVHRFFRQWDGRU
RQWDGRUGHQWUHDTXHOHVTXHWrPR TXHQmRDFRQWHFHUDPRVIDWRV RXFDODQGR GL]HQGRTXH
GHYHU GH WHVWHPXQKDU H GH RXWUR ODGR FRUULJLXVH R QmRVDEHRXQmRYLX HILFDUSURYDGRTXHVHXWHVWHPXQKR
HTXtYRFRGRWH[WRDQWHULRUTXHVXJHULDDH[LVWrQFLDGH IRL IDOVR SURYDVH QD FRPSDUDomR FRP RV GHPDLV
SURFHVVR SROLFLDO TXDQGR Vy Ki R SURFHGLPHQWR GR GHSRLPHQWRV H FRP DV GHPDLV SURYDV GR SURFHVVR 
LQTXpULWR
LQTXpULWR SROLFLDORQGHWDPEpPWDLVSHUVRQDJHQVGD
SROLFLDO UHVSRQGHUiSHORFULPHGHIDOVRWHVWHPXQKR(PFDVRGH
SURYDRUDOQmRSRGHPPHQWLUQHJDURXFDODUDYHUGDGH HQJDQR RX HVTXHFLPHQWR ILFD H[FOXtGR R GROR QmR VH
FRQILJXUDQGRRFULPH
$WHQomR
$WHQomR DSHQDGRFULPHIRLDXPHQWDGDGHaSDUDGHa
DQRVGHUHFOXVmRSHOD/HLQ 0DV HP MXt]R SURFHVVR MXGLFLDO  RX QD GHOHJDFLD
LQTXpULWRSROLFLDO RXSHUDQWHDDGPLQLVWUDomRS~EOLFD
1D HVVrQFLD SUHVHUYDVH YiOLGD D HVWUXWXUD GR WLSR SURFHVVRDGPLQLVWUDWLYR RXPHVPRHPMXt]RDUELWUDO
SHQDODQWHULRU QmR VmR Vy DV WHVWHPXQKDV DV ~QLFDV SHVVRDV D SUHVWDU
FRODERUDomRVYH]HVDSHVVRDTXHGHFLGLUi MXL]GHOHJD
 6XMHLWR
6XMHLWR$WLYRTXHPWHQKDDTXDOLGDGHGHHVWDUVHQGR
$WLYR GR RX DGPLQLVWUDGRU  SUHFLVD GR DX[tOLR GH XP SHULWR
WHVWHPXQKDSHULWRWUDGXWRURXLQWpUSUHWH SHVVRDTXHFRQKHFHSURIXQGDPHQWHFHUWRVUDPRVWpFQL
FRVHFRPTXHPRMXL]EXVFDDVLQIRUPDo}HVSDUDPHOKRU
 6XMHLWR 3DVVLYR
3DVVLYR (VWDGR HYHQWXDOPHQWH DSHVVRD FRQKHFHURIDWR ([HPSORSDUDVDEHUVHRUpXpORXFRR
SUHMXGLFDGD MXL]SUHFLVDUiGHFRQKHFLPHQWRVSVLTXLiWULFRV&RPRHOH
MXL] QDGD VDEH VREUH SVLTXLDWULD GHWHUPLQD D XP Pp
 2EMHW
2EMHWR
R GD 7XWHOD 3HQDODYHUDFLGDGHGDVSURYDVQD
3HQDO GLFRSVLTXLDWUDTXHH[DPLQHRUpXHHODERUHXPODXGR
$GPLQLVWUDomRGD-XVWLoD GL]HQGRVHRUpXpRXQmRORXFR
 $omR
$omR)tVLFDTXDOTXHUXPDGDVWUrVVHJXLQWHV D
)tVLFD D ID]HU
D 2XWUDVYH]HVRMXL]UHFHEHQRSURFHVVRXPGRFXPHQWR
DILUPDomRIDOVD E
E 
E QHJDUDYHUGDGH
FDODUDYHUGDGH HVFULWRHPOtQJXDHVWUDQJHLUD&RPRQmRFRQKHFHEHPR
LGLRPDSUHFLVDUiGHXPDSHVVRDSDUDWUDGX]LORQRPHDUi
(OHPHQWR 6XEMHWLYR,QMXVWR
 (OHPHQWR 6XEMHWLYR,QMXVWR
,QMXVWR R GROR 1mR
1mR p FULPHD XPWUDGXWRUTXHWUDGX]LUiWDOGRFXPHQWRSDUDTXHHOH
FRQGXWDFXOSRVD MXL]VDLEDRVHXFRQWH~GR
 $omR
$omR 3HQDOS~EOLFDLQFRQGLFLRQDGD DVHQWHQoDILQDO
3HQDO 1RXWUDVYH]HVDWHVWHPXQKDRXPHVPRRUpXRXDYt
ILFDUiVXERUGLQDGDDRSURIHULPHQWRGDGHFLVmRGDTXHOH WLPDSRGHPVHUHVWUDQJHLURVTXHVyIDODPHPVXDOtQJXD
RXWURSURFHVVRHPTXHVHGHXRIDOVRWHVWHPXQKRRX
HVWUDQJHLUD FRPR R MXL] HQWHQGHUi H FRPSUHHQGHUi R
SHUtFLD 
IDWR TXH HOHV FRQWDUmR " 1HVVH FDVR QRPHDUi XP LQ
WpUSUHWHTXHFRQIRUPHDWHVWHPXQKDRXUpXRXYtWLPD
7RGDVDVSHVVRDVTXHVmRFKDPDGDVDFRODERUDUFRPD
IRUHPFRQWDQGRRIDWRLUiHOHLQWpUSUHWHWUDGX]LQGRD
-XVWLoDWrPDREULJDomRGHGL]HUDYHUGDGHSRUTXHVHQmR
QDUUDWLYDDRMXL]
D GLVVHUHP HVWDUmR DMXGDQGR D ID]HU LQMXVWLoDV WDQWR
DEVROYHQGRTXHPGHYHULDVHUFRQGHQDGRTXDQWRFRQGH
1HP R SHULWR QHP R WUDGXWRU QHP R LQWpUSUHWH
QDQGRXPLQRFHQWH
SRGHUmR IDOWDU FRP D YHUGDGH QHP PHQWLQGR QHP
QHJDQGRQHPFDODQGRVREUHDYHUGDGH
2 WHVWHPXQKR p XP PHLR GH SURYD LPSRUWDQWtVVLPR
SDUDDGHVFREHUWDGDYHUGDGHGHXPIDWRRFRUULGREHP
'DPHVPDIRUPDTXHDWHVWHPXQKDWDLVFRODERUDGRUHV
FRPRVREUHDFXOSDRXDLQRFrQFLDGHXPDFXVDGR$VVLP
GRMXt]RUHVSRQGHUmRSHORFULPHGHIDOVRWHVWHPXQKRRX
TXDQGRXPDSHVVRDIRUFKDPDGDDSUHVWDUGHSRLPHQWR
IDOVDSHUtFLD
VHU WHVWHPXQKD GH XP IDWR  GHYH FRQWDU DR -XL] RX
'HOHJDGR VH j 3ROtFLD IRU FKDPDGR RX j $XWRULGDGH
$GPLQLVWUDWLYDVHIRUFKDPDGRDXPDUHSDUWLomRS~EOLFD eLPSRUWDQWHREVHUYDUWDPEpPTXHRFULPHGHVWHDUWLJR
RX PHVPR VH FRQYRFDGR SRU -Xt]R $UELWUDO  WRGD D WHPXPQRPHIDOVRWHVWHPXQKRRXIDOVDSHUtFLD$OLiV
YHUGDGHTXHVDEH YLXRXRXYLX  TXDVH WRGRV RV FULPHV GR &yGLJR 3HQDO WrP XP QRPH
$VVLP TXHP PDWD FRPHWH KRPLFtGLR TXHP PDFKXFD
(VFODUHoDVH TXH R -Xt]R $UELWUDO FRQVWLWXL XPD RXWUHPFRPHWHOHVmRFRUSRUDOIXQFLRQiULRS~EOLFRTXH
HVSpFLH GH MXVWLoD SDUWLFXODU HP TXH DV SDUWHV HP GHVYLD EHP GD UHSDUWLomR SUDWLFD SHFXODWR HWF  $
FRQIOLWR QRPHLDP XP iUELWUR SDUD VROXFLRQDU VXD WHVWHPXQKDWHPRGHYHUGHFRPSDUHFHUD-Xt]RHGHIDODU
SHQGrQFLDHVHREULJDPDREHGHFHUjGHFLVmRTXHSRUHOH DYHUGDGH
IRU SURIHULGD SUHYLVWR QD OHL Q  DWp SDUD
GHVDIRJDUR-XGLFLiULRHFRQWULEXLUSDUDRUHVWDEHOHFLPHQ 7UrVSRUWDQWRVmRVHXVGHYHUHVR
pFRPSDUHFHU VH

WR GR HTXLOtEULR HQWUH DV SDUWHV QDWXUDOPHQWH R -Xt]R QmRFRPSDUHFHSRGHVHUSURFHVVDGDSRUGHVREHGLrQFLD 
$UELWUDO WDPEpP SRGH SUHFLVDU GH WHVWHPXQKDV RX GH R
pIDODU VHVHUHFXVDUDIDODUFRPHWHFULPHGHIDOVR

SHULWRVVHQmRGHFRQWDGRURXGHWUDGXWRURXLQWpUSUHWH WHVWHPXQKRHRpIDODUVRPHQWHDYHUGDGH VHPHQWLU

HQmRSRGHILFDUVHPDSURWHomRFRQWUDDHYHQWXDOIDOVLGD WDPEpPFRPHWHFULPHGHIDOVRWHVWHPXQKR 
GHGHVWHVSHUVRQDJHQV
6LJQLILFDTXHVHPSUHTXHDWHVWHPXQKDFRPSDUHFHUD
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
MXt]RRXHODIDODUiDYHUGDGH HQmRFRPHWHUiQHQKXP +DYHUiVVXERUQRTXDQGRDWHVWHPXQKD RXSHULWRRX
XERUQR
FULPH RXHOD DD PHQWLUiRX E
E VHQHJDUiDIDODUHP WUDGXWRU RX LQWpUSUHWH  DFHLWDU TXDOTXHU YDQWDJHP
TXDOTXHUGHVVDVGXDVKLSyWHVHVRQRPHGRFULPHVHUiR GLQKHLURHPSUHJRXWLOLGDGHVHWF SDUDSUDWLFDURIDOVR
PHVPR VHJXQGR R DUW&yG3HQDO WDO FULPH WHP R WHVWHPXQKR RX IDOVD SHUtFLD RX IDOVD WUDGXomR RX IDOVD
QRPHGHIDOVRWHVWHPXQKRRXIDOVDSHUtFLD HVVHDVSHFWRIRL LQWHUSUHWDomR
TXHVWLRQDGRQDVSURYDVGH3LUDVVXQXQJDHGH7DXEDWp 
0DV VmR GXDV H GLVWLQWDV DV FDXVDV GH H[DVSHUDomR
$WHQomR
$WHQomR QmRVHGHYHFRQIXQGLUWHVWHPXQKDFRPYtWL DXPHQWR GDSHQDDSDUGD  LQVSLUDomRPHUFHQiULDGR
PDRXDFXVDGR(VWDVSHVVRDVWDPEpPSUHV DJHQWH VXERUQR DSHQDVHUiWDPEpPDJUDYDGD  VH
WDPGHSRLPHQWRVPDVQmRWrPFRPSURPLVVR RIDOVRWHVWHPXQKRRXIDOVDSHUtFLDIRUSUDWLFDGDHP D
REULJDomR GHGL]HUDYHUGDGH$OLiVRUpXWHP SURFHVVRV SHQDLV RX E  HP SURFHVVRV FLYLV HP TXH D
DWpRGLUHLWRGHPHQWLUHPERUDVXDSDODYUD DGPLQLVWUDomRS~EOLFDVHMDSDUWH
VHMDSURYD FRQWUDRXDIDYRUGHOH 
2WH[WRDQWHULRUMiSUHYLDRDJUDYDPHQWRSDUDDPHQ
'DPHVPDIRUPDDOHLGLVSHQVDDYtWLPDGDREULJDomR WLUDSUDWLFDGDHPSURFHVVRSHQDOHVVHWLSRGHSURFHVVR
GH GL]HU D YHUGDGH 6XD SDODYUD p SURYD PDV VHPSUH WHP SRU REMHWR D OLEHUGDGH KXPDQD  H QDGD p PDLV
WRPDGDFRPDOJXPDGHVFRQILDQoDSRUTXHHOHFRPSUHHQ RGLRVRTXHDSURGXomRGHXPDLQMXVWLoDFRQGX]LQGRDR
VLYHOPHQWHSRGHHVWDUDIHWDGRSHORIDWRFULPLQRVR TXH FiUFHUHXPLQRFHQWHRXH[SRQGRYtWLPDHVRFLHGDGHVj
VRIUHX DVLWXDomRGHYtWLPDHVXDVGHFODUDo}HVIDOVDVIRL DEVROYLomRGHXPFXOSDGRVLWXDo}HVTXHSURYRFDUmR
REMHWR GH TXHVWmR HP FRQFXUVR S~EOLFR 3DWURFtQLR DLQGDXPGHVJDVWDQWHGHVSUHVWtJLRDR3RGHU-XGLFLiULR
3DXOLVWD  (LVDtUD]}HVVXILFLHQWHVSDUDRDXPHQWRGDSHQD

2XWUDTXHVWmRLQWHUHVVDQWHIRLIRUPXODGDHPSURYDGD 9HMDVHSRUWDQWRTXHDOHLQmRGLVWLQJXHVHDPHQWLUD
&RPDUFDGH6XPDUpLQGDJDQGRVHXPUpXSRGHULDPHQWLU IRL HP IDYRU RX FRQWUD R 5e8 %DVWD TXH WHQKD VLGR
QXPRXWURSURFHVVRHPTXHILJXUDYDFRPRWHVWHPXQKD SUDWLFDGDSDUDVXUWLUHIHLWRHPSURFHVVRSHQDOSDUDTXH
6DELGDPHQWHDFRQGLomRGHDOJXpPGHVHURUpXGiOKH R SUHVWDGRU GH IDOVR WHVWHPXQKR RX IDOVD SHUtFLD GHYD
RGLUHLWRGHPHQWLUDSHQDVQRSUySULRSURFHVVRHPTXHp VRIUHUXPDSXQLomRPDLRU
RUpX6HIRLDUURODGRFRPRWHVWHPXQKDHPRXWURSURFHV
VRWHUiDOLRGHYHUGHGL]HUDYHUGDGHFRPHWHUiFULPHGH 0DVDJUDQGHQRYLGDGHGDDOWHUDomROHJDOpDSURWHomR
IDOVRWHVWHPXQKRVHPHQWLUHVXDSHQDDLQGDVHUiDJUDYD FRQWUDDVPHQWLUDVTXHIRLGDGDDRVSURFHVVRVFLYLVHP
GDSRUVHUDPHQWLUDGHVWLQDGDjSURGXomRGHSURYDHP TXHDDGPLQLVWUDomRS~EOLFDVHMDSDUWH
SURFHVVRSHQDO
([SOLFDVHWDOWXWHODHVSHFLDODRIDWRGHTXHWDLV(QWLGD
DUW $V
$VSHQDV
SHQDVDXPHQWDPVH
DXPHQWDPVHGH GHXP
XPVH[WRDXP GHVSHUWHQFHPj)D]HQGD3~EOLFDHKiGHVHGDUXP
WHUoR
WHUoR VH
VH R FULPH
FULPH p SUDWLFDGR
SUDWLFDGR PHGLDQWH ]HOR HVSHFLDO QD GHIHVD GRV LQWHUHVVHV GR SDWULP{QLR
VXERUQR
VXERUQR RX VH FRPHWLGR FRP R ILP GH S~EOLFR
REWHU
REWHU SURYD
SURYD GHVWLQDGD
GHVWLQDGD D SURGX]LU
SURGX]LU HIHLWR
HP
HP SURFHVVR
SURFHVVR SHQDORXHPSURFHVVRFLYLO
SHQDORXHPSURFHVVRFLYLO +i GH VH OHPEUDU DTXL TXH $GPLQLVWUDomR 3~EOLFD
HP
HPTXH
TXHIRU
IRUSDUWH
SDUWHHQWLGDGH
HQWLGDGHGD
GDDGPLQLVWUD GLUHWD VmR WRGRV RV UJmRV H $JHQWHV GR *RYHUQR HP
omRS~EOLFDGLUHWDRXLQGLUHWD TXDOTXHUGDVUrVTXDWURHVIHUDVDGPLQLVWUDWLYDV8QLmR
2EV
2EV WHPUHGDomRGDGDS/HLQ2WH[WR
(VWDGRV'LVWULWR)HGHUDOH0XQLFtSLRV
DQWHULRUGLVSXQKD6HRFULPHpFRPHWLGRFRPRILPGH
REWHUSURYDGHVWLQDGDDSURGX]LUHIHLWRHPSURFHVVRSH (D$GPLQLVWUDomR3~EOLFDLQ
LQGLUHWDVmRDV$XWDUTXLDVDV
LQ
QDO3HQDUHFOXVmRGHGRLVDVHLVDQRVHPXOWD (PSUHVDV3~EOLFDVDV6RFLHGDGHVGH(FRQRPLD0LVWDHDV
)XQGDo}HV3~EOLFDVWRGDVFRPDXWRQRPLDDGPLQLVWUDWL
2 WH[WR DWXDO WHP UHGDomR VtPLOH j D GLVSRVLomR GR YDPDVHVWUXWXUDGDVQRGLQKHLURS~EOLFR
DQWHULRUGRDUWTXHSUHYLDTXH$VSHQDVDXPHQ
WDPVH GH XP WHUoR VH R FULPH p  SUDWLFDGR PHGLDQWH $VVLPHPTXDOTXHUKLSyWHVHVHDPHQWLUDVHGHUQXP
VXERUQR SURFHVVRFtYHOHPTXHD$GPLQLVWUDomR3~EOLFDGLUHWDRX
LQGLUHWDVHMDSDUWHWDOIDOVRWHVWHPXQKRRXIDOVDSHUtFLD
$QRYDUHGDomRpPDLVEUDQGDSUHYHQGRDJUDYDomRGH HWFDFDUUHWDUiSUHMXt]RDRSDWULP{QLRS~EOLFRUD]mR

 XPVH[WR DD XPWHUoR HQTXDQWRDH[DVSHUDomR EDVWDQWHSDUDTXHROHJLVODGRURSURWHMDGDLQG~VWULDGDV
DQWHULRUHUDLQIOH[LYHOPHQWHIL[DGHD XPWHUoR  IUDXGHVPHQWLUDVIDOFDWUXDVHRXWURVJROSHV

$VVLPVHDPHQWLUDSXUDHVLPSOHVMiQmRpWROHUDGD (DPHQWLUDHPSURFHVVRWUDEDOKLVWDRXSURFHVVRFtYHO
SHODOHLPHQRVDLQGDVHUiVHHODVHIRUSUDWLFDGDSRUTXH HQWUHSHVVRDVFRPXQV"$GLVFULPLQDomRH[SUHVVDGR D
DOJXpPSDJRX VXERUQRX RPHQWLURVRSDUDIDOWDUFRPD SURFHVVRSHQDOH E SURFHVVRFLYLOHPTXHDDGPLQLVWUD
YHUGDGHQRSURFHVVR6HPG~YLGDpPDLVRGLRVDDPHQWLUD omR S~EOLFD VHMD SDUWH  GHL[D FODUR TXH QmR KDYHUi
LQVSLUDGDQDFXSLGH]QRLQWHUHVVHSHODSHF~QLDDPHQWLUD DJUDYDPHQWRGDSHQDVHDPHQWLUDVHGHUHPRXWURWLSRGH
PHUFHQiULD SURFHVVR
 (FUHYHQWH7pFQLFR-XGLFLiULR7-6
7- 6mR3DXOR 'LU3HQDO 

,QVLVWDVH QD GLVWLQomR R IDOVR WHVWHPXQKR RX IDOVD 6HMiIRLSURIHULGDDVHQWHQoDHQWmRDUHWUDWDomRVHUi


SHUtFLD VHP VXERUQR  SUDWLFDGRV HP SURFHVVR FLYLO LQ~WLOHRGDQRGDPHQWLUDMiVHFRQVXPRXHSRULVVR
WUDEDOKLVWDRXDGPLQLVWUDWLYRVRIUHUiDVDQomRGRFDSXW QmRKiPDLVWHPSRSDUDDUHWUDWDomRHRPHQWLURVRVHUi
GRDUW&3HVHUiSXQLGRFRPUHFOXVmRGHXPDWUrV SXQLGRSHORFULPHGHIDOVRWHVWHPXQKR
DQRV

(VHPSUHTXHDIDOVLGDGHWLYHULQVSLUDomRPHUFHQiULD
VXERUQR HQWmRDSHQDVHUiDXPHQWDGDGH XPVH[WR &RUUXSomR$WLYDGH7HVWHPXQKDRX3HULWR
DD XPWHUoR 

,JXDODXPHQWRKDYHUiVHRIDOVRWHVWHPXQKRRXDIDOVD $UW 'DU


'DU RIHUHFHURXSURPHWHUGLQKHLURRXTXDO
RIHUHFHURXSURPHWHUGLQKHLURRXTXDO
SHUtFLDIRLSUDWLFDGRHPSURFHVVRFULPLQDORXHPSURFHVVR TXHU
TXHU RXWUD
RXWUD YDQWDJHP
YDQWDJHP D WHVWHPXQKD
WHVWHPXQKD SHULWR
FtYHOHPTXHD$GPLQLVWUDomR3~EOLFDILJXUHFRPRSDUWH FRQWDGRU
FRQWDGRU WUDGXWRU
WUDGXWRU RX
RX LQWpUSUHWH
LQWpUSUHWH SDUD
SDUD ID]HU
DWLYD DXWRUD RXSDVVLYD Up  DILUPDomR
DILUPDomRIDOVD
IDOVDQHJDU
QHJDURX
RXFDODUDYHUGDGHHP
GHSRLPHQWR
GHSRLPHQWR SHUtFLD
SHUtFLD FiOFXORV
FiOFXORV WUDGXo
WUDGXommR RX
DUW 2 IDWRGHL[DGHVHUSXQtYHOVHDQWHVGD LQWHUSUHWDomR
VHQWHQo
VHQWHQoD QRQR SURFHVVR
SURFHVVR HP
HP TXH
TXH RFRUUHX
RFRUUHX R
LOtFLWR
LOtFLWR R DJHQWH VH UHWUDWD RX GHFODUD D
3HQD
3HQD UHFOXVmRGHWUrVDTXDWURDQRVHPXOWD
YHUGDGH
YHUGDGH
2EV
2EV WHPUHGDomRGDGDS/HLQ GH 2WH[WR 2EV HVWHDUWLJRIRLPRGLILFDGRSHOD/HLQ$UHGDomRDQWHULRUGLVSXQKD
DQWHULRUGLVSXQKD2IDWRGHL[DGHVHUSXQtYHOVHDQWHVGDVHQWHQoDR 'DURIHUHFHURXSURPHWHUGLQKHLURRXTXDOTXHURXWUDYDQWDJHPDWHVWHPX
DJHQWHVHUHWUDWDRXGHFODUDDYHUGDGH QKDSHULWRWUDGXWRURXLQWpUSUHWHSDUDID]HUDILUPDomRIDOVDQHJDURXFDODU
D YHUGDGH HP GHSRLPHQWR SHUtFLD WUDGXomR RX LQWHUSUHWDomR DLQGD TXH D
RIHUWD RX SURPHVVD QmR VHMD DFHLWD 3HQD  UHFOXVmR GH XP D WUrV DQRV H
$DOWHUDomROHJLVODWLYDREULJDTXHDUHWUDWDomRVHGrQR PXOWD
PHVPRSURFHVVRHPTXHVHGHXDPHQWLUD
7UrVDOWHUDo}HVREVHUYDPVHQRQRYRWH[WRHPUHODomR
$QWLJDPHQWHRPHQWLURVRHUDFKDPDGRjSROtFLDHOiVH DR DQWHULRU   DFUHVFHXVH R FRQWDGRU FRPR DOYR GD
UHWUDWDYD GL]HQGR TXH KDYLD PHQWLGR H FRUULJLQGR VHX FRUUXSomR DWLYD   H[FOXLX D H[SUHVVmR DLQGD TXH D
GHSRLPHQWR  1HP VHPSUH R GHVPHQWLGR HUD OHYDGR DR RIHUWDRXSURPHVVDQmRVHMDDFHLWDH  DXPHQWRXVHR
SURFHVVRRTXHFDXVDYDWUDQVWRUQRVj-XVWLoDSRLVXPD TXDQWXPGDSHQDDQWHVGHDDQRVDJRUDGHD
GHFLVmRHUDSURIHULGDEDVHDQGRVHQDSURYDSURGX]LGDHP DQRV
-Xt]R HQTXDQWR QD 3ROtFLD RX QXP SURFHVVR FULPLQDO
ILFDYD XP GHVPHQWLGR 'LVVR GHFRUULDP PXLWDV Do}HV $LQFOXVmRGRFRQWDGRUGHQWUHRVSDVVtYHLVGDFRUUXSomR
UHVFLVyULDVSDUDDQXODUDTXHODDomRRQGHDVHQWHQoDIRUD SDVVLYD YLVD DSHQDV D GHFODUDU D LPSRUWkQFLD GH VHXV
LQVSLUDGDQDPHQWLUD FiOFXORVSDUDDVHJXUDQoDHVHULHGDGHGDDGPLQLVWUDomRGD
-XVWLoDHOLPLQDQGRVHGLVFXVVmRVREUHHVWDUHOHLQFOXVR
'RUDYDQWHRPHQWLURVRVyHVFDSDUiDSXQLomRVHVXD RX QmR QD H[SUHVVmR SHULWR YiOYXOD GH HVFDSH SDUD
UHWUDWDomR VH GHU QR PHVPtVVLPR SURFHVVR HP TXH HOH PXLWDVDEVROYLo}HV
WHVWHPXQKDIDOVDPHQWHRXIL]HUDIDOVDSHUtFLDHWF1mR
EDVWDUiSRUWDQWRTXHHOHVHUHWUDWHQRLQTXpULWRSROLFLDO $ H[FOXVmR GD H[SUHVVmR  DLQGD TXH D RIHUWD RX
QHPQDDomRSHQDO
SURPHVVDQmRVHMDDFHLWDQmRIRLPDLVTXHUHWLUDGDGH
XPWH[WRLQ~WLOVHSDUDDFRQGXWD MiEDVWDRIHUHFHURX
&RQWLQXDSRUpPDUHWUDWDomRVHQGRXPDFROKHUGH
DSHQDVSURPHWHUMiVHWLQKDGHVQHFHVViULRGLVSRUVREUH
FKiTXHDOHLGiDRVPHQWLURVRVDQWHVTXHVXDPHQWLUD
D DFHLWDomR RX UHFHELPHQWR GR VXERUQR SRLV HP WDLV
SURGX]DDOJXPGDQRFRUULMDDDWHPSRPDVQRSUySULR
SURFHVVRHPTXHPHQWLX KLSyWHVHVHVWiLPSOtFLWRTXHQmRKRXYHQHPRSDJDPHQWR
QHPDDFHLWDomR
6DELGDPHQWHRIDOVRWHVWHPXQKRVyYDLVHUGDQRVRj
$GPLQLVWUDomR GD -XVWLoD TXDQGR R -XL] GH 'LUHLWR IRU 3RUILPRDXPHQWRGDSHQDYLVDDPHOKRUSURWHJHUWDLV
MXOJDURFDVRRSRUWXQLGDGHHPTXHGHYHUiVHEDVHDU SURILVVLRQDLVHVXDFUHGLELOLGDGHDX[LOLDUHVGD-XVWLoDH
QDVSURYDVHQRGHSRLPHQWRIDOVR UHIOH[DPHQWHPDLVVHJXUDQoDjVGHFLV}HVTXHVHEDVHLHP
HPFiOFXORVFRQFOXV}HVSHULFLDLVWUDGXo}HVHWF
7UDWDVHHPYHUGDGHGHXPLQFHQWLYRGDOHLSDUDTXH
DYHUGDGHVHPSUHDIORUHHFRQWULEXDSDUDDUHDOL]DomRGD ~QLFR $V SHQDV DXPHQWDPVH GH XPVH[WRDXP
-XVWLoD  $VVLP VH DQWHV GD VHQWHQoD D SHVVRD UHVROYHU WHUoR
WHUoR VH
VH R FULPH
FULPH p FRPHWLGR
FRPHWLGR FRP
FRP R ILP GH
GL]HUDYHUGDGHHODSURFXUDUiRPHVPR-Xt]RGDFDXVDH REWHU
REWHU SURYD GHVWLQDGD D SURGX]LU HIHLWR HP
VHGLVSRUiDFRQWDUDYHUGDGHGHVID]HQGRDPHQWLUD6y SURFHVVR
SURFHVVRSHQDO
SHQDORX
RXHP
HPSURFHVVR
SURFHVVRFLYLO
FLYLOHP
HPTXH
TXHIRU
QHVVDKLSyWHVHILFDUiOLYUHGDSXQLomR SDUWH
SDUWHHQWLGDGH
HQWLGDGHGDGDDGPLQLVWUDomR
DGPLQLVWUDomRS~EOLFD
S~EOLFDGLUHWD
RXLQGLUHWD
RXLQGLUHWD
0DVPXLWDDWHQomRKiVGXDVSUHPLVVDVEiVLFDVRXVHMD 2EV
2EV HVWH~QLFRIRLPRGLILFDGRSHOD/HLQ GH $UHGDomR
 DUHWUDWDomRGHYHVHGDUSHUDQWHRPHVPtVVLPR-Xt]R DQWHULRUGLVSXQKD6HRFULPHpFRPHWLGRFRPRILPGHREWHUSURYDGHVWLQDGD
DSURGX]LUHIHLWRHPSURFHVVRSHQDODSOLFDVHDSHQDHPGREUR
HSURFHVVRHPTXHIRLIHLWRRIDOVRWHVWHPXQKRRXIDOVD
SHUtFLDHWFH  DUHWUDWDomRGHYHVHGDUDQWHVGHR-XL] $ DOWHUDomR GHVWH  ~QLFR p VLPLODU j GR   GR
SURIHULUVHQWHQoD DUW&3TXDQWRjLQFOXVmRFRPRFDXVDGHDXPHQWRGD
(VFUHYHQWH7pFQLFR-XGLFLiULR7-6
 '
LU3HQDO 7- 6mR3DXOR
SHQDGDKLSyWHVHGHDFRUUXSomRDWLYDGR$X[LOLDUGD (OHPHQWR6XEMHWLYR,QMXVWR
-XVWLoDKDYHUVHGDGRHPSURFHVVRFtYHOHPTXHIRUSDUWHD RGROR,QH[LVWHIRUPDFXOSRVD
DGPLQLVWUDomRS~EOLFDGLUHWDRXLQGLUHWD
$omR3HQDOS~EOLFDLQFRQGLFLRQDGD
$omR3HQDO
( WDPEpP DTXL VH DIURX[RX R DXPHQWR GD SHQD QR
WH[WR DQWHULRU R DXPHQWR HUD GH R GREUR GD SHQD H
DJRUDWmRVRPHQWHGH XPVH[WR DD XPWHUoR 
&RDomRQR&XUVRGR3URFHVVR
([SOLFDVHWDOWXWHODHVSHFLDOFRQWUDDFRUUXSomRDWLYDGH
$X[LOLDUHVGD-XVWLoDHPSURFHVVRVHPTXHD$GPLQLV
WUDomR3~EOLFD'LUHWDRX,QGLUHWDIRUSDUWHSHORIDWRGH $UW 8VDU
8VDUGH
GHYLROrQFLD
YLROrQFLDRX
RXJUDYH