Вы находитесь на странице: 1из 240

Elías Antonio Saca

Presidente de la República

Ana Vilma de Escobar


Vicepresidenta de la República

Darlyn Xiomara Meza


Ministra de Educación

José Luis Guzmán Carlos Benjamín Orozco


Viceministro de Educación Viceministro de Tecnología
37219
E49p El Salvador. Ministerio de Educación (MINED) Norma Carolina Ramírez
Programa de estudio quinto grado : educación básica / Ministerio Directora General de Educación
sv de Educación (MINED). -- 1a. ed. -- San Salvador, El Salv. :
Ministerio de Educación (MINED), 2009.
240 p. ; 28 cm. Ana Lorena de Varela
Plan Nacional de Educación 2021. Directora Nacional de Educación
ISBN 978-99923-63-02-7
Manuel Antonio Menjívar
1. Educación primaria-El Salvador--Programas. 2. Educación
primaria-Planes de estudio. 3. Currículo. I. Ministerio de Educación Gerente de Gestión Pedagógica
(MINED). II. Título.
Rosa Margarita Montalvo
Jefe de Unidad Académica
BINA/jmh

Equipos técnicos
Lenguaje Matemática Ciencia, Salud y Medio Ambiente Estudios Sociales Educación Física Educación Artística
Ernesto Antonio Esperanza Bernardo Gustavo Monterrosa Alex Wilfredo Canizález Carlos Benjamín Henríquez Jorge Alberto Marinero Asesoras externas
Evelyn Escobar Quijano Carlos Alberto Cabrera Ana Esperanza Elías Cristelina Henríquez de Villalta Asesores externos Ana Ruth Aragón
José Luis Segovia Gustavo Antonio Cerros Cristabel Dinorah Martínez René Alfredo Molina Martha Estrada Martha Elena Rosales
Karla Ivonne Méndez José Elías Coello Mario Eleazar Alvarenga Santos de Jesús Lucero Martha Eugenia Valle
Sandra Micaela Hernández Silvio Hernán Benavides
Oswaldo Efraín Hernández Vilma Calderón Soriano

Asesoras externas
Amanda de Franco
Celia Morán

ISBN 978-99923-63-02-7
© Copyright Ministerio de Educación de El Salvador, 2008
Derechos Reservados. Prohibida su venta. Esta publicación puede ser reproducida en todo o en parte,
reconociendo los derechos del Ministerio de Educación.
A las maestras y los maestros

En el marco de la implementación del Plan Nacional de Educación 2021, tenemos el placer de entregarles
la versión actualizada del Programa de estudio de quinto grado de Educación Básica. Su contenido es
coherente con nuestra orientación curricular constructivista, humanista y socialmente comprometida; al
mismo tiempo, incorpora la visión de desarrollar competencias, concretando así los planteamientos de la
política del currículo al servicio del aprendizaje.

Como parte de esta política se ha elaborado una propuesta curricular por competencias. También se han
diseñado libros de texto, cuadernos de ejercicios y guías metodológicas como ayuda a la labor de las
docentes y los docentes en su trabajo diario. Renovamos los lineamientos de evaluación de los aprendizajes
para hacer coherente la propuesta de competencias con el tipo de evaluación que necesitamos.

Todos estos instrumentos se entregarán junto con los programas de estudio, a fin de que cuenten con los
recursos necesarios para poner en marcha, con entusiasmo y responsabilidad, esta propuesta.

Este programa reúne el aporte de expertos en educación, especialistas de las diferentes áreas y las
experiencias de las maestras y los maestros que, han desarrollado experiencias innovadoras para
mejorar los procesos de enseñanza-aprendizaje en quinto grado.

De todas las recomendaciones y planteamientos formulados enfatizamos, en esta oportunidad, en un


solo aspecto: la importancia de tener altas expectativas en las niñas y los niños, comunicarles a ellas,
a ellos y a sus familias que son capaces de aprender y que, con constancia y esfuerzo, podrán alcanzar
grandes metas.

De la misma manera, externamos nuestra confianza en ustedes. Sabemos que leerán y analizarán este
programa con una actitud dispuesta a aprender, tomando en cuenta su experiencia y su formación
docente. Creemos en su compromiso con la misión que nos ha sido dada: que las niñas y los niños de
quinto grado tengan mejores logros de aprendizaje y puedan desarrollarse en forma integral.

Darlyn Xiomara Meza José Luis Guzmán


Ministra de Educación Viceministro de Educación
Competencias a desarrollar 100
ÍNDICE Bloques de contenido 101
Objetivos de quinto grado 106
Lineamientos metodológicos 106
Lineamientos de evaluación 108
Unidades 111

VI Estudios Sociales
Presentación de la asignatura 146
I Introducción Enfoque de la asignatura 146
Innovación de los programas de estudio 6 Competencias a desarrollar 146
Descripción gráfica del programa 10 Bloques de contenido 146
Objetivos de quinto grado 150
II Plan de estudio 12 Lineamientos metodológicos 150
III Lenguaje Lineamientos de evaluación 153
Presentación de la asignatura 14 Unidades 155
Enfoque de la asignatura 14
Competencias a desarrollar 14 VII Educación Artística
Bloques de contenido 15 Presentación de la asignatura 178
Objetivos de quinto grado 22 Enfoque de la asignatura 179
Lineamientos metodológicos 22 Competencias a desarrollar 179
Lineamientos de evaluación 24 Bloques de contenido 180
Unidades 27 Objetivos de quinto grado 183
Lineamientos metodológicos 183
IV Matemática Lineamientos de evaluación 185
Presentación de la asignatura 54 Unidades 188
Enfoque de la asignatura 54
Competencias a desarrollar 54 VIII Educación Física
Bloques de contenido 54 Presentación de la asignatura 220
Objetivos de quinto grado 59 Enfoque de la asignatura 220
Lineamientos metodológicos 60 Competencias a desarrollar 220
Lineamientos de evaluación 62 Bloques de contenido 220
Unidades 65 Objetivos de quinto grado 223
Lineamientos metodológicos 223
V Ciencias, Salud y Medio Ambiente Lineamientos de evaluación 226
Presentación de la asignatura 100 Unidades 227
Enfoque de la asignatura 100
I. Introducción al programa de estudio 3. El componente de metodología ofrece recomendaciones
de quinto grado específicas que perfilan secuencias didácticas por
asignatura, describiendo fases o etapas en orden
El programa de estudio de quinto grado de Educación Básica lógico en función de aprendizajes de competencias y
presenta una propuesta curricular que responde a las las recomendaciones generales. El programa actual no
interrogantes que maestras y maestros deben responderse presenta actividades sugeridas por unidad didáctica.
para poder planificar sus clases.
4. La evaluación se desarrolla por medio de sugerencias
Estas interrogantes tienen como respuestas los componentes y criterios aplicables a las funciones de la evaluación:
curriculares: diagnóstica, formativa y sumativa.
INTERROGANTES COMPONENTES CURRICULARES Finalmente, se presentan de manera articulada los objetivos,
contenidos e indicadores de logro por unidad didáctica en
¿Para qué enseñar? Competencias/Objetivos cuadros similares a los formatos de planificación de aula.
¿Qué deben aprender las Aunque desarrolle los componentes curriculares, el
niñas y los niños? Contenidos programa de estudio no resuelve situaciones particulares
de cada aula y cada estudiante, por lo tanto, se debe
¿Cómo enseñar? Orientaciones sobre metodología desarrollar de manera flexible y contextualizada.
¿Cómo, cuándo y Orientaciones sobre evaluación Para implementarlo se deberán realizar adecuaciones
qué evaluar? Indicadores de logro curriculares en función de las necesidades de las y los
estudiantes y las condiciones del contexto. Esta flexibilidad
Indicadores de logro es posible gracias al Proyecto Curricular de Centro (PCC)1,
en el que se registran los acuerdos que han tomado las y
El programa de estudio está diseñado a partir de estos los docentes de un centro escolar sobre los componentes
componentes curriculares. Se desarrollan en cada curriculares (objetivos, contenidos, metodología, evaluación),
asignatura en el siguiente orden: a partir de los resultados académicos del alumnado, de la
visión, la misión y el diagnóstico del centro escolar escrito
1. Descripción de las competencias y el enfoque que orienta en su Proyecto Educativo Institucional (PEI).
el desarrollo de cada asignatura.
Las maestras y los maestros deberán considerar los acuerdos
2. Presentación de los bloques de contenido que responden pedagógicos del PCC y la propuesta de los programas de
a los objetivos de la asignatura y permiten estructurar las estudio como insumos clave para su planificación didáctica.
unidades didácticas. Ambos instrumentos son complementarios.

1 Para mayor información, leer el apartado sobre Proyecto Curricular de Centro en el documento
Currículo al servicio del aprendizaje. Ministerio de Educación, San Salvador, 2007. 5
Programa de estudio de quinto grado
Innovación de los programas de estudio En cada asignatura se ha buscado mayor integración entre
los contenidos de los diferentes bloques, articulándolos
La experiencia de trabajar con los programas de estudio en función de las necesidades e intereses del alumnado.
anteriores es el primer referente para implementar esta Este esfuerzo ha requerido de una nueva organización
propuesta curricular. Sin embargo, es necesario advertir de las unidades didácticas, las cuales se presentan
que algunos aspectos de los componentes curriculares comparativamente con relación a las unidades didácticas
están presentados de diferente manera, u orientados hacia del programa de estudio anterior.
un énfasis nuevo. A continuación se detallan los cambios Tres tipos de contenidos:
más importantes.2 Conceptuales, procedimentales y actitudinales
Objetivos La relevancia de los contenidos se debe a su contribución
Se presentan los objetivos de grado por cada asignatura y al logro de los objetivos y, por lo tanto, de las competencias.
El autor español Antoni Zabala3 define los contenidos de la
luego en cada unidad didáctica.
siguiente manera:
Los objetivos están estructurados en función del logro de Conjunto de habilidades, actitudes y conocimientos
competencias, por ello se formulan con un verbo que orienta necesarios para el desarrollo de las competencias. Se pueden
una acción. Así se introduce la expectativa o meta a partir agrupar en tres grandes grupos según estén relacionados
de procedimientos. Posteriormente se enuncian también con el saber, saber hacer o el ser, es decir, los contenidos
conceptos y actitudes como parte del objetivo para articular conceptuales (hechos, conceptos y sistemas conceptuales),
los tres tipos de saberes. Al final se expresa “el para qué” o los contenidos procedimentales (habilidades, técnicas,
finalidad del aprendizaje, lo que conecta los contenidos con métodos, estrategias, etc.) y los contenidos actitudinales
la vida y las necesidades del alumnado. (actitudes, normas y valores).
Contenidos Los contenidos conceptuales, procedimentales y actitudinales
tienen la misma relevancia, ya que solo integrados
Presentación de bloques de contenido reflejan la importancia y la articulación del saber, saber
hacer, saber ser y convivir. El desafío es superar la
El programa de estudio presenta y describe los bloques
tendencia de “enseñar” únicamente información, es decir,
de contenido de cada asignatura. Con ello se propicia aprendizajes memorísticos.
mayor comprensión de la asignatura a partir de sus
fuentes disciplinares. Estos tienen su espacio y su importancia; sin embargo, es
necesario insistir en superar la concepción del aprendizaje
El reconocimiento de la importancia y la relación entre memorístico como un sinónimo de aprendizaje exitoso.
los contenidos fortalece el desarrollo curricular de El aprendizaje implica la articulación de los tres tipos
las asignaturas. de contenido.
2 Ministerio de Educación. (2007). Currículo al servicio del aprendizaje. San Salvador
6 3 Marco Curricular. Antoni Zabala. Documento de referencia de consultoría para el
Programa de estudio de quinto grado Ministerio de Educación, página 21
En el quinto grado, al igual que en los grados anteriores, se Los contenidos procedimentales no son nuevos en el
utiliza, en algunos casos, la palabra “noción” para precisar currículo, ya que la dimensión práctica o de aplicación
un contenido en la categoría de contenidos conceptuales. de los conceptos se ha venido potenciando desde hace
Las nociones refieren el conocimiento de las cosas por varias décadas. Sin embargo se ha denominado técnicas,
medio de los sentidos (la experiencia). Resultan de comparar habilidades, estrategias, algoritmos, etc. Al darles la
objetos, hechos o fenómenos para abstraer los elementos categoría de contenidos, los procedimientos “quedan
comunes que servirán para continuar estableciendo futuras sujetos a planificación y control, igual como se preparan
comparaciones. Estas comparaciones son elementales, es adecuadamente las actividades para asegurar la
decir, vinculadas a la percepción (sentidos) y a la acción. adquisición de los otros tipos de contenidos”5.
Por ejemplo: noción de equilibrio y desequilibrio personal
(Educación Física), noción de alimento y golosina (Ciencia, Por lo tanto, no deberán confundirse con metodología,
Salud y Medio Ambiente), noción de espacio (Estudios ya que aunque tienen puntos en común, los contenidos
Sociales), noción de peso y capacidad (Matemática), procedimentales “se deben aprender” desarrollando una
noción de adverbios de tiempo o de modo (Lenguaje). Con progresiva destreza en su aplicación, y la metodología
ello, se pretende señalar un saber menos estructurado es la forma, el proceso, para aprender cualquier tipo
que un concepto. de contenido.
La importancia de las nociones es que son la base para Los contenidos actitudinales deberán planificarse igual que
estructurar conceptos. Al presentarse en el programa de los otros contenidos. Tienen la misma importancia que los
estudio, la y el docente tendrá como expectativa de logro una conceptuales y los procedimentales, ya que las personas
idea muy elemental o poco estructurada sobre el contenido. competentes tienen conocimientos y los aplican con
Seguramente habrá una aplicación importante de la noción determinadas actitudes y valores.
en los contenidos procedimentales y actitudinales.
También merecen especial mención los contenidos
Secuenciación de contenidos
procedimentales por el riesgo de que se entiendan como La secuencia de contenidos presentada en los programas
metodología. César Coll los define de la siguiente manera:4 de estudio es una propuesta orientadora para ordenar el
Se trata siempre de determinadas y concretas formas de desarrollo de los contenidos, pero no es rígida. Es importante
actuar, cuya principal característica es que no se realizan de señalar que está fundamentada a partir de los principios
forma desordenada o arbitraria, sino de manera sistemática de las disciplinas, principios de psicología del desarrollo, la
y ordenada, unos pasos después de otros, y que dicha secuencia de enseñanza, etc. Por lo tanto su modificación
actuación se orienta hacia la consecución de una meta. debe ser analizada en forma cuidadosa.

4 Coll, C. y otros. (1992). Los contenidos en la reforma; Enseñanza y aprendizaje de


conceptos, procedimientos y actitudes. Editorial Santillana, Aula XXI, pág. 85. 7
5 Ibíd. pág. 103. Programa de estudio de quinto grado
Cuando se incluyan contenidos de grados superiores en variedad de situaciones, propiciando mayor motivación en
grados inferiores, o viceversa, deberá haber un acuerdo el aprendizaje. Además, hay más posibilidades de asignarle
en el Proyecto Curricular de Centro que lo respalde. Por el tiempo necesario al refuerzo académico, práctica que
ejemplo, si las niñas y los niños de un centro escolar llegan persigue dar un tratamiento oportuno a las y los estudiantes
a quinto grado con competencias lingüísticas avanzadas en que no alcanzan ni el nivel bajo esperado en los logros de
relación a la propuesta del programa de estudio, se deberá cada trimestre. Con unidades más pequeñas, saber a quién
realizar una evaluación diagnóstica y posteriormente hacer debo dedicarle más tiempo es posible. En las asignaturas
adecuaciones a los contenidos para atender el avance Educación Física y Educación Artística se mantienen tres
que presentan. unidades debido a la cantidad de contenidos posibles
a desarrollar en las horas de que disponen en el plan de
En algunas materias como Matemática o Lenguaje se estudio.
suele cometer el error de adelantar contenidos de grados
superiores, considerando que es conveniente para las niñas
y los niños, aunque los programas de estudio los presentan Lineamientos metodológicos
para grados superiores. Los resultados reflejan poca o difícil En el aspecto metodológico, se ha eliminado el apartado
comprensión (puede haber memorización), deficiencia en con la propuesta de actividades. Esto se debe a que se han
el aprendizaje de procedimientos, sensación de fracaso y diseñado guías metodológicas, libros de texto y cuadernos
aversión a la asignatura por parte del alumnado. de ejercicios completamente articulados con el currículo
Los programas actuales presentan una secuencia de actualizado. Por lo tanto, es posible prescindir de la
contenidos detallada para que las maestras y los maestros propuesta de actividades en los programas de estudio.
tengan claridad y tomen las mejores decisiones para sus Se ha incorporado un apartado con lineamientos
alumnas y alumnos. metodológicos que describe una propuesta de secuencia
didáctica que responde al enfoque de cada asignatura. Esta
Organización de objetivos y contenidos en unidades
puede ser mejorada por las y los docentes para ofrecer a
didácticas las niñas y los niños clases que faciliten el aprendizaje en
Las unidades didácticas se presentan en cuadros que función de competencias.
permiten apreciar de manera conjunta los objetivos, los
tres tipos de contenidos y los indicadores de logro de Lineamientos de evaluación
cada grado.
Una de las innovaciones más evidentes es la inclusión de
Se han organizado los contenidos en unidades didácticas indicadores de logro6, que son evidencias del desempeño
más pequeñas e interdisciplinares. Esto permite combinar esperado en relación con los objetivos y contenidos de cada
bloques de contenido y lograr mayor “interdisciplinariedad”. unidad. Su utilización para la evaluación de los aprendizajes
Unidades de menor duración contribuyen a comunicar más es muy importante debido a que señalan los desempeños

6 Para mayor información, leer el documento Evaluación al servicio de los aprendizajes.


8 Ministerio de Educación, San Salvador, 2007
Programa de estudio de quinto grado
que debe evidenciar el alumnado y que debe considerarse cada unidad didáctica. Por ejemplo, 2.1 indica que es el
en las actividades de evaluación y de refuerzo académico. indicador uno de la unidad 2, y el número 3.5 indica es el
Las unidades didácticas se presentan en cuadros que quinto indicador de la unidad 3. Esta enumeración facilitará
permiten ver de manera conjunta los objetivos, los tres tipos su referencia en el cuadro de registro de evaluación
de contenidos y los indicadores de logro de cada grado. sumativa.
Se debe recordar que la meta que se busca está reflejada
en los objetivos; los indicadores de logro son desempeños
Refuerzo académico
que demuestran su logro. Las y los docentes deben Se insiste en utilizar los resultados de la evaluación para
comprender el desempeño descrito en el indicador y apoyar los aprendizajes de las niñas y los niños. Por lo tanto,
hacer las adecuaciones que sean necesarias para atender los indicadores de logro deberán orientar al docente para
las diversas necesidades del alumnado. Sin embargo, prevenir la deserción y la repetición:
modificar un indicador implica un replanteamiento en los
contenidos (conceptuales, procedimentales y actitudinales), Al describir los desempeños básicos que se espera lograr
por lo tanto, se recomienda discutirlo con otros colegas del en un grado específico, los indicadores de logro permiten
centro y la directora o el director, y acordarlo en el Proyecto reconocer la calidad de lo aprendido, el modo como
Curricular de Centro. se aprendió y las dificultades que enfrentaron las y los
Se ha resaltado con letra negrita los indicadores más estudiantes. Así, se puede profundizar sobre las causas que
relevantes o abarcadores del trimestre. Se recomienda dificultan el aprendizaje, partiendo de que muchas veces
tomarlos como referente importante para las actividades no es descuido o incapacidad del alumnado.7
de evaluación que se reportan en los cuadros de registro y El seguimiento constante descrito en los indicadores
para programar refuerzo académico. significa ofrecer refuerzo académico oportuno a las niñas
El programa de estudio presenta los indicadores de y los niños que lo requieran, y hacer adecuaciones para
logro numerados de acuerdo a un orden correlativo por atender la diversidad.

7 Evaluación al servicio de los aprendizajes. Ministerio de Educación, San Salvador. 2007


9
Programa de estudio de quinto grado
Descripción gráfica del programa
El grado, número y nombre de unidad: describe los datos Los indicadores de logro son una muestra evidente de
generales de la unidad. que el alumnado está alcanzando los objetivos.
Tiempo asignado para la unidad: contiene el número de Los indicadores de logro priorizados: se refieren a los
horas asignadas a esa unidad. principales o más relevantes logros que se pretende
Objetivos de unidad: lo que se espera que alcancen las alcanzar en las y los estudiantes. Están destacados en
alumnas y los alumnos. negrita y son claves para la evaluación formativa y/o
sumativa.
Contenidos conceptuales, procedimentales y
actitudinales: incluyen los conceptos, procedimientos y
actitudes que las niñas y los niños deben adquirir como
parte del proceso de enseñanza-aprendizaje.

10
Programa de estudio de quinto grado
Objetivos de la Tiempo probable Grado, número y
unidad para la unidad nombre de la unidad

3FNIXMZSW 92-(%(
Þ 4VSHYGMVXI\XSWSVEPIWGSRIPETS]SHIKIWXSW]EHIQERIW]XI\XSWIWGVMXSWHIWXEGERHSPE
MQTSVXERGMEHIPPIRKYENIEJMRHIHIWEVVSPPEVPEGETEGMHEHGSQYRMGEXMZEIR
HMJIVIRXIWGSRXI\XSW
237'3192-'%137
Þ9XMPM^EVHMJIVIRXIWIWXVEXIKMEWTEVEPEGSQYRMGEGMzRSVEP]IWGVMXEVIGSRSGMIRHSPEW
WMQMPMXYHIW]HMJIVIRGMEWIRXVIIPPIRKYENISVEP]IWGVMXSIRPEWHMQIRWMSRIWIWTEGMEP]
XIQTSVEPGSRIPTVSTzWMXSHIPSKVEVGSLIVIRGME]GSVVIGGMzRIRPEI\TVIWMzR
Þ4EVXMGMTEV]IQMXMVSTMRMSRIWWSFVIXIQEWGSXMHMERSWIRHMZIVWEWWMXYEGMSRIW]GSRXI\XSW
VIGSRSGMIRHSPSWHMJIVIRXIWIPIQIRXSWHIPEGSQYRMGEGMzRTEVEVIEPM^EVYREIJIGXMZE
JYRGMzRGSQSVIGITXSVSIQMWSVHIPSWQIRWENIW 8MIQTSTVSFEFPILSVEWGPEWI

'328)2-(37 -2(-'%(36)7()03+63
'32')489%0)7 463')(-1)28%0)7 %'8-89(-2%0)7
  )WXVEXIKMEWTEVEPE   %TPMGEGMzRHIIWXVEXIKMEW   -RMGMEXMZEEPETPMGEV   %TPMGEGSRMRMGMEXMZEIWXVEXIKMEW
GSQYRMGEGMzRSVEP] TEVEPEGSQYRMGEGMzRSVEP IWXVEXIKMEWTEVEPE TEVEPEGSQYRMGEGMzRSVEP]
IWGVMXEXSQEHIETYRXIW] ]IWGVMXEGSQSPEXSQEHI GSQYRMGEGMzRSVEP IWGVMXEGSQSPEXSQEHIETYRXIW
WYPIGXYVEIRZS^EPXE ETYRXIW]WYPIGXYVEIR ]IWGVMXE ]WYPIGXYVEIRZS^EPXE
ZS^EPXE

  )PPIRKYENISVEP]IWGVMXS   6IGSRSGMQMIRXSHIPEW   -RXIVqWIRGSQYRMGEVWI   )\TVIWEPEHMJIVIRGMEIRXVI


WMQMPMXYHIW]HMJIVIRGMEW HIJSVQESVEP]IWGVMXE IPPIRKYENISVEP]IPIWGVMXS
IRXVIIPPIRKYENISVEP XSQERHSIRGYIRXEPE HIQSWXVERHSMRXIVqWIRPE
]IWGVMXSXSQERHSIR HMQIRWMzRIWTEGMEP HMQIRWMzRXIQTSVEP]IWTEGMEP
GYIRXEPEWHMQIRWMSRIW ]XIQTSVEP EPGSQYRMGEVWI
IWTEGMEP]XIQTSVEP


4VSKVEQEHIIWXYHMSHIUYMRXSKVEHS

Contenidos conceptuales Contenidos procedimentales Contenidos actitudinales Indicadores de logro


a desarrollar a desarrollar a desarrollar numerados

11
Programa de estudio de quinto grado
II. Plan de estudio de segundo ciclo Contribuyen a la formación integral del educando ya que
a través de ellos se consolida “una sociedad democrática
A partir de las cuarenta semanas laborales, el plan de impregnada de valores, de respeto a la persona y a la
estudio de quinto grado se organiza en seis asignaturas con naturaleza, constituyéndose en orientaciones educativas
carga horaria definida. El único cambio en el plan de estudio concretas a problemas y aspiraciones específicos del
es el incremento de una hora en la asignatura Matemática, país”8.
que tendrá cinco horas semanales, y la supresión de una
hora para el desarrollo curricular de Educación Física que Los ejes que el currículo salvadoreño presenta son:
contará con 3 horas semanales. Educación en derechos humanos
La asignatura de Educación Moral y Cívica no cuenta Educación ambiental
con carga horaria definida, debido a la coincidencia en
contenidos y objetivos con Estudios Sociales. Se recomienda Educación en población
acordar los aspectos específicos para su desarrollo en el
Proyecto Curricular de Centro, en función de las necesidades Educación preventiva integral
del diagnóstico y de la organización escolar. Educación para la igualdad de oportunidades
Se recomienda buscar relaciones entre los contenidos de
todas las asignaturas para organizar procesos integrados de Educación para la salud
aprendizaje. Los ejes transversales son contenidos básicos Educación del consumidor
que deben incluirse oportunamente en el desarrollo del plan
de estudio. Educación en valores
Grados y Número de horas
ASIGNATURA
horas semanales anuales por grado
4o 5o 6o 4o 5o 6o
Lenguaje 5 5 5 200 200 200
Matemática 5 5 5 200 200 200

Ciencia Salud y Medio Ambiente 5 5 5 200 200 200

Estudios Sociales 4 4 4 160 160 160

Educación Artística 3 3 3 120 120 120

Educación Física 3 3 3 120 120 120

Total 25 25 25 1000 1000 1000

8 Fundamentos Curriculares de la Educación Nacional. Ministerio de Educación,


12 pág. 115-116. El Salvador, 1999.
Programa de estudio de quinto grado
LENGUAJE
Presentación de la asignatura Enfoque de la asignatura: comunicativo
El programa de estudio de la asignatura Lenguaje para El enfoque que orienta las actividades de aprendizaje en
quinto grado se enfoca en el desarrollo de las capacidades la asignatura de Lenguaje es el comunicativo, cuya meta
que el y la estudiante necesita para comunicarse con su es que los estudiantes aprendan a comunicarse de forma
entorno. El dominio de estas capacidades supone aprender oral y escrita con eficacia y eficiencia en una variedad de
conceptos, dominar procedimientos y adoptar actitudes de situaciones comunicativas.
manera integrada. Esta articulación garantiza la adquisición
de las competencias esperadas. En consecuencia, la pertinencia de los contenidos
programáticos se determina a partir de la necesidad de
Para ello, se privilegian los contenidos que amplían las utilizarlos en la vida diaria.
habilidades de comprensión y expresión tanto oral como
escrita (leer, hablar, escuchar y escribir) que permiten a los Incluye no solo los conocimientos gramaticales, sino también
niños y niñas relacionarse eficientemente con los demás. los que se basan en los significados y el sentido derivado
del contexto y la situación comunicativa.
Con este propósito, el Ministerio de Educación ha definido
cuatro competencias básicas para esta asignatura: Además, es preciso recalcar que el uso de la lengua responde
expresión oral, expresión escrita, comprensión lectora y a un contexto determinado, una finalidad particular y a un
comprensión oral. destinatario específico.
Con esto se enfatiza la necesidad de orientar los aprendizajes Los relatos de experiencias, las cartas, las instrucciones de
hacia el logro de estas competencias. El dominio de estas juego o de uso de un aparato, las descripciones, etc., son el
habilidades es un aprendizaje que dura toda la vida y punto de partida de la enseñanza.
que implica un trabajo arduo, sostenido y gradual, que va Desde el enfoque comunicativo, los objetivos de la
construyendo al utilizar el lenguaje en situaciones reales asignatura se orientan a que el estudiante sea capaz de
de comunicación. saludar, comunicarse en una tienda, escribir una nota, dar
El programa promueve el uso de la lengua para relacionarse un recado en forma correcta, leer un anuncio y entenderlo,
con los compañeros y las compañeras, los docentes, los etc. En otras palabras, la asignatura pretende el desarrollo
padres de familia, los miembros de la comunidad y otros. de las competencias orales y escritas de los estudiantes,
En el segundo ciclo se propicia la lectura de diferentes quienes “utilizan el código” con finalidades comunicativas.
tipos de textos necesarios para la comunicación cotidiana y
literaria: textos informativos, descriptivos, narrativos, textos Competencias a desarrollar
de tradición oral, textos argumentativos, textos dramáticos
y poéticos, textos instruccionales y textos icono-verbales. Las competencias definidas por el MINED para la asignatura
de Lenguaje son las siguientes:
Esta propuesta señala el aprendizaje de la gramática y la
ortografía desde su utilidad en la vida cotidiana. Por lo tanto, a. Comprensión oral. Es la capacidad de utilizar todo tipo
se estudian a partir de textos producidos en situaciones de de recursos para comprender información oral, que
la comunicación oral o escrita. se presenta con distintos propósitos y en diferentes
situaciones comunicativas.

14
Programa de estudio de quinto grado
b. Expresión oral. Esta competencia, al igual que Es importante destacar que la intención del bloque no es
la comprensión oral, se enmarca en situaciones mostrar una tipología textual sino, enfocar el estudio de los
comunicativas, en las cuales el educando expresa de textos a partir de los criterios de función y estructura.
forma oral sus deseos, intereses, experiencias, ideas,
entre otros, con un propósito determinado. En el segundo ciclo se continúa con los diversos tipos de
texto estudiados en el primer ciclo, sin embargo, se muestran
c. Compresión lectora. Esta competencia implica la algunos con un mayor nivel de profundización, entre ellos:
comprensión y la construcción del sentido de textos los narrativos incluyendo diferentes tipos de cuento y la
escritos. En este proceso el lector se ve enfrentado a novela, los poéticos incorporando figuras literarias, los
una situación comunicativa en la que pone en juego sus textos teatrales y los textos argumentativos y explicativos o
conocimientos y estrategias cognitivas y metacognitivas, de información científica.
pues su interlocutor no puede ser interrogado de manera
directa, sino a través de las pistas y convenciones que Comunicación oral y escrita
estructuran los diferentes tipos de texto.
a. Estrategias de comprensión y expresión oral
d. Expresión escrita. Esta capacidad permite establecer En este bloque de contenidos se agrupa una variedad
comunicación por medio de la escritura. Al igual que de aspectos relacionados con la compleja actividad de
las otras competencias, implica adecuarse al contexto la comunicación humana. Nos referimos a prácticas
comunicativo, al lector (destinatario). Escribir no discursivas orales, que contribuyen a la comprensión y a la
solo requiere el conocimiento del código (sistema de producción de una variedad de textos funcionales (de uso
escritura) sino también del uso de estrategias, técnicas y
principios convencionales, que implican saber planificar cotidiano, académico y formal).
un discurso, y construirlo con adecuación, coherencia y Aquí, se evidencia el uso de la lengua, es decir, se manifiestan
cohesión textual. aquellos contenidos que promueven el desarrollo de
habilidades para una comprensión de los textos orales,
Bloques de contenido así como la adecuación del lenguaje, del tono de voz, del
vocabulario, etc. cuando se está en determinada situación
Tipología textual comunicativa y que responde a un contexto en particular.
Se incluyen contenidos vinculados a diferentes formas de
Se entiende por texto cualquier manifestación oral o escrita expresión oral, como debates, exposiciones, entre otros.
con significado, que se produzca en una comunicación. Por
tanto, son textos los escritos de literatura, las redacciones b. Estrategias de comprensión y producción de textos
de los alumnos, las exposiciones del profesor de lengua y Presenta el aprendizaje de técnicas y estrategias que
de matemática, los diálogos, las noticias, los afiches. ayuden al estudiante a comprender los textos que lee;
Los textos pueden ser orales o escritos, literarios o no asimismo, a producir textos escritos con base en modelos
(Cassany, Daniel). y procedimientos que ordenen el pensamiento a partir de
una situación comunicativa.

15
Programa de estudio de quinto grado
En primera instancia, la comprensión de textos se aborda a promueve que la producción escrita esté encaminada en dos
partir de cinco niveles de comprensión lectora: direcciones: hacia los textos de uso cotidiano y funcional y
a. Nivel de comprensión literal hacia los textos literarios, con la seguridad que cada uno de
ellos tienen diferentes finalidades y desarrollan diferentes
En este nivel, la persona lectora se da cuenta de las ideas habilidades. Así, cuando un estudiante se enfrenta a la
explícitas del texto. El o la docente busca verificar que se tarea de escribir textos es capaz de:
haya comprendido el mensaje tal como se expresa en el
texto. Diferentes textos Textos literarios
b. Nivel de comprensión inferencial cotidianos y funcionales (Con intención literaria)
Se trabaja sobre lo que se encuentra implícito en el Hacer de la escritura un
texto para que los niños o las niñas puedan hacer sus Animar a la creación escrita.
propias deducciones. La construcción de sus conjeturas hábito.
o hipótesis tienen como base su propia experiencia.
Alternar actividades de lectura
c. Nivel de comprensión crítica Desarrollar la imaginación.
y escritura.
Se orienta para que se emitan juicios valorativos acerca
del texto a partir de la comprensión literal. En otras Experimentar con la
Comprender el lenguaje literario.
palabras, se pretende que contrapongan lo expresado producción de “libros”.
en el texto con sus propios criterios.
d. Nivel de comprensión apreciativa Desarrollar una forma Relacionar textos con otros
personal de expresión. significativos (los que el niño
Consiste en expresar las impresiones personales sobre conoce)
el texto, lo cual permite saber el grado de impacto del
sentido estético; es decir, se trata de motivar la sensibilidad Desarrollar los diferentes
de los niños y niñas. momentos en la producción Descubrir significados e interpretar
e. Nivel de comprensión creadora de un texto: planificación, el sentido de los textos.
escritura, revisión y edición.
Este nivel consiste en dar sus aportaciones y hacer
propuestas a partir de lo que se lee. Las posibilidades Reflexión sobre la lengua
de creación son infinitas y diversas: pueden ir desde
reescritura, escritura a partir de modelos o la producción Este bloque de contenidos está orientado al estudio de
escrita totalmente nueva. la lengua como sistema de comunicación. El análisis
morfológico, sintáctico, semántico y textual, así como el
Como segundo punto, la producción escrita como eje empleo de las diversas estructuras del idioma, de acuerdo
importante para el desarrollo de las competencias con la norma gramatical, constituyen el objeto de aprendizaje
comunicativas tiene gran valor en este ciclo. Por ello, se en esta parte muy significativa del programa.

16
Programa de estudio de quinto grado
En este bloque se ha incorporado la gramática del texto, La selección de las muestras responde a criterios específicos
también conocida como lingüística textual, ya que es como los siguientes: a) valor representativo de la época
imperioso que el alumno aprenda a generar discursos o movimiento literario, b) valor representativo de los
cuidando el uso pertinente de todas sus propiedades, esquemas discursivos; c) valor representativo cultural,
como son la cohesión, la coherencia, la adecuación y por cuanto modelan la realidad en un tiempo y espacio
la corrección. determinados; d) valor estético, vinculado éste con la
capacidad del texto para generar una disposición afectiva-
Comunicación literaria emotiva del alumno; e) valor didáctico, que se establece,
en primer lugar por ser una muestra auténtica de arte
Se entiende como un acercamiento vivencial a la literatura universal, y, en segundo lugar, por su carácter diversificado
infanto - juvenil que tiene principalmente tres propósitos: (debido a la ubicación espacio-temporal, la pertenencia a
1. Despertar el gusto estético y la afición por la lectura de corrientes artísticas diversas, y a sus diferentes grados de
textos literarios. Esto se consigue con hábitos de lectura facilidad o dificultad de lectura); y, f) valor comunicativo,
y con el contacto continuo con diferentes textos. porque muestran todas las virtualidades presentes en una
situación comunicativa real o imaginaria.
2. Utilizar los textos literarios con una finalidad didáctica; es
decir, aprovechar la diversidad lingüística que aparece Los textos mencionados en el programa son lecturas
en ellos para relacionarlos con los otros bloques de obligatorias mínimas, las cuales deberán ser completas
contenido. En otras palabras, los diversos tipos de textos y auténticas, lo que implica no hacerlas con muestras
literarios (cuentos, poemas, leyendas, rondas, canciones, que hayan sido adaptadas. Los docentes de aula pueden
adivinanzas, trabalenguas y otros) se convierten en el ampliar este canon, si cuentan con los factores favorables
punto de partida para el desarrollo de las competencias para ello, introduciendo lecturas completas de otras obras
lingüísticas, para el desarrollo de nociones gramaticales representativas, según lo crean conveniente.
y para el ejercicio de la escritura creativa, en sus Los libros establecidos para quinto grado son:
diferentes formas.
Mitología de Cuscatlán (Miguel Angel Espino)
3. Conocer algunos elementos básicos del lenguaje
literario y de la estructura textual que permiten que la Poesía completa (Claudia Lars)
lectura sea de manera comprensiva, al mismo tiempo
Cuentos de mi Tía Panchita (Carmen Lyra)
que los estudiantes van desarrollando de forma gradual,
habilidades básicas que les permiten la construcción Corazón (Edmundo de Amicis)
del sentido de lo que leen a partir de sus experiencias
personales y lectoras. Las aventuras de Tom Sawyer (Mark Twain)
Por esta última razón, en este ciclo, se incluyen en algunas
unidades el canon literario básico. Su inclusión obedece a Relación entre bloques de contenido y las
la intención de proporcionar un canon mínimo de lecturas unidades didácticas
completas que respondan al desarrollo formativo del
estudiante en cuanto a los saberes necesarios para el logro El programa de estudio de quinto grado se ha estructurado
de la competencia literaria. en nueve unidades didácticas. Tener mayor número de
17
Programa de estudio de quinto grado
unidades no supone un incremento significativo en el número experiencias, necesidades e intereses de las niñas y
de contenidos, sino una reestructuración alrededor de ejes los niños. Así, se inicia el programa con la unidad Nos
que le otorgan mayor sentido al aprendizaje, en función de conocemos, que sitúa los contenidos alrededor de las
criterios pedagógicos sobre la enseñanza y aprendizaje de experiencias comunicativas que suelen suceder al inicio
los contenidos. del año escolar, incluyendo las normas de convivencia y las
fórmulas sociales de tratamiento que ayudan a establecer
A continuación, se presentan las razones más relevantes de
buenas relaciones de interacción y de trabajo en el aula.
la nueva estructuración de unidades.
La segmentación en unidades más cortas evidencia de
Una estructura curricular con unidades más cortas facilita
mejor manera la integración de los diferentes bloques
el seguimiento del aprendizaje de los contenidos y la
de contenido de forma más ordenada y armónica. Por
planificación de más periodos de retroalimentación al inicio
ejemplo, la literatura está articulada con las estrategias de
y al final de cada unidad.
comprensión y producción oral y escrita, con la reflexión
Un mayor número de unidades permite definir más sobre la lengua y los demás bloques.
ejes temáticos que articulan los contenidos a partir de

El siguiente cuadro muestra los nombres de las unidades didácticas del programa anterior y del nuevo programa de estudio
y su relación con los bloques de contenido.
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 1: Hablemos de lo nuestro Unidad 1: Nos comunicamos Bloques dde contenido


Bl t id
Se enfatiza en el desarrollo de la expresión oral de Comprende estrategias para la comunicación oral Comunicación oral y escrita
ideas, sentimientos y acontecimientos, así como de y escrita: toma de apuntes y lee en voz alta. Reflexión sobre la lengua
la escucha atenta de lo que dicen los demás, para
Así como el lenguaje oral y escrito. Tipología textual
reforzar las habilidades comunicativas.
Identificando los elementos de la comunicación:
emisor, receptor, código, canal, interferencias.
Haciendo uso de los gestos y ademanes como
apoyo del lenguaje oral.

18
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 1: Hablemos de lo nuestro Unidad 2: Recordemos Bloques de contenido


Conocimiento y utilización de estrategias de Comunicación oral y escrita
lectura y escritura para mejorar la comprensión Tipología textual
lectora y la producción de textos.

Unidad 3: Describamos y narremos

En esta unidad se estudia la estructura y los Comunicación oral y escrita


elementos de diferentes textos narrativos como Reflexión sobre la lengua
los cuentos de ciencia ficción y de aventuras, los
mitos; además de textos descriptivos como la Tipología textual
crinografía y cronografía con la intención de que Comunicación literaria
las y los estudiantes no solamente los lean, sino
también los produzcan.
También se estudian aspectos gramaticales y
ortográficos.

Unidad 2: Expresemos lo que pensamos Unidad 4: Actuemos


Esta unidad se centra en los aprendizajes de Se estudia el texto dramático con su estructura Comunicación oral y escrita
carácter instrumental en cuanto al uso del idioma interna y externa, relacionando los signos más Reflexión sobre la lengua
en su forma oral y escrita, por lo que comprende utilizados en este tipo de texto como: la raya
conocimientos de teoría gramatical, ortografía y o guión largo, los signos de exclamación e Tipología textual
aspectos prácticos relacionados con la elaboración interrogación. Comunicación literaria
de textos.

19
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad
U id d 2:
2 Expresemos
E lo
l que pensamos Unidad
U id d 5:
5 Sigamos
Si iinstrucciones
t i Bloques de contenido
En esta unidad se estudia la estructura Comunicación oral y escrita
y elaboración de textos instruccionales Reflexión sobre la lengua
diversos como: instrucciones para
experimentos sencillos y manualidades. Tipología textual
En relación con estos textos, se ven
contenidos gramaticales y ortográficos.

Unidad 6: De verso en verso


Se leen, memorizan y declaman poemas Comunicación literaria
con la dicción y entonación correctas y
Comunicación oral y escrita
también se estudia la estructura de los
mismos para conocerlos mejor y poder Reflexión sobre la lengua
escribir algunos, como parte de la propia Tipología textual
creación.
El conocimiento y uso figuras literarias
como la anáfora, símil, metáfora y
personificación , así como contenidos
gramaticales y de ortografía.

Unidad 3: Disfrutemos de la lectura Unidad 7: Imágenes con significado


Con esta unidad se pretende lograr la lectura, la Esta unidad tiene como objetivo estudiar Comunicación oral y escrita
comprensión, la escritura y el análisis de diferentes y reconocer los textos icono-verbales y no
tipos de textos literarios y no literarios, aplicando Reflexión sobre la lengua
verbales.
técnicas elementales de comprensión lectora. Tipología textual

20
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 3: Disfrutemos de la lectura Unidad


U id d 7:
7 Imágenes
I á con significado
i ifi d Bloques de contenido
También comprende la interpretación
y producción de caricaturas, señales
de tránsito y afiches. También las
palabras homófonas, los antónimos y los
pronombres.

Unidad 8: Nos informamos

Esta unidad enfatiza la comprensión y la Comunicación oral y escrita


elaboración de textos informativos, así Reflexión sobre la lengua
como la identificación de párrafos, con su
respectiva idea principal. Tipología textual
También se estudian algunos conectores,
así como temas ortográficos.

Unidad 9: Argumentamos
Se aborda principalmente el texto Comunicación oral y escrita
argumentativo y los tipos de conectores Reflexión sobre la lengua
utilizados en él, además de algunos
contenidos ortográficos. Tipología textual
Comunicación literaria

21
Programa de estudio de quinto grado
Objetivos de quinto grado o procesos de una clase, atendiendo a un orden lógico.
Estas etapas tienen correspondencia con las lecciones
1. Producir textos breves con intención literaria, acordes al propuestas en el libro de texto y la guía metodológica que
nivel y grado a partir de la lectura de textos narrativos, el Ministerio de Educación ha entregado para apoyar el
poéticos y dramáticos, valorando oralmente las desarrollo curricular de quinto grado.
situaciones comunicativas imaginarias y reales presentes
en ellos; construyendo, además, los significados de La secuencia propuesta no debe concebirse como un
estos con el fin de desarrollar habilidades para analizar obstáculo para la creatividad e iniciativa de los docentes; más
críticamente cualquier tipo de texto oral o escrito. bien puede mejorarse con su experiencia y adecuarse a las
condiciones específicas del aula, los recursos tecnológicos
2. Elaborar diferentes clases de textos orales y escritos y otros materiales con los que cuenta la escuela.
relacionados con textos descriptivos, informativos,
argumentativos: el informe escolar, la noticia, la entrevista, Se proponen cinco momentos fundamentales que tienen
el volante, el debate, la mesa redonda, el foro, entre otros, opciones de desarrollo con matices diferentes de acuerdo
tomando en cuenta los elementos de la comunicación, a la competencia que prevalece o al tipo de texto que se
para acomodarlos a una situación de vivencia cotidiana, trabaje. La secuencia no responde a una hora clase, sino
definida con anterioridad, cuidando las estructuras de al proceso de enseñanza aprendizaje de un conjunto de
cada uno, sus características particulares a partir de la contenidos. No se espera cumplir los cinco pasos en una
coherencia y corrección gramatical. hora clase; se recomiendan al menos dos horas para
completar la secuencia. Pero este tiempo puede variar
3. Participar activamente en situaciones comunicativas de debido a la dificultad de los contenidos o a los diferentes
su entorno, por medio de la expresión y comprensión ritmos y necesidades de los estudiantes.
oral y la participación en dramatizaciones al expresar
sus ideas, necesidades y sentimientos, así como sus Los pasos de la secuencia son:
opiniones sobre los textos que lee y escucha, haciéndolo
con claridad, espontaneidad y respeto, a fin de satisfacer 1. Verificación y valoración de los saberes previos.
diferentes necesidades de comunicación con armonía y Al inicio de la clase se debe valorar los saberes sobre
confianza en diversos contextos. la lengua que ya poseen y que son básicos para el
aprendizaje de los conceptos y el conocimiento de los
Lineamientos metodológicos textos.Es importante reconocer que niños y niñas ya han
tenido diferentes experiencias con los textos, las cuales
Las clases deben ofrecer una experiencia significativa son importantes para la comprensión y producción de la
para las niñas y los niños, que les permita practicar su comunicación escrita.
comprensión y expresión oral y escrita por medio de la
participación en una situación comunicativa, de la lectura de 2. Comprensión de la situación comunicativa y/o del texto.
textos, de la observación de ilustraciones o imágenes, etc. En esta fase se pueden identificar varios momentos:
Esta experiencia debe estar relacionada con sus intereses,
necesidades y los contenidos a desarrollar. a. Acercamiento al texto.
Para orientar el desarrollo metodológico de los contenidos, Escrito a través de estrategias de comprensión, como
se propone una secuencia didáctica que describe las etapas por ejemplo, las predicciones. El docente orienta a los y

22
Programa de estudio de quinto grado
las estudiantes para que “adivinen”, hagan hipótesis o gramaticales y ortográficos, tales como: los sustantivos; los
predigan su contenido a partir de las ilustraciones, el título adjetivos; el verbo en presente, pasado y futuro; la oración
o las primeras líneas del texto. simple y su estructura de sujeto y predicado; las oraciones
b. Lectura por parte del docente o de los estudiantes. afirmativas y negativas; el uso de ‘ción’ y ‘sión’ y otros.
Atendiendo el nivel de avance que tengan los niños y niñas, 4. Resolución de situaciones comunicativas.
la o el docente podrá leerles en voz alta o planificar lectura Es prioritario verificar que el alumnado puede integrar
grupal o independiente. Durante la lectura la maestra o sus nuevos conocimientos en las diversas situaciones
maestro debe intercalar pausas para que los niños y las comunicativas que se le presenten y que evidencie el
niñas comenten si acertaron en sus predicciones y generen dominio de los saberes adquiridos de una forma integrada.
nuevas. Las situaciones comunicativas pueden ser: hacer un
Las modalidades de lectura deben ser variadas, algunas comentario oral, sostener un diálogo, escribir una carta,
de estas son: una receta (de acuerdo al texto estudiado), interpretar el
mensaje de una secuencia de dibujos, seguir instrucciones
Lectura en voz alta para realizar una actividad, etc.
Lectura compartida El programa de estudio presenta los contenidos sobre
Lectura independiente el código escrito, los tipos de texto, las situaciones
comunicativas, y los contenidos gramaticales, de manera
Lectura guiada integrada, en las unidades didácticas.
Lectura modelada El trabajo docente en esta asignatura, a partir de esta
c. Actividades orales o escritas para corroborar la comprensión. secuencia o de otra que el docente estructure, siempre
deberá prestar especial atención a los principios generales
Por medio de preguntas, dibujos, comentarios, juegos, etc. de enseñanza y aprendizaje:
En este apartado es importante fomentar la expresión oral
de los niños y las niñas. También se incluyen preguntas de Conocimientos previos
comprensión literal, apreciativa e inferencial para ampliar
y enriquecer la comprensión de los textos. Se debe reconocer que las y los alumnos presentan
diferentes niveles en su desarrollo lingüístico a partir de
3. Reflexión sobre la lengua. sus características individuales y de las interacciones que
En este apartado, se partirá de los textos leídos y tienen con las personas que los rodean. Por ejemplo, el
comentados para estudiar las diferentes nociones y primer hijo o hija de una familia tiene menos interacciones
conceptos gramaticales correspondientes al grado. El comunicativas que el segundo, y por eso solemos escuchar
alumnado realiza diversos ejercicios orales y escritos que “el segundo hijo es más listo que el primero”. También
que refuerzan el aprendizaje de palabras y oraciones difieren la cantidad y calidad de experiencias con textos
completas, descomposición silábica, composición de otras escritos: unos estarán familiarizados con ellos desde edades
palabras, ampliación del vocabulario y análisis de aspectos tempranas y otros podrán carecer de estos contactos.

23
Programa de estudio de quinto grado
Atención a la diversidad Modelaje docente
Hay que tener en cuenta que no todos los niños y niñas El clima comunicativo del aula debe contar con la
aprenden de la misma manera ni al mismo ritmo. Esto participación activa de la y el docente en su calidad de
obliga a la y el docente a implementar diversas estrategias hablante y oyente, así como de lector y escritor de mensajes.
didácticas, con el fin de dar una respuesta que permita Por tanto su comportamiento lingüístico debe ser un modelo
atender de forma adecuada a la diversidad. para sus estudiantes. Para ello, es necesario estar prevenido
La diversidad también incluye el uso diferente de la lengua. en relación con los términos y expresiones que se dicen,
En un aula puede haber alumnos de origen rural y urbano, de manera que cumplan con las propiedades textuales de
así como de diferente estrato social y económico. En este corrección, coherencia, cohesión y adecuación. Hay que
caso, no es recomendable que el y la docente intervenga ser bastante consciente de que no se les puede pedir a los
como un corrector del uso gramatical. Su actitud ante estudiantes lo que no se les da.
hechos comunicativos en los que intervengan dos niveles de Desarrollo de ejes transversales
lengua distintos será la de usar los términos de adecuado o
inadecuado, de acuerdo al contexto específico de acción. El Currículo Nacional establece ocho ejes transversales que
deben desarrollarse dentro de las asignaturas. En el caso
El aula como situación comunicativa
de Lenguaje, estos temas se pueden abordar por el uso de
El aula de clase es el contexto adecuado para fomentar diversos textos, como recursos didácticos y como objetos
la adquisición de las capacidades comunicativas. Es el de estudio. Para ello, el y la docente ha de estar alerta ante
contexto social por excelencia en donde el hecho de la la posibilidad de seleccionar estos textos; por ejemplo: en
convivencia debe propiciar la necesidad de comunicarse. el mes de enero, se pueden aprovechar los textos que se
De esta manera, el docente empleará metodologías que publican en los diarios antes, durante o después del día 16,
favorezcan la cooperación y la participación de las y los para reflexionar sobre la importancia de la paz, los valores
alumnos, dialogando con ellos y proponiendo actividades cívicos o los derechos humanos. O sobre temas de medio
en las cuales la interacción constante sea la forma de
afianzar los aprendizajes. ambiente, equidad de género, etc.

El alumno como protagonista Lineamientos de evaluación


El aprendizaje de la lengua es una actividad que involucra,
de manera especial, al alumnado. A hablar se aprende En cuanto a la evaluación, debe abandonarse la idea de
hablando; a escribir, escribiendo. Implica la adquisición que el o la maestra es el juez de los resultados obtenidos
de las capacidades comunicativas y de la lengua en por las y los alumnos, y la única autoridad en el saber. Por
situaciones de uso. Entonces, las actividades de el contrario, la y el docente debe pensarse a sí mismo como
aprendizaje deberán estimular la curiosidad, la reflexión creador de situaciones de aprendizaje, un profesional
y la creatividad de las y los estudiantes para que puedan capaz de criticar su propia práctica en el aula y, sobre todo,
resolver las situaciones comunicativas en forma autónoma ser respetuoso y orientador del proceso de aprendizaje de
y autodirigida. cada niño y niña.

24
Programa de estudio de quinto grado
La evaluación ya no se concibe como el resultado de un actividades específicas que refuercen este conocimiento
juicio unilateral de resultados que decide quién aprueba y destreza.
y quién no. La evaluación al servicio del aprendizaje
debe mostrar los aciertos y desaciertos que ocurren en el La evaluación formativa se apoya en la observación
proceso de enseñanza para tomar decisiones: cambiar sistemática durante la clase para detectar las necesidades,
métodos, buscar más recursos, diseñar planes de refuerzo habilidades y dificultades de cada uno de sus alumnos y
académico, etc. alumnas; también son muy útiles las preguntas orales ya
que permiten conocer lo que un estudiante piensa sobre el
Para que la evaluación sea integral, flexible y útil deberá contenido o sobre la actividad. Al indagar las razones de
cumplir, al menos las siguientes funciones: su conducta se puede identificar el tipo de ayuda o medida
que necesita para mejorar su aprendizaje.
Evaluación diagnóstica
La autoevaluación y coevaluación posibilita a las y los
El profesor o profesora, por medio de diversas técnicas estudiantes exponer, compartir resultados y procedimientos
como la elaboración de dibujos, la formulación de preguntas realizados, valorar el trabajo en equipo, expresando cómo
exploratorias, las lecturas de textos, las descripciones o se sintieron, qué hicieron bien y qué cosas deben mejorar
las explicaciones previas, obtendrá el conocimiento y las en actividades futuras.
habilidades que poseen los estudiantes al inicio del año
escolar y al iniciar nuevos contenidos. Este tipo de evaluación también propicia la observación y el
registro de actitudes referidas a la seguridad, la autonomía,
Se debe diagnosticar también los procedimientos que son el interés, el respeto, la participación, el trabajo en equipo,
capaces de hacer mediante tareas específicas, por ejemplo: etc., para fortalecer su vivencia y desarrollo.
clasificar correctamente algunas palabras de acuerdo a
“cómo suenan” al principio o al final de un poema, contar Evaluación sumativa
cuentos que ha escuchado, describir personas, animales y La evaluación sumativa certifica y asigna una nota a la
objetos, escribir pequeños textos, etc. calidad del desempeño de una actuación del estudiante.
La evaluación diagnóstica debe permitir planificar y adecuar Se deben seleccionar actividades de evaluación similares
la clase en función de las necesidades y los logros de los a las realizadas en clase para determinar la adquisición
niños y las niñas. y comprensión de conceptos, procedimientos y actitudes
Evaluación formativa en relación al dominio en el uso del idioma oral y escrito.
La prueba objetiva sólo es una actividad entre otras. Lo
La finalidad de la evaluación formativa es conocer los recomendable es exponer a los y las estudiantes también a
logros y dificultades de aprendizaje de los y las estudiantes situaciones problema que impliquen resolución por medio
para facilitarles ayuda adecuada y oportuna. Por ejemplo, de una actividad concreta: identificar, analizar, explicar,
si el o la estudiante no logra identificar las sílabas que representar, argumentar, predecir, inventar, escribir, etc.
constituyen una palabra, el profesor o profesora debe Así, las niñas y los niños pueden aplicar su aprendizaje a
indagar el porqué del fallo e intervenir proponiendo nuevas situaciones comunicativas reales.

25
Programa de estudio de quinto grado
Ejemplos de posibles actividades de evaluación: Respecto a la limpieza de los textos presentados, es
importante que las y los docentes no esperen que los
Las pruebas. Deben ser integrales y equilibradas para alumnos y las alumnas que están en su proceso de
evaluar, al menos, contenidos conceptuales y formación presenten de una vez los textos en versión final.
procedimentales, de maneras independientes o integradas; Todo escritor o toda escritora competente escribe antes un
no necesitan ser exhaustivas ni con muchas preguntas, borrador para corregir y precisar mejoras a sus textos. En
sino diseñadas de acuerdo a la competencia e indicador este sentido, los docentes deben orientar a los niños a que
de logro. la producción de textos es un proceso que va paso a paso.
Actividades de aplicación, por ejemplo, la producción y el Además de los criterios sobre la forma, el orden, la limpieza
envío de una tarjeta de invitación al director o la directora y aspectos como la puntualidad, se recomienda considerar
para que participe en una clase, la realización del periódico criterios fundamentales para el logro de las competencias.
mural, etc. Por ejemplo:
Actividades de investigación: recopilar leyendas de la Dominio de la voz: incluye la claridad, la vocalización,
tradición oral de la región, chistes, adivinanzas, etc. la resonancia y el uso del volumen adecuado en una
Exposiciones orales sobre experiencias, textos creados o determinada situación; la utilización de pausas.
memorizados, como cuentos, poemas, fábulas, rimas, etc. Comportamiento ante una audiencia: el dominio del cuerpo,
la situación delante de la audiencia: mirar a las y los
También se recomienda incluir la autoevaluación para oyentes, no taparse la boca al hablar, estar en una actitud
asignar notas. de interacción con los demás.
Esto supone orientaciones precisas y acompañamiento a Utilización de apoyos no verbales: es importante en la
las y los docentes para que los niños y las niñas la realicen comunicación el apoyo de aspectos no verbales como
responsablemente. ademanes, gestos y movimientos para reafirmar o enfatizar
lo hablado, narrado, recitado, etc.
Criterios de evaluación
Coherencia: presenta la mayoría de las ideas completas,
Es sumamente importante clarificar con las y los estudiantes relacionadas entre sí y con secuencia.
los elementos que se tomarán en cuenta para la evaluación
formativa y sumativa: Corrección: trazo adecuado de las letras, uso correcto de
las palabras.
Debe pedirse a los alumnos aspectos como pronunciación
clara y correcta, orden y aseo en los cuadernos, limpieza en Auto-corrección de sus escritos, etc.
la producción de trabajo, siempre y cuando sean trabajados Adecuación: la mayoría de veces hace uso adecuado del
y aprendidos durante las clases. lenguaje, tomando en cuenta la situación comunicativa.

26
Programa de estudio de quinto grado
Objetivos UNIDAD 1
¸ Producir textos orales con el apoyo de gestos y ademanes; y textos escritos, destacando la
importancia del lenguaje, a fin de desarrollar la capacidad comunicativa en
diferentes contextos.
NOS COMUNICAMOS
¸ Utilizar diferentes estrategias para la comunicación oral y escrita, reconociendo las
similitudes y diferencias entre el lenguaje oral y escrito en las dimensiones espacial y
temporal con el propósito de lograr coherencia y corrección en la expresión.
¸ Participar y emitir opiniones sobre temas cotidianos en diversas situaciones y contextos,
reconociendo los diferentes elementos de la comunicación para realizar una efectiva
función como receptor o emisor de los mensajes. Tiempo probable: 10 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Estrategias para la Aplicación de estrategias Iniciativa al aplicar 1.1 Aplica con iniciativa estrategias
comunicación oral y para la comunicación oral estrategias para la para la comunicación oral y
escrita: toma de apuntes y y escrita como la toma de comunicación oral escrita como la toma de apuntes
su lectura en voz alta. apuntes y su lectura en y escrita. y su lectura en voz alta.
voz alta.

El lenguaje oral y escrito. Reconocimiento de las Interés en comunicarse 1.2 Expresa la diferencia entre
similitudes y diferencias de forma oral y escrita el lenguaje oral y el escrito,
entre el lenguaje oral tomando en cuenta la demostrando interés en la
y escrito, tomando en dimensión espacial dimensión temporal y espacial
cuenta las dimensiones y temporal. al comunicarse.
espacial y temporal.

27
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los elementos de la Adopción de medidas para Interés en mejorar su 1.3 Explica y adopta algunas
comunicación: emisor, mejorar la comunicación comunicación atendiendo medidas para mejorar la
receptor, código, canal, a partir del análisis de los a los elementos comunicación a partir de los
interferencias. elementos que intervienen que intervienen. elementos que intervienen:
en la comunicación y emisor, receptor, código,
comprensión del proceso. canal, interferencias.

Los gestos y ademanes Expresión y utilización Respeto por personas 1.4 Se expresa oralmente con
como apoyo del de gestos, ademanes y que se expresan de soltura, utilizando gestos y
lenguaje oral. movimientos, como apoyo formas diferentes. ademanes, manifestando
del lenguaje oral. respeto por otras formas de
comunicación diferentes.

28
Programa de estudio de quinto grado
Objetivos UNIDAD 2
¸ Aplicar estrategias de lectura y escritura al redactar diferentes textos de interacción social
como las cartas y noticias, con el propósito de mejorar la expresión tanto oral como escrita.
¸ Escribir diferentes textos, utilizando los signos de puntuación, uso de mayúsculas y RECORDEMOS
abreviaturas, terminaciones de diminutivos y aumentativos con la finalidad de satisfacer
necesidades de expresión escrita con coherencia y corrección.

Tiempo probable: 15 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Estrategias de comprensión Deducción del significado Interés y atención por 2.1 Infiere con interés el significado
lectora: interrogación del de algunas palabras inferir el significado de de palabras que desconoce
texto antes, durante y desconocidas a partir palabras cuyo significado a partir de la información del
después de la lectura, del contexto. se desconoce, a través contexto que las rodea.
formulación de preguntas del contexto.
sobre lo leído.
Formulación de preguntas Autonomía en formular 2.2 Formula autónomamente
acerca del contenido de preguntas relativas a los preguntas que permiten
los textos, con el objeto de textos que lee. aclarar el contenido de textos
asegurar la comprensión que lee.
de los mismos.

Pasos en el proceso de Escritura de textos Autonomía y esmero al 2.3 Escribe textos con esmero
escritura: planificación, diversos, siguiendo los escribir textos, siguiendo y autonomía, siguiendo los
escritura del borrador, pasos fundamentales y los pasos fundamentales pasos fundamentales
reescritura del trabajo y adaptándolos al tipo del proceso. del proceso.
publicación o edición. de texto.

29
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Partes principales de la Lectura e identificación de Interés en hechos y 2.4 Explica el contenido de noticias
noticia: titular, entradilla, las partes importantes de noticias nacionales que lee, apoyándose en su
cuerpo y cierre. una noticia. e internacionales. estructura (titular, entradilla,
cuerpo y cierre) manifestando
interés en hechos nacionales
e internacionales.

Estructura de la carta Intercambio de cartas Disposición entusiasta 2.5 Intercambia con entusiasmo
familiar: lugar y fecha, familiares respetando para intercambiar cartas familiares respetando
saludo, cuerpo de la carta, su estructura y normas cartas familiares. su estructura al escribirlas.
despedida y firma. ortográficas de los
dos puntos.

Uso de los dos puntos, Escritura de dos puntos, Esmero y atención en 2.6 Escribe dos puntos después del
después del saludo en después del saludo, el uso de dos puntos, saludo, en las cartas, y antes de
las cartas y antes de en las cartas; y antes después del saludo en las enumeraciones.
las enumeraciones. de enumeraciones de las cartas y antes de
elementos de diferente enumeraciones.
clase, en oraciones y
textos cortos.

Uso de mayúscula en Indagación de títulos Interés al indagar títulos 2.7 Utiliza correctamente la
títulos de libros. de libros a partir de de libros. mayúscula en títulos de libros que
un criterio dado y indaga con interés de acuerdo a
escritura de sus títulos un criterio dado.
aplicando mayúsculas
y las reglas ortográficas
correspondientes.

30
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Uso de abreviaturas. Identificación del Interés en la escritura 2.8 Utiliza abreviaturas correctamente
significado de correcta de las al escribir textos.
abreviaturas y uso en abreviaturas.
textos que escribe.

Uso de diminutivos Diferenciación y Esmero al escribir 2.9 Utiliza los diminutivos y


y aumentativos. uso de sustantivos y correctamente los aumentativos para expresar
adjetivos, diminutivos y diminutivos afecto o su percepción del
aumentativos, aplicando y aumentativos. tamaño de objetos, animales o
las terminaciones personas, esmerándose en su
correctas. escritura correcta.
Reglas ortográficas
en las terminaciones
de los aumentativos y
diminutivos. Terminaciones
-ón, -ona, -ote, -ota,
-azo, -aza, -ito, -ita, -cito,
-cita, -ico-, -ica, -illo, -illa,
-ecito, -ecita.

31
Programa de estudio de quinto grado
Objetivos UNIDAD 3
¸ Producir con entusiasmo, textos descriptivos en forma oral y escrita: cronografía,
crinografía, biografía; utilizando con corrección los diferentes grados del adjetivo, los
sustantivos, conjunciones y preposiciones a fin de mejorar la capacidad expresiva
y creativa.
¸ Escribir textos breves relacionados con cuentos de aventuras y de ciencia-ficción, así como
DESCRIBAMOS Y
con alguna novela juvenil; identificando además, los diferentes tiempos del Modo Indicativo
utilizados en la narración, reforzando el concepto de oración simple y la concordancia entre
NARREMOS
el sujeto y el verbo, con la intención de despertar el interés, disfrute y gozo por la lectura de
estos textos narrativos.
¸ Leer y escribir algunos mitos de las culturas mesoamericanas, como un tipo de narración
que mezcla la realidad con la fantasía, tomando en cuenta algunos aspectos ortográficos
como: el uso adecuado del punto y coma, los puntos suspensivos; el uso de la “b” en
palabras que empiezan por “ob, obs, ab, abs” y uso de la “g” en verbos terminados en
“ger” y “gir”, con el objeto de acrecentar su capacidad de comprensión y aprecio por
la literatura. Tiempo probable: 45 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Textos descriptivos. La Lectura y comprensión de Interés manifiesto por 3.1 Lee con interés cronografías
cronografía: definición y cronografías literarias y conocer las cronografías. literarias y no literarias,
características. no literarias, identificando distinguiéndolas entre otros
en ellas sus características textos descriptivos.
descriptivas.

Grados del adjetivo Comparación de dos Atención e interés en el 3.2 Utiliza correctamente los grados
calificativo: positivo, objetos o seres utilizando uso adecuado de los del adjetivo calificativo al
comparativo y superlativo. los diferentes grados del grados del adjetivo. describir y comparar objetos o
adjetivo calificativo. seres.

32
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Textos descriptivos: la Lectura en voz alta y Interés en leer y escribir 3.3 Lee en voz alta y silenciosa
crinografía, definición y silenciosa de crinografías crinografías que cronografías propias o
características. propias o de compañeros respondan a propósitos escritas por sus compañeros
y compañeras escritas comunicativos. y compañeras, a partir de
en función de propósitos propósitos comunicativos
comunicativos. definidos.

Producción escrita de Creatividad y esmero en la 3.4 Escribe crinografías con


crinografías, utilizando producción oral y escrita creatividad y esmero
adjetivos calificativos en de crinografías. utilizando de manera
los diferentes grados. apropiada los adjetivos
calificativos en diferentes
grados.

La biografía. Definición Lectura y conocimiento Juicio crítico sobre las 3.5 Expresa su opinión críticamente
y características. de biografías de cualidades o hechos sobre las cualidades y hechos
personalidades positivos de la vida de de la vida de personalidades
salvadoreñas o del mundo. personalidades nacionales nacionales e internacionales, a
o internacionales. partir de la lectura y comentario
de sus biografías.

Producción escrita de Valoración de las 3.6 Escribe biografías de


biografías de personas cualidades y aportes de familiares o personas de su
destacadas en la familiares o personas de comunidad, valorando sus
comunidad, a partir de su comunidad. cualidades o aportes, a partir
modelos leídos. de modelos leídos.

33
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Conjunciones y Revisión y corrección Interés por utilizar 3.7 Identifica y corrige, si es
preposiciones. de conjunciones y conjunciones y necesario, las conjunciones y
preposiciones utilizadas en preposiciones preposiciones utilizadas en la
la redacción de biografías correctamente para redacción de biografías y otros
y otros textos. clarificar la redacción textos, a partir de la relación que
de biografías. establecen entre las palabras
e ideas.

El uso del punto y coma: Uso y corrección del punto Esmero e interés por 3.8 Utiliza punto y coma para escribir
antes de las conjunciones y coma en oraciones utilizar correctamente el y corregir oraciones unidas
adversativas y en oraciones unidas por conjunciones punto y coma. por conjunciones adversativas
simples que tienen varias adversativas y en y oraciones que tienen varias
enumeraciones, separadas oraciones simples con enumeraciones, separadas
por comas. varias enumeraciones por comas.
separadas por comas.

El cuento de ciencia- Lectura en voz alta y Gusto y entusiasmo por 3.9 Lee y escribe con entusiasmo
ficción. Definición, silenciosa y producción la lectura y escritura de cuentos de ciencia-ficción y
elementos y estructura. escrita de cuentos cuentos de ciencia-ficción. explica sus características,
de ciencia-ficción y elementos y estructura.
descubrimiento de las
características principales.

Cuentos de aventura. Lectura y reinvención Interés y creatividad al leer 3.10 Lee y reinventa con interés y
de cuentos de aventura e inventar alguna parte de creatividad el inicio, parte del
teniendo en cuenta la un cuento de aventura. desarrollo o el final de cuentos
estructura, elementos, de aventura, conservando la
características y temática coherencia entre sus partes y
que tratan. sus características.

34
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sustantivos individuales Utilización de los Precisión al utilizar los 3.11 Selecciona y utiliza con precisión
y colectivos. sustantivos individuales sustantivos individuales sustantivos individuales y
y colectivos en cuentos y colectivos. colectivos al escribir o reinventar
de aventura, de ciencia- cuentos de ciencia-ficción y
ficcción y otros textos. de aventura.

La oración simple. Ubicación de diferentes Interés por identificar el 3.12 Identifica correctamente y con
Diferentes posiciones del posiciones del sujeto y el sujeto del predicado en interés diferentes posiciones
sujeto y el predicado. predicado en oraciones diferentes posiciones de la del sujeto y del predicado de
Concordancia entre sujeto simples a partir de la oración simple. oraciones simples a partir de
y verbo. concordancia entre el la concordancia entre el
sujeto y el verbo. sujeto y el verbo.

Corrección de oraciones Esmero en corregir 3.13 Corrige con esmero y acierto


simples en textos breves, oraciones, aplicando la la concordancia de número,
aplicando la concordancia concordancia entre el entre el sujeto y el verbo de
de número, entre el sujeto sujeto y el verbo. oraciones simples de
y el verbo. textos breves.

Mitos mesoamericanos. Lectura e interpretación Curiosidad e interés 3.14 Comenta oralmente y por
de mitos de la cultura por la lectura de mitos escrito el contenido de mitos
mesoamericana y mesoamericanos. mesoamericanos identificando
descubrimiento de sus las características que los
características principales. distinguen de otros textos.

Puntos suspensivos en Producción de enunciados Creatividad al escribir 3.15 Escribe creativamente y


enunciados incompletos incompletos o de suspenso enunciados incompletos con corrección enunciados
o en suspenso. con puntos suspensivos a o de suspenso con incompletos o de suspenso,
partir de modelos. puntos suspensivos. utilizando puntos suspensivos,
a partir de modelos dados.

35
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Uso de la “b” en palabras Escritura y corrección de Esmero por escribir, 3.16 Escribe y corrige correctamente
que empiezan con las palabras que empiezan correctamente, palabras palabras que empiezan con las
sílabas ab-, ob- obs-, con las sílabas ob-, obs-, que empiecen con ab-, sílabas ab-, abs-, ob-, obs-.
abs-. ab-, abs-. abs-, ob-, obs-.

La novela. Definición, Lectura y comprensión Entusiasmo en la lectura 3.17 Comenta con entusiasmo,
estructura y características. de las acciones y de la de novelas cortas. oralmente y por escrito, las
estructura narrativa de principales acciones realizadas
novelas cortas. por los personajes de novelas
que lee.

El Modo Indicativo de los Comprensión del sentido Atención para identificar 3.18 Identifica oraciones
verbos. Tiempos simples del Modo Indicativo los tiempos simples y expresadas en Modo Indicativo
y compuestos. para referir acciones compuestos del Modo a partir del sentido que les ha
de la realidad. Indicativo. dado el hablante o escritor.
Uso de los tiempos simples 3.19 Utiliza correctamente los
y compuestos del Modo tiempos simples y compuestos
Indicativo, para escribir del Modo Indicativo para
acciones de cuentos, escribir acciones de cuentos,
novelas o de su invención. novelas o de su invención.

Uso de la “g” en verbos Conjugación correcta de Interés y esmero en 3.20 Conjuga correctamente verbos
terminados en -ger verbos en tiempos simples escribir correctamente la en los tiempos simples del Modo
y -gir. del indicativo terminados conjugación de los verbos Indicativo terminados en -ger y
en -ger y -gir, al producir terminados en -ger -gir al producir o corregir textos
textos orales y -gir. orales y escritos.
y escritos.

36
Programa de estudio de quinto grado
Objetivos UNIDAD 4
¸ Dramatizar situaciones de la vida cotidiana utilizando textos dramáticos breves en
los cuales se incluyan diálogos o monólogos, tomando en cuenta, el uso de signos de
admiración, interrogación; así como la raya y el guión largo con el propósito de desarrollar
las capacidades expresivas. ACTUEMOS
¸ Redactar diálogos utilizando los signos de admiración, interrogación, la raya y el guión
largo con el propósito de desarrollar la capacidad de expresión oral y escrita.
Tiempo probable: 15 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El texto dramático. El tema Lectura u observación Interés en el tema y los 4.1 Reconoce con interés el tema
y los personajes. de textos dramáticos personajes de los textos y los personajes de textos
reconociendo el tema y los dramáticos. dramáticos que lee u observa.
personajes.

Estructura interna del Descubrimiento y Interés y esmero al 4.2 Deduce y explica los
texto dramático: inicio, explicación de la analizar la estructura componentes de la estructura
desarrollo y final. estructura interna y interna y externa de un externa e interna de un texto
externa del texto dramático texto dramático. dramático que observa o lee.
a partir de su lectura,
observación y análisis.
Estructura externa de textos
dramáticos: actos, escenas
y acotaciones.

37
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El diálogo en textos Escritura de diálogos en Respeto por la norma y el 4.3 Escribe diálogos cortos en
dramáticos. los que participan varios uso de la raya y el guión los que participan varios
personajes de situaciones largo en diálogos de textos personajes de situaciones
Uso de la raya o guión
reales o imaginarias dramáticos. reales o imaginarias utilizando
largo y de los signos
utilizando la raya o guión correctamente el guión largo,
de interrogación y
largo, para señalar la los signos de interrogación y
exclamación en textos
participación de los exclamación.
dramáticos.
personajes y utilización de
los signos de interrogación
y exclamación para
expresar emociones
o preguntas.

Dramatización de escenas Realización de Interés y agrado 4.4 Participa con interés en


de textos dramáticos o de dramatizaciones, basadas al participar en dramatizaciones de escenas
diálogos inventados. en textos dramáticos o dramatizaciones de de textos dramáticos
diálogos creados a partir diferente tipo. o diálogos inventados
de situaciones de la entonando su expresión
vida real. con ayuda de los signos de
interrogación y exclamación
y apoyándose de la
expresión corporal.

38
Programa de estudio de quinto grado
Objetivos UNIDAD 5
¸ Escribir textos instruccionales sobre la realización de algún experimento sencillo, utilizando
correctamente el Modo Imperativo de la conjugación verbal y la segunda persona del
singular, con sus variantes pronominales, con la finalidad de acrecentar la capacidad de
expresión oral y escrita en la convivencia cotidiana. SIGAMOS
¸ Explicar oralmente instrucciones a seguir para la elaboración de trabajos manuales
con materiales reciclables o de bajo costo con base en la lectura previa de textos sobre
INSTRUCCIONES
experimentos sencillos o la realización de manualidades con el propósito de consolidar la
lectura comprensiva y capacidad de expresión oral.
Tiempo probable: 15 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONC U S
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los textos instruccionales Lectura y seguimiento Disposición para realizar 5.1 Expresa comprensión y sigue
y su función para prevenir de instrucciones orales prácticas de prevención o instrucciones que lee para
o atender emergencias: para prevenir o atender de protección en el caso prevenir o atender emergencias
terremotos, inundaciones y emergencias: terremoto, de desastres naturales. en caso de desastres naturales.
huracanes. inundación, huracán.

Instrucciones orales Seguimiento de Atención e interés por 5.2 Sigue con atención e interés
y escritos para la instrucciones orales y hacer trabajos manuales instrucciones orales y escritas
elaboración de trabajos escritas para realizar y experimentos sencillos para hacer trabajos manuales
manuales y experimentos trabajos manuales y siguiendo instrucciones y experimentos sencillos.
sencillos. experimentos sencillos. orales y escritas.

39
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El Modo Imperativo en Escritura y divulgación de Interés en comunicar 5.3 Escribe y divulga mensajes
oraciones exhortativas. mensajes que contribuyen medidas de prevención a que contribuyen a la
a la convivencia o la la comunidad educativa. convivencia o la seguridad en
seguridad en el centro el centro escolar y comunidad
escolar y comunidad utilizando correctamente
utilizando correctamente oraciones exhortativas con
oraciones exhortativas verbos en Modo Imperativo.
con verbos en Modo
Imperativo.

Los pronombres posesivos Reconocimiento y uso de Interés en comunicar 5.4 Expresa con interés, oralmente
y demostrativos. los pronombres posesivos relaciones de pertenencia y por escrito, la relación de
y demostrativos. en situaciones pertenencia de personas y cosas,
comunicativas. por medio del uso correcto de
los pronombres posesivos y
los determinantes posesivos en
situaciones comunicativas.

Las abreviaturas de uso Reconocimiento y uso Valoración de la utilidad 5.5 Utiliza correctamente
frecuente. correcto de abreviaturas de las abreviaturas de uso abreviaturas de uso frecuente,
de uso frecuente, en frecuente. valorando su importancia para
diferentes textos. la comunicación escrita.

40
Programa de estudio de quinto grado
Objetivos UNIDAD 6
¸ Leer, recitar y escribir, con intención literaria, poemas de dos a cuatro estrofas haciendo
buen uso del lenguaje poético, la tildación de palabras y los conocimientos previos acerca
de la estrofa, los tipos de rima, algunas figuras literarias como la anáfora con el propósito de DE VERSO EN
desarrollar la creatividad, y la sensibilidad por el género poético.
VERSO
¸ Escuchar en forma atenta, textos orales de tradición: colmos, modismos y refranes, tomando
en cuenta el lenguaje cotidiano, los monosílabos, los diptongos, la tildación de palabras, uso
de “cc”,” sc” y “xc” y otros a fin de enriquecer su dominio léxico y expresión oral.
Tiempo probable: 25 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los poemas. Lectura y Lectura en voz alta de Entusiasmo por la lectura 6.1 Lee poemas en voz alta y con
declamación. poemas de diferente de poemas. entusiasmo atendiendo la dicción
número de estrofas y de y entonación apropiadas.
versos, con la dicción
correcta y la entonación
adecuada.
Memorización y recitación Entusiasmo y empeño 6.2 Memoriza y recita con
de poemas de tres a cinco al memorizar y recitar entusiasmo y empeño poemas
estrofas. poemas. de al menos tres estrofas.

El lenguaje cotidiano y el Caracterización y Valoración del lenguaje 6.3 Distingue expresiones orales y
lenguaje poético. distinción del lenguaje cotidiano y del lenguaje escritas de lenguaje cotidiano
cotidiano y del lenguaje poético según la intención y de lenguaje poético a partir
poético en textos cortos, comunicativa. de sus características y la
orales o escritos. intención comunicativa.

41
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La estrofa y el verso. Escritura de poemas de Esfuerzo por escribir 6.4 Escribe un poema utilizando
dos a cuatro estrofas, poemas con lenguaje lenguaje poético y la
utilizando lenguaje poético poético, tomando en estructura básica: estrofa
y atendiendo la estructura cuenta los versos y y verso.
básica de los poemas: estrofas.
estrofa y versos.

La rima. Tipos de rima: Reconocimiento de la rima Atención e interés por 6. 5 Diferencia claramente la rima
consonante y asonante. consonante y asonante comprender la diferencia consonante y asonante de un
en los versos que riman entre la rima consonante poema, señalando los versos
entre sí. y asonante. que riman entre sí.

Figuras literarias: la Identificación y uso de Aprecio por el valor 6.6 Identifica y utiliza anáforas,
anáfora, el símil, la figuras literarias, en comunicativo de las símiles, personificaciones y
personificación y poemas que lee y escribe. figuras literarias. metáforas en poemas que lee y
la metáfora. escribe, manifestando aprecio
por su valor comunicativo.
Creación y presentación Creatividad y autonomía 6.7 Escribe y presenta
de poemas con intención al escribir poemas. creativamente poemas, con
literaria, tomando en intención literaria, tomando
cuenta la versificación, en cuenta la versificación,
rima y empleando figuras rima y empleando las figuras
literarias en estudio. literarias estudiadas.

Tildación de palabras: Tildación de palabras Esmero en tildar 6.8 Tilda correctamente las palabras
agudas, graves, esdrújulas agudas, graves, esdrújulas correctamente las agudas, graves, esdrújulas y
y sobreesdrújulas. y sobreesdrújulas, según la palabras. sobreesdrújulas que utiliza al
regla ortográfica. escribir poemas y otros textos.

42
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los monosílabos. Revisión de textos propios Responsabilidad durante la 6.9 Revisa con responsabilidad textos
o ajenos en los que se revisión de textos propios propios o ajenos en los que se
utilicen monosílabos o ajenos en los que se utilicen monosílabos reparando
reparando en su escritura utilicen monosílabos. en su escritura correcta.
correcta.

Los textos de tradición Comprensión de colmos, Valoración de la función 6.10 Comenta su comprensión de
oral: colmos, modismos modismos y refranes lúdica y pedagógica de colmos, modismos y refranes
y refranes. reconociendo su función algunos textos de que lee o escucha, valorando su
lúdica o pedagógica. tradición oral. función lúdica y pedagógica, y
desaprobando expresiones que
dañen la integridad de personas
o grupos.
Desaprobación por colmos
que dañan la integridad
de personas o grupos.

Uso de “cc” ,” sc” y “xc”. Conocimiento y aplicación Empeño en escribir 6.11 Escribe correctamente las
de las reglas ortográficas correctamente palabras palabras que llevan “cc”, “sc” y
relativas al uso de “cc”, con “cc”, “sc” y “xc”. “xc” en pequeños textos.
“sc” y “xc”, en oraciones y
pequeños textos.

La tilde diacrítica. Redacción de textos cortos Interés por utilizar 6.12 Redacta textos cortos empleando
en los que se distinga el correctamente la tilde la tilde diacrítica correctamente y
uso de la tilde diacrítica. diacrítica. con interés.

43
Programa de estudio de quinto grado
Objetivos UNIDAD 7
¸ Leer y producir caricaturas, afiches, y señales de tránsito enriqueciendo su expresión con
palabras antónimas, homófonas, y los pronombres de la segunda persona del singular, con
sus variantes pronominales (ti-te-contigo; vos, usted) a fin de expresarse con coherencia y
corrección en diferentes situaciones comunicativas.
IMÁGENES CON
¸ Escribir diferentes textos en los que se empleen oraciones simples, distinguiendo el sujeto y SIGNIFICADO
predicado; utilizando las variantes pronominales estudiadas y verbos como: ir-venir, subir-
bajar, entrar-salir, nacer-morir, reír-llorar y otros para interactuar con mayor facilidad con
las demás personas en diferentes contextos. Tiempo probable: 15 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES
M N ACTITUDINALES
C U N S
La caricatura: finalidad y Comprensión de Entusiasmo por conocer 7.1 Expresa con entusiasmo su
características. caricaturas a través del caricaturas. opinión sobre el mensaje
reconocimiento de sus de caricaturas apoyándose
características. en el conocimiento de sus
características.

Las señales de tránsito. Clasificación de las Respeto a las diferentes 7.2 Clasifica y explica la utilidad
Definición, tipos e diversas señales de tránsito señales de tránsito. de las señales de tránsito
importancia (preventivas, y reconocimiento de su manifestando respeto por su
reglamentarias e utilidad para la vida. indicación.
informativas). Creación de algunas Interés y esmero en crear 7.3 Crea por lo menos una señal
señales gráficas, a las algunas señales gráficas para ser utilizada en una
que se les adjudicará que tengan utilidad. situación determinada en la
un significado, y que escuela, en la comunidad, o en
respondan a una el país.
necesidad detectada en la
escuela, en la comunidad,
o en el país.

44
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El afiche. Elaboración de afiches Creatividad al elaborar 7.4 Elabora creativamente afiches
para comunicar afiches tomando en para comunicar información útil
información útil al centro cuenta sus características y al centro escolar o comunidad,
escolar y comunidad, función. tomando en cuenta sus
tomando en cuenta sus características y función.
características y función.

Las palabras antónimas Utilización de palabras Creatividad al contrastar 7.5 Expresa juegos de palabras,
(verbos). antónimas (verbos) a acciones opuestas en oralmente y por escrito, a partir
través de juegos orales y juegos de palabras. del contraste de verbos con
escritos. significado opuesto (antónimos).

Las palabras homófonas. Lectura y elaboración Atención y esmero en 7.6 Diferencia claramente el
de textos en los que identificar el significado significado de, por lo menos,
se utilicen palabras correcto de las palabras quince pares de palabras
homófonas, reconociendo homófonas. homófonas, por su escritura
su significado por la o por el contexto de la
escritura diferente y por el comunicación oral.
contexto, en el caso de la
comunicación oral.

Los pronombres Lectura y reconocimiento, Interés en los pronombres 7.7 Reconoce y usa los pronombres
personales y las variantes en oraciones y/o textos personales, especialmente personales, especialmente los de
pronominales de segunda cortos, de los pronombres los de la segunda persona la segunda persona del singular
persona del singular (ti, te, personales de la segunda del singular. con sus variantes pronominales.
contigo). persona del singular.

45
Programa de estudio de quinto grado
Objetivos UNIDAD 8
¸ Leer y comprender textos informativos, a través del análisis de su estructura, del
descubrimiento de sus ideas principales y secundarias y del tipo de lenguaje utilizado a fin
de desarrollar su pensamiento crítico e incrementar su vocabulario.
¸ Construir organizadores gráficos, como el esquema de llaves y los cuadros de doble NOS INFORMAMOS
entrada, respetando su estructura básica, así como los aspectos gramaticales referentes
a la oración simple y a algunos contenidos ortográficos para visualizar y utilizar mejor la
información extraída de textos expositivos que permitan facilitar el aprendizaje.
¸ Escribir informes o reportes escolares, respetando su estructura básica, así como los
aspectos gramaticales referentes a la oración y los diferentes elementos ortográficos
estudiados con el fin de desarrollar la coherencia y cohesión en la expresión escrita. Tiempo probable: 35 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los textos explicativos o Descubrimiento de la Interés en leer y 8.1 Reconoce la introducción,
expositivos. estructura y función de comprender textos desarrollo y conclusión de un
textos explicativos o expositivos. texto expositivo escrito.
expositivos. 8.2 Identifica con interés textos
expositivo o explicativo que
lee a partir de su estructura y
función.

El párrafo en textos Identificación de la idea Interés y esmero en 8.3 Identifica con esmero e
explicativos o expositivos. principal y de las ideas identificar las ideas interés la idea principal y
Ideas principales y secundarias de textos principales y secundarias las ideas secundarias de un
secundarias. expositivos o explicativos de textos expositivos. texto explicativo de cuatro o
a partir de la comprensión cinco párrafos a partir de la
y relación de los párrafos comprensión de cada uno de
que los componen. éstos y la relación de las ideas
que comunican.

46
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Reconocimiento del tipo Atención a las 8.4 Explica con sus propias palabras
de lenguaje en los textos características del lenguaje las características del lenguaje
expositivos o explicativos. expositivo. que se utiliza en los textos
expositivos.

Clases de sujeto en Identificación del sujeto Atención en la 8.5 Diferencia claramente el


la oración: simple y simple y compuesto en identificación del sujeto sujeto simple del sujeto
compuesto; explícito y oraciones y textos cortos. simple y compuesto. compuesto, en la oración.
tácito.
Reconocimiento del Interés en el 8.6 Reconoce y explica con interés
sujeto explícito y tácito en reconocimiento del sujeto cuando el sujeto está explícito
oraciones y textos cortos. explícito y del sujeto tácito. o tácito, en una oración.

Núcleo del sujeto y núcleo Reconocimiento de los Interés en reconocer al 8.7 Reconoce con interés el núcleo
del predicado. núcleos del sujeto y núcleo del sujeto y del del sujeto y del predicado de
del predicado y de las predicado. oraciones simples, identificando
palabras que pueden las palabras que pueden
realizar dicha función. desempeñar dicha función:
sustantivo, pronombre personal
y verbo.

El predicado nominal y Distinción entre el Empeño en distinguir el 8.8 Distingue, con acierto,
predicado verbal. predicado nominal y predicado nominal del oraciones con predicado
verbal, según la clase de verbal. nominal y con predicado
verbo que se emplea. verbal a partir del verbo.

Complementos del Reconocimiento Esmero en reconocer los 8.9 Reconoce y escribe


predicado verbal: el y utilización del complementos directo e complementos directos
directo y el indirecto. complemento directo y indirecto del predicado e indirectos en diversas
del complemento verbal. oraciones con predicado
indirecto, en oraciones verbal.
con predicado verbal.

47
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Uso de la “h” en palabras Identificación del uso de Interés en utilizar “h” en 8.10 Escribe con interés “h” en
que empiezan con: hue-, la “h” en palabras que palabras que empiezan palabras que empiezan con
hie-, hosp-, hipo-, her-, empiezan con hue-, hie-, con las sílabas citadas. hue-, hie-, hosp-, hipo-,
hor-. hosp-, hipo-, her- ,hor-, her-, hor-.
en un listado de palabras.

Organizadores gráficos Organización de la Esmero al elaborar 8.11 Elabora, de manera clara y


de la información: el información principal organizadores gráficos ordenada, un esquema de
esquema de llaves y los de un texto expositivo y que facilitan el llaves con la información
cuadros de doble entrada. presentación de la misma aprendizaje. principal extraída de un texto
en un esquema de llaves. expositivo o explicativo.

Organización de la 8.12 Elabora con esmero un cuadro


información extraída de doble entrada para organizar
de un texto expositivo y la información de un texto
presentación, de manera explicativo o expositivo.
comparativa, en un cuadro
de doble entrada.

El informe escolar. Elaboración de un Interés y esfuerzo en 8.13 Elabora un informe o reporte


Estructura básica informe o reporte elaborar un reporte o sobre algún tema investigado,
(introducción, desarrollo y escolar, atendiendo a informe escolar. atendiendo a la estructura
conclusiones). la estructura básica de: básica y características del
introducción, desarrollo y lenguaje en este tipo
conclusiones; sin olvidar de textos.
las características básicas
del lenguaje: claridad,
orden y objetividad.

Uso de comillas para Utilización de comillas (““) Atención en el uso de 8.14 Utiliza comillas siempre que
reproducir citas textuales. para citar palabras, frases comillas, al escribir citas hace una cita textual en
o textos cortos, escritos por textuales. informes que escribe.
otra persona.

48
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El sintagma nominal y el Identificación de sintagmas Interés en identificar 8.15 Identifica sintagmas nominales y
sintagma verbal. nominales y verbales en sintagmas nominales y verbales en textos que redacta.
textos que escribe. verbales en textos que
redacta.

La entrevista. Entrevista a personas Respeto e interés por las 8.16 Entrevista con respeto e interés
del centro escolar o personas que entrevista. a personas del centro escolar o
comunidad usando un comunidad utilizando un guión
guión preelaborado. elaborado previamente.

El volante. Elaboración de volantes Esmero al elaborar 8.17 Elabora con esmero volantes
sobre aspectos o eventos volantes sobre aspectos y sobre aspectos o eventos
cotidianos que resulte eventos cotidianos. cotidianos que resulte
útil divulgar. útil comunicar.

Uso de la “s” en palabras Escritura de palabras Interés en la escritura 8.18 Escribe con buena disposición,
terminadas en -erse, -erso. terminadas en -erse, -erso. correcta de palabras palabras terminadas en -erse,
terminadas en -erse, -erso. -erso.

El periódico como Reconocimiento del Criticidad al leer diferentes 8.19 Identifica diferentes tipos de
portador textual. periódico como portador textos y secciones del textos y diversas secciones
de diferentes tipos de periódico. del periódico comentando su
textos y localización de contenido con criticidad.
las distintas secciones del
mismo, con la intención
de hacer un uso
adecuado de éste.

49
Programa de estudio de quinto grado
Objetivos UNIDAD 9
¸ Producir textos argumentativos breves, que puedan ser utilizados en debates, mesas
redondas, pequeños foros, en los cuales se empleen los conectores adecuados y los
adverbios de: lugar, cantidad, afirmación y negación con el propósito de desarrollar la
capacidad creativa y expresiva para satisfacer necesidades de comunicación. ARGUMENTAMOS
¸ Participar en pequeños debates orales, mesas redondas y foros, tomando en cuenta su
estructura, haciendo uso de los conectores y adverbios adecuados, con la finalidad de
incrementar el dominio propio y la interacción social sana.
Tiempo probable: 25 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES
M N ACTITUDINALES
C U N S
La argumentación. Intercambio de opiniones Interés y respeto al dar 9.1 Intercambia opiniones en
Definición. orales, para proponer opiniones y defender forma oral, por medio de
o defender una idea, ideas, utilizando razones o la expresión y escucha de
por medio de razones o argumentos. razones o argumentos para
argumentos. proponer o defender sus ideas
con respeto e interés.

Textos argumentativos. Identificación y comentario Atención y esmero en 9.2 Identifica y comenta la


Definición y estructura. de la tesis que sostiene un identificar la tesis de textos “tesis” que sostiene un
autor o autora en un argumentativos. autor o autora, en un texto
texto argumentativo. argumentativo.
Reconocimiento de Seguridad al reconocer 9.3 Reconoce con seguridad por lo
al menos dos o tres argumentos para apoyar o menos dos o tres argumentos
argumentos que utiliza defender una tesis. que utiliza un autor o autora
el autor o autora para para apoyar o defender una tesis
apoyar o defender de un texto argumentativo.
una tesis.

50
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Escritura de textos Veracidad y respeto al 9.4 Produce un texto
argumentativos, a partir formular argumentos. argumentativo con veracidad
de la estructura: tesis, y respeto enunciando su tesis,
argumentos y conclusión. argumentos y la conclusión.

Conectores utilizados en Utilización de conectores Autonomía en utilizar 9.5 Relaciona las ideas y
los textos argumentativos: que faciliten la exposición correctamente los expone sus argumentos con
por lo tanto, por de argumentos a favor de conectores apropiados. autonomía, apoyándose en
el contrario, por una tesis y que relacionen conectores apropiados.
consiguiente, sin embargo, las ideas adecuadamente.
de todas formas, aun así,
al contrario, en cualquier
caso, en todo caso, sea
como sea, por otra
parte, etc.

Los diptongos. Separa y tilda Esmero al separar 9.6 Separa y tilda correctamente
correctamente palabras correctamente los palabras que presentan
que presentan diptongos. diptongos al realizar diptongos.
divisiones silábicas de
palabras.

El debate. Definición y Participación en debates Respeto y entusiasmo por 9.7 Participa con entusiasmo
características. respetando sus normas y participar en un debate. y respeto en debates
características. atendiendo sus normas y
características.

51
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El foro. Realización de foro sobre Respeto y aprecio al 9.8 Participa con respeto e interés en
temas de interés colectivo. participar en un pequeño un foro sobre temas de interés
foro sobre temas de interés colectivo.
colectivo.

La mesa redonda. Participación en una mesa Seguridad y autonomía 9.9 Emite opiniones con seguridad y
redonda, respetando sus al participar en mesas autonomía al participar en mesas
normas y características. redondas. redondas.

Adverbios de: tiempo, Selección y utilización Interés en utilizar las 9.10 Selecciona diferentes clases de
lugar, cantidad, negación de diferentes clases de diferentes clases de adverbios para expresar sus
y afirmación. adverbios para expresar adverbios. ideas de forma oral y escrita
sus ideas con riqueza de con riqueza y variedad.
vocabulario.

52
Programa de estudio de quinto grado
MATEMÁTICA
Presentación de la asignatura relacionen conceptos. Estos procedimientos permiten
estructurar el pensamiento matemático en los educandos,
La asignatura de Matemática permite el desarrollo de superando la práctica tradicional de partir de una definición
diversas habilidades intelectuales: el razonamiento lógico matemática y no del descubrimiento del principio o proceso
y flexible, la imaginación, la ubicación espacial, el cálculo que le da sentido.
mental, la creatividad, etc. Estas capacidades tienen
una aplicación práctica en la resolución de problemas Comunicación con lenguaje matemático
de la vida cotidiana y en la formación integral de las y
Los símbolos y notaciones matemáticas tienen un significado
los niños.
preciso, distinto al existente desde el lenguaje natural.
Esta competencia desarrolla habilidades, conocimientos
Enfoque de la asignatura: y actitudes que promueven la descripción, el análisis, la
Resolución de problemas argumentación y la interpretación en las y los estudiantes
Este enfoque responde a la naturaleza de la Matemática: utilizando el lenguaje matemático, desde sus contextos, sin
resolver problemas en los ámbitos científico, técnico, olvidar que el lenguaje natural es la base para interpretar
artístico y de la vida cotidiana. En la enseñanza matemática el lenguaje simbólico.
se parte de que en la solución de todo problema hay cierto Aplicación de la matemática al entorno
descubrimiento que puede utilizarse siempre; como las
palabras asociadas a cada operación aritmética, los Es la capacidad de interactuar con el entorno y en
razonamientos asociados al proceso de resolución y la él, apoyándose en sus conocimientos y habilidades
existencia de diversas formas para resolverlo. En este matemáticas. Se caracteriza también por la actitud
sentido, los aprendizajes se fijan para la vida no para pasar de proponer soluciones a diferentes situaciones de la
una evaluación. En términos de enseñanza, la y el docente vida cotidiana. Su desarrollo implica el fomento de la
deben generar situaciones en las que las y los estudiantes creatividad, evitando así el uso excesivo de métodos
exploren, apliquen, argumenten y analicen los conceptos, basados en la repetición.
procedimientos, algoritmos u otros tópicos matemáticos
acerca de los cuales deben aprender. Bloques de contenido
El programa de estudios está estructurado a partir de cuatro
Competencias a desarrollar bloques de contenidos:
Razonamiento lógico matemático 1. Aritmética
Esta competencia promueve que las y los estudiantes En el estudio de los números naturales se incluye los
identifiquen, nombren e interpreten información, criterios de divisibilidad entre 2,3 y 5; así como sus múltiplos
comprendan procedimientos, utilicen algoritmos y y divisores, y la diferencia entre número primo y compuesto.

54
Programa de estudio de quinto grado
Se profundiza en el estudio del máximo común divisor y el Se utilizan prismas para retomar el tema de volumen
mínimo común múltiplo y la descomposición factorial. y capacidad.
En este grado se estudia ampliamente la multiplicación y Se introducen medidas de longitud como la yarda, el pie,
división de números decimales con resultados hasta las la pulgada y la milla, y sus conversiones entre sí. También
décimas, centésimas y milésimas; junto con el redondeo medidas de peso del sistema métrico como el gramo y el
hasta las décimas, centésimas y milésimas. kilogramo y sus equivalencias.
Se continúa con la explicación de las relaciones entre También se incluye el estudio de monedas de países
naturales, fracciones y decimales por medio de conversiones. centroamericanos y sus conversiones entre sí.
Se retoma el tema de fracciones para el desarrollo de
la adición y sustracción de fracciones heterogéneas, 4. Estadística
combinadas con números mixtos y números naturales, y En este bloque se orienta a que las y los niños elaboren e
las distintas propiedades aplicadas a las operaciones interpreten gráficas de líneas simples y dobles, a partir de
entre ellas. una tabla de datos. Que encuentren la mediana y moda de
2. Geometría un conjunto de datos. También se incluye el estudio de los
arreglos (combinaciones) y clasificación de sucesos.
Se incluye el estudio de las relaciones entre ángulos, en
triángulos y cuadriláteros y la caracterización de ángulos Relación entre los bloques de contenido y
complementarios, suplementarios, opuestos por el vértice
y adyacentes. las unidades didácticas
Se profundiza en el estudio de la circunferencia y los Esta propuesta está organizada en unidades más pequeñas
elementos y componentes del círculo, así como la en relación a las del programa de estudio anterior. Esto
aproximación al número pi (π). Se construyen polígonos no significa un aumento en el número de contenidos. La
regulares e irregulares. intención es didáctica y obedece a las siguientes razones:
Se inicia el estudio de los movimientos en el plano, El programa anterior concentraba los contenidos de
en particular la traslación de figuras y sus simetrías. aritmética en la unidad 2. Estos contenidos (operaciones
Finalmente se profundiza en el estudio de los sólidos con números naturales, nociones sobre fracción y número
geométricos y la construcción de prismas y pirámides a partir decimal, operaciones con fracciones y decimales),
de la plantilla o patrón, así como el cálculo de volúmenes pueden ofrecer cierta dificultad para algunos estudiantes,
de prismas. desmotivándolos. En la propuesta actual, los contenidos
de aritmética se desarrollan alternándolos con otro tipo
3. Medidas de contenidos (por ejemplo, geometría) para intercalar
Comprende: la medición de ángulos por medio del otra experiencia de aprendizaje, que disminuye la tensión
transportador, la medida de longitud de la circunferencia y en el alumnado y le mantiene siempre en contacto con
el área de cuadriláteros. aprendizajes matemáticos.

55
Programa de estudio de quinto grado
Los contenidos de medidas, aritmética y geometría se así como otros conceptos, de modo que se garantice que
utilizan de manera integrada. Al alternarse, se facilita los estudiantes han visto los prerrequisitos necesarios
aplicar aprendizajes de aritmética en los otros bloques para abordar los nuevos conceptos.
de contenido. Esta integración refuerza su aplicación y Esta estructura, además de aclarar la secuencia de
propicia aprendizajes significativos. enseñanza, favorece la planificación de la evaluación
La falta de precisión en la secuencia de la enseñanza de formativa (posiblemente al inicio y finalización de cada
los contenidos matemáticos puede propiciar exigir a la unidad didáctica) para brindar refuerzo académico en
niña o el niño ciertos aprendizajes sin haber garantizado forma oportuna.
los prerrequisitos. El programa actual presenta las
unidades didácticas estableciendo una secuencia de
enseñanza progresiva de los números y las operaciones,
A continuación se presenta la reorganización de los contenidos del programa actual con relación al programa anterior.

PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 1: Organicemos los datos Unidad 8: Interpretemos datos


Construcción e interpretación de tablas y gráficas de Tablas de doble entrada.
líneas y de pastel rectangular. Gráficas de líneas simples y dobles. Moda y Mediana. Sucesos posibles,
Cálculo de la media y la moda como medidas que imposibles y seguros.
resumen la información de un conjunto de datos. Arreglos de 2 elementos (combinaciones).
Clasificación de sucesos seguros, imposibles y
probables.

Unidad 2: Operemos con los números Unidad 1: Encontremos múltiplos y divisores comunes

Números naturales, operaciones básicas y Criterios de divisibilidad por 2, 3, 5 y 10. Números primos y compuestos.
procedimientos adecuados. Números fraccionarios, Mínimo común múltiplo, máximo común divisor y descomposición en
números decimales y las operaciones de suma y resta factores primos.
y su aplicación en diferentes situaciones.
Divisibilidad por 2, 3 y 5.

56
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 2: Operemos con los números Unidad 3: Utilicemos números decimales

Suma y resta de fracciones de igual denominador. Multiplicación y división de números decimales, combinados con naturales.
Ampliación y reducción de figuras para inferir la Redondeo de números decimales hasta las décimas, centésimas o milésimas.
proporcionalidad directa.
Unidad 5: Utilicemos las fracciones

Conversión entre fracciones y números decimales. Adición y sustracción de


fracciones heterogéneas y números mixtos.

Unidad 3: Estudiemos geometría Unidad 2: Relacionemos ángulos

Orientación en el plano y el espacio, mediante la Medida de ángulos internos de un triángulo y un cuadrilátero.


ubicación de puntos y la representación de cuerpos Ángulos complementarios, suplementarios, opuestos por el vértice
geométricos. y adyacentes.
Descripción y construcción de triángulos,
cuadriláteros y cuerpos geométricos, por medio del Unidad 4: Dibujemos con círculos y polígonos
U
análisis de las características y elementos que los
conforman.
Identificación de los elementos del círculo y cálculo de la longitud de la
Tangente, secante y cuerda en curvas abiertas y circunferencia.
cerradas.
Usos del compás.
Traslación y simetría de figuras.
Ángulo central y perímetro de un sector circular.
Polígonos regulares e irregulares.

Unidad 6: Encontremos el área de cuadriláteros


U

Cálculo del área de rombos, romboides, trapecios y trapezoides.

57
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 3: Estudiemos geometría Unidad 7:


U 7 Tracemos figuras
Traslación de figuras en un plano.
Ejes de simetría y figuras simétricas con respecto a un eje.
Vértices y lados correspondientes en una figura simétrica.

Unidad 9: Encontremos volúmenes

Paralelismo y perpendicularidad entre aristas y entre caras de un prisma


rectangular.
Patrones de prismas y pirámides.
Cálculo del volumen de un prisma y de una pirámide.
Volumen de prismas.
Relación entre volumen y capacidad.

Unidad 4: Utilicemos medidas Unidad 10: Utilicemos otras medidas

Equivalencia entre yardas, varas, pies y pulgadas Unidades de longitud del sistema inglés, equivalencias.
con el sistema métrico decimal. Unidades métricas de pesos.
Áreas de triángulos y cuadriláteros. Conversión entre monedas centroamericanas.
Manejo y equivalencias de la moneda de los países
de toda Centroamérica.
Volúmenes de paralelepipedos rectangulares.
Equivalencias entre kg, g, lb y oz.
El año y el día en relación a los movimientos de la
Tierra.
Presupuestos.

58
Programa de estudio de quinto grado
Relación de bloques de contenido y unidades didácticas
PROGRAMA ACTUAL BLOQUES
Unidad 1: Encontremos múltiplos y divisores comunes Aritmética

Unidad 2: Relacionemos ángulos Geometría y medidas

Unidad 3: Utilicemos números decimales Aritmética

Unidad 4: Dibujemos con círculos y polígonos Geometría y medidas

Unidad 5: Utilicemos las fracciones Aritmética

Unidad 6: Encontremos el área de cuadriláteros Geometría y medidas


Unidad 7: Tracemos figuras Geometría

Unidad 8: Interpretemos datos Estadística


Unidad 9: Encontremos volúmenes Geometría y medidas
Unidad 10: Utilicemos otras medidas Medidas y aritmética

Objetivos de quinto grado


1. Utilizar la adición y sustracción de fracciones 3. Trasladar figuras y cuerpos geométricos, encontrando
hetereogéneas (propios, impropios y mixtos para resolver el tipo de simetría - simétrica o reflexiva- que poseen,
con seguridad problemas de la vida cotidiana). determinando los ejes de simetría, vértices, lados y puntos
correspondientes, a partir de situaciones problemáticas
2. Determinar perímetros y áreas de cuadriláteros y círculos, del entorno.
el volumen de prismas y pirámides, identificando cada
uno de los elementos que conforman a dichos cuerpos 4. Utilizar las equivalencias de las medidas de peso y
figuras geométricas, al proponer soluciones a problemas capacidad del sistema inglés y métrico decimal, al
que se relacionen con ellos. estimar, medir o calcular, pesos de personas u objetos (y
la capacidad en estos últimos) de su entorno.

59
Programa de estudio de quinto grado
5. Realizar conversiones entre las monedas utilizadas en los La geometría y las medidas requieren de la manipulación
países centroamericanos, al establecer comparaciones de objetos. Es primordial que los elementos de cada figura
de precios y calidad de vida; así como para elaborar o cuerpo geométrico y el uso de instrumentos de medición
presupuestos conociendo el monto a invertir. estén claros en la mente de los y las niñas porque éstos le
serán de mucha utilidad.
6. Interpretar críticamente gráficas lineales, la moda y
la mediana; así como determinar sucesos seguros, Es importante que los y las alumnas estudien la
posibles e imposibles utilizando el diagrama de árbol Estadística iniciando con la utilización de datos y
para aplicarlo a situaciones de su cotidianidad. fenómenos de la vida real relacionados con su entorno, para
luego ampliar esta práctica utilizando datos y fenómenos
Lineamientos metodológicos relacionados con su país y el mundo. El uso del periódico,
revistas y libros es una forma creativa de recabar datos que
El proceso de enseñanza aprendizaje de la Matemática pueden ser de interés para los y las alumnas.
requiere de metodologías participativas que generen la
Otra idea substancial que debe quedar clara en la mente
búsqueda de respuestas en el estudiante, promoviendo su
de los estudiantes es la utilización de la moneda (en nuestro
iniciativa y participación en un clima de confianza que le
caso, el dólar de los Estados Unidos de América), su valor,
permita equivocarse sin temor, desarrollar su razonamiento
y sus equivalencias en moneda extranjera, específicamente
lógico y comunicar sus ideas para solucionar problemas del
para los países de Centro América. La formación precisa
entorno. Se deben hacer esfuerzos para evitar explicaciones
de esta idea, junto con la utilización de objetos y precios
largas de parte de la o el docente y procurar que las niñas
actuales de cada país, ayudará a que los alumnos y alumnas
y los niños disfruten la clase de Matemática, la encuentren
puedan elaborar presupuestos en distintas situaciones de
interesante y útil porque construyen nuevos aprendizajes
la vida cotidiana y en el análisis del costo de los artículos en
matemáticos.
cada país centroamericano.
En el quinto grado, la idea de número primo o compuesto
La introducción y desarrollo de cada contenido matemático
y las reglas de divisibilidad son la base para el cálculo
requiere de una cuidadosa planificación, en la cual se
del mínimo común múltiplo y el máximo común divisor. La
incluyen actividades creativas que motiven al estudiante a
utilización de la Criba de Eratóstenes es de vital importancia
aprender de las situaciones que le rodean. Es importante
para esta idea.
que el docente guíe el aprendizaje de los conceptos
Es necesario reforzar el concepto y la representación de y procedimientos de manera gradual y que al mismo
fracciones y decimales a partir de las conversiones que tiempo ofrezca retos de interés. La evaluación constante
pueden realizarse entre éstos; para que el y la alumna mediante la observación y los instrumentos de evaluación
comprendan con claridad las relaciones entre estos tipos formales deben retar al estudiante a recordar conceptos
de números y los números naturales, y su utilización en la y procedimientos previos y del momento, para la fijación
adición, sustracción, multiplicación y división. correcta de cada uno de ellos.

60
Programa de estudio de quinto grado
A fin de orientar la metodología de la asignatura, se proponen Paso 3. Ejecución del PO
6 pasos que siguen un orden lógico para el desarrollo de
un contenido. Esta secuencia didáctica corresponde al En este paso se realizan los cálculos y operaciones
necesarias para aplicar los procedimientos y estrategias
procedimiento desarrollado en las lecciones del Libro de
elegidas o incluidas en el PO. Se examina sobre la marcha,
texto y la Guía metodológica. Debe concebirse como un si cada uno de los pasos es correcto. Si se tiene dificultad no
modelo, puede adecuarse y enriquecerse con la experiencia hay que desistir hasta que se vea con claridad que el plan
docente, el conocimiento del alumnado y los recursos con no es válido; y en este caso, ser flexible, abandonándolo y
los que cuenta la escuela. volviendo al paso anterior de la búsqueda.
Paso 1. Lectura y comprensión de la situación problemática Paso 4. Revisión de la resolución
El alumnado observa una situación directamente de la En este paso se examina el camino seguido; se comprueban
vida real o ilustrada en el Libro de texto y expresa sus los cálculos, y se localizan rutinas para ver si los
conocimientos sobre la situación o el contenido a partir de procedimientos se pueden generalizar.
preguntas generadoras, así se despierta su interés y se
Paso 5. Procedimientos similares
contextualiza el contenido científico en una situación real.
En este paso se plantean en el Libro de texto, ejercicios
En este paso, las y los niños, deben saber cuáles son los
similares al trabajado con anterioridad, y se manda
datos que se dan, qué es lo que queremos averiguar, cuáles a las niñas y los niños al cuaderno de apuntes a que
son las condiciones y si esas condiciones son suficientes los resuelvan.
para resolver el problema.
Paso 6. Refuerzo
La o el docente presenta la situación o ilustración, lee las
preguntas a las y los estudiantes y escucha las respuestas En este paso las y los niños son remitidos al Cuaderno de
sin corregir a las y los niños en ese momento. ejercicios, donde se encuentran ejercicios y problemas
relacionados con el contenido desarrollado en la clase.
Paso 2. Escritura del PO
Es muy importante distinguir entre ejercicio y problema.
Las y los niños escriben en notación matemática la operación Un ejercicio es aquella situación en la que una vez
tentativa que los llevará a la solución. identificada la técnica que precisa, hay que aplicarla en
En este paso, se analiza y reflexiona sobre la conveniencia forma correcta.
de hacer la propuesta de solución, las conexiones que Un problema es una situación cuyos términos y propósitos
existen entre los datos y lo que queremos encontrar. Al final son globalmente comprensibles por la o el alumno, pero no
de este paso ya se tiene un plan tentativo de solución. sabe, de momento, como abordarlos.

61
Programa de estudio de quinto grado
Recomendaciones previas para el desarrollo de una clase aula para detectar las dificultades en las alumnas y
los alumnos.
1. Haga una lectura del Libro de texto y de la Guía
metodológica. 3. Cuando la mayoría ha terminado, enviar a la pizarra
en forma simultánea a varias niñas y niños, para que
2. Verifique los materiales a utilizar.
escriban como lo hicieron.
Hay dos tipos de clases:
4. Las y los niños revisan los procedimientos que se han
a. La que introduce un nuevo conocimiento. escrito en la pizarra. No borrar las respuestas equivocadas,
preguntar la opinión de otras niñas y niños para corregirlas,
b. La que fija conocimientos. valorando el esfuerzo y reconociendo el razonamiento
Sugerencias para una clase de introducción de de la o el niño que las presentó.
conocimientos Los errores en Matemática no deben considerarse como
1. Iniciar con una pregunta o un problema, acorde al algo negativo, sino una etapa normal del proceso. A partir de
indicador de logro. los errores se puede iniciar con mayor reflexión el proceso
de descubrimiento, discusión y construcción que permite
2. Permitir que las y los niños resuelvan el problema. que las y los niños aprendan. No hay que perder de vista,
que se aprende Matemática haciendo Matemática; para
3. Propiciar que las y los niños presenten sus ideas.
conseguirlo hay que utilizar distintos tipos de actividades
4. Orientar a las y los niños en la discusión sobre las ideas que permitan a las y los niños elaborar sus propios
presentadas. resultados, y esto conlleva tener equivocaciones; por lo que
deben aprender también a evaluar sus resultados. Esta
5. Concluir la discusión y presentar la forma de resolver propuesta metodológica propicia que las y los niños ejerzan
el problema. su protagonismo y autonomía y que aprendan matemática
6. Resolver el problema y evaluar el nivel de comprensión. de una manera divertida. Así se fortalece la adquisición y
desarrollo de conocimientos, habilidades y actitudes que les
Sugerencias para una clase de fijación de conocimientos servirán para seguir estudios y prepararse para la vida.
1. Si los ejercicios que se utilizan contienen algo nuevo
en la forma de calcular, resolverlos con el libro de Lineamientos de evaluación
texto cerrado. Diagnóstica
2. Después de que las y los niños han entendido cómo En quinto grado, la o el docente debe valerse de la
se resuelven los ejercicios, darles otros ejercicios para observación, entrevistas y ejercicios escritos para
que los resuelvan de manera individual y recorrer el diagnosticar los aprendizajes con los que sus estudiantes
inician el año escolar.
62
Programa de estudio de quinto grado
Es necesario estar consciente de los conocimientos previos la discusión de los planteamientos operativos y los cálculos
con los que inician el año escolar y para ello es importante realizados al resolver el problema, en la resolución de los
enfrentar a las y los niños a situaciones donde apliquen ejercicios de lección, etc.
los conocimientos y evidencien las habilidades básicas
necesarias para el desarrollo de los contenidos. La Guía metodológica de Matemática 5 sugiere
constantemente la observación del desempeño del
Es importante detectar necesidades de aprendizaje así alumnado como parte de la evaluación formativa con frases
como cualidades y habilidades de las y los estudiantes para como: “Que comprueben que...”, “Que las niñas y los niños
fomentar su desarrollo. De esta manera se puede mejorar descubran que...”, “Que reconozcan el concepto de...”,
la planificación de la práctica docente de acuerdo a la “Que observen que...”, etc.
realidad del grupo. La evaluación diagnóstica se realiza al
comienzo de un período de aprendizaje, no solo al inicio del La evaluación formativa requiere que la y el docente
año escolar. utilicen los errores del alumnado para comprender su
En algunas unidades de Libro de texto “Matemática 5”, razonamiento. Por lo tanto, no se deben corregir los errores
se encuentra un apartado llamado “Recordemos” con en forma inmediata, sino preguntarles como pensaron
ejercicios que son la base para el desarrollo de la unidad. para poder apoyarles en la reflexión y la búsqueda de la
respuesta correcta con la participación de sus compañeras
Formativa y compañeros.
La evaluación formativa se tiene que hacer en forma Al revisar los cuadernos debe tomarse en cuenta que las
continua, y el desarrollo de la clase se presta para ir sobre correcciones tengan una intención formativa: valorar el
la marcha controlando el logro de los indicadores de la esfuerzo realizado y brindar recomendaciones para asegurar
lección. La observación durante el análisis, planteamiento el aprendizaje. Por ejemplo, al inicio de un contenido casi
y desarrollo de situaciones problema durante la clase, nos siempre se presenta un problema o situación, por lo que,
sirve para comprobar y determinar el nivel de aprendizaje al revisar el cuaderno de la niña o del niño debe tenerse en
de las y los niños para retroalimentar a los que lo necesitan cuenta el planteamiento del razonamiento de la situación,
y lograr la competencia. el planteamiento de la operación (PO), y la respuesta.
La evaluación formativa será el principal referente para Estas acciones deberán ser parte de la práctica de la y el
ofrecer refuerzo académico. Este debe llevarse a cabo docente con el propósito de detectar avances, posibilidades,
antes de aplicar evaluaciones sumativas, es decir, antes de limitaciones y reorientar el proceso de enseñanza
asignar calificaciones. aprendizaje si es necesario, de esta forma la evaluación
estará al servicio de los aprendizajes.
Es importante evaluar aprovechando los momentos que
sean pertinentes para determinar lo que las y los niños han La evaluación formativa valora los aprendizajes alcanzados
aprendido, por ejemplo, al interpretar el problema y tratar de cada niña o niño, tomando en cuenta indicadores de
de resolverlo de manera individual, cuando participan en

63
Programa de estudio de quinto grado
logros definidos en cada unidad didáctica. Se han resaltado Criterios de evaluación
indicadores prioritarios que son claves en la unidad.
Algunas veces las y los estudiantes tendrán dificultades en Los criterios que se establezcan para adjudicar la nota
un indicador de logro porque no se aseguró el aprendizaje deben considerar aspectos representativos del aprendizaje.
referido en un indicador previo, que constituye un Si se valora el cuaderno del estudiante para efectos de
prerrequisito. Por ejemplo, el estudiante podrá descomponer calificación, se recomienda valorar criterios como los
un número en sus factores primos, si el estudiante clasifica siguientes:
con exactitud los números primos y compuestos. Utilización de un proceso lógico: planteamiento de la
La evaluación formativa es determinante. Se reitera: se situación, planteamiento de la operación (PO), validez de
deben monitorear los avances y cumplimientos de las las operaciones y la presentación de la respuesta a la
actividades, prestando atención individual a las niñas y los situación problema.
niños que más necesiten apoyo. Seguimiento de indicaciones.
Sumativa Corrección de los errores, etc.
La evaluación sumativa se planificará a partir de indicadores Para la actividad de integración se recomienda utilizar la
de logro y criterios de evaluación correspondientes a rúbrica (Cuadro donde se relacionan criterios e indicadores
las competencias. Se deberán incluir actividades de para evaluar la actividad de integración)
evaluación integradoras, que constituyan situaciones
de resolución de problemas más o menos cercanos a El indicador de logro se considera como el desempeño
la realidad y aplicación de los tres tipos de contenidos máximo esperado, a partir de éste se deducen desempeños
(conceptuales, procedimentales y actitudinales) de forma de menor complejidad y se establecen rangos numéricos
interrelacionada. de los cuales se obtiene la nota. Ver ejemplo en Evaluación
al servicio del aprendizaje.
Las pruebas escritas como instrumentos de evaluación
Para pruebas escritas se recomienda, entre otros criterios,
sumativa deben considerar los indicadores de logro
los siguientes:
priorizados y en ningún momento ser el único instrumento
para la asignación de notas. El razonamiento lógico.
En los casos de estudiantes con necesidades educativas Capacidad de comprensión.
especiales, se deberán incluir actividades de evaluación
individualizadas que les permitan demostrar sus Aplicación de algoritmos.
competencias. Coherencia y otros.

64
Programa de estudio de quinto grado
Objetivo UNIDAD 1
¸ Encontrar el mínimo común múltiplo y el máximo común divisor de dos números usando
con destreza la composición y descomposición de números naturales para resolver con ENCONTREMOS
satisfacción problemas de la vida cotidiana que requieren de su aplicación.
MÚLTIPLOS Y
DIVISORES COMUNES
Tiempo probable: 17 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Números pares e Clasificación de números Entusiasmo en la 1.1 Clasifica los números en
impares. en pares e impares. clasificación de números pares e impares por el residuo
pares e impares. obtenido al dividir entre dos,
con entusiasmo.

Divisibilidad. Deducción y aplicación Interés por aplicar la regla 1.2


1 Deduce y aplica la regla de
Divisibilidad entre dos. de la regla de divisibilidad de divisibilidad entre dos. la divisibilidad entre dos, con
entre dos. interés.
Divisibilidad entre diez
y cinco. Deducción y aplicación Seguridad al aplicar la 1.3
1 Deduce y aplica la regla de la
de la regla de divisibilidad regla de divisibilidad entre divisibilidad entre diez y cinco,
Divisibilidad entre tres. entre diez y cinco. diez y cinco. con seguridad.
Deducción y aplicación Seguridad al aplicar la 1.4
1 Deduce y aplica la regla de
de la regla de divisibilidad regla de divisibilidad la divisibilidad entre tres, con
entre tres. entre tres. seguridad.

65
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Resolución de problemas Trabajo en equipo al 1.5 Resuelve problemas que
que involucran resolver problemas que involucran divisibilidad,
divisibilidad. involucran divisibilidad. trabajando en equipo.

Mínimo común múltiplo Determinación de los Seguridad al determinar 1.6


1 Determina los múltiplos de un
(mcm). múltiplos de un número. los múltiplos de un número, con seguridad.
número.
Deducción y aplicación Interés en deducir y aplicar 1.7
1 Deduce y aplica la regla para
de la regla para hallar el la regla para hallar el hallar el mcm de dos números,
mcm de dos números. mcm. con interés.
Identificación de mcm Seguridad al identificar el 1.8 Encuentra el mcm de dos
1
entre los múltiplos mcm entre los múltiplos números menores que 100,
comunes de dos números. comunes de dos números. identificándolo entre los divisores
comunes, con seguridad.
Resolución de problemas Dedicación al resolver 1.9 Resuelve problemas aplicando
1
aplicando el mcm. problemas aplicando el el mcm, con dedicación.
mcm.

Máximo común divisor Determinación los Seguridad al determinar 1.10 Determina los divisores de un
1
(mcd). divisores de un número los divisores de un número, con seguridad.
con seguridad. número. 1.11 Deduce y aplica la regla para
1
Deducción y aplicación Confianza al deducir y hallar el mcd de dos números,
de la regla para hallar el aplicar la regla para hallar con confianza.
mcd de dos números. el mcd de dos números.

66
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Resolución de problemas Dedicación al resolver 1.12 Resuelve problemas aplicando
aplicando el mcd. problemas aplicando el el mcd, con dedicación.
mcm.

Números primos y Deducción y explicación Interés por deducir y 1


1.13 Deduce y explica el número
compuestos. de números primos. explicar un número primo. primo, con interés.
Criba de Eratóstenes.
Deducción y explicación 1.14 Deduce y explica el número
1
de números. compuesto, con interés.

Construcción y uso de la Dedicación en la 1.15 Construye y usa la Criba de


1
Criba de Eratóstenes. construcción y uso de la Eratóstenes para determinar los
Criba de Eratóstenes. números primos menores que
100, con dedicación.

Factores primos. Descomposición de un Seguridad al descomponer 1


1.16 Descompone un número como
Descomposición factorial. número en sus factores un número como producto producto de sus factores primos,
primos. de sus factores primos con seguridad.
Expresión de los divisores Confianza al expresar los 1.17 Expresa los divisores de un
1
de un número como divisores de un número número como productos de
producto de números como producto de números primos, con confianza.
primos. números primos.
Utilización de la Dedicación al utilizar 1.18 Encuentra divisores comunes
1
descomposición en la descomposición en de dos números menores que
factores primos para factores primos para 100 usando la descomposición
hallar divisores comunes hallar divisores comunes en factores primos, con
de dos números menores de dos números menores dedicación.
que 100. que 100.

67
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Utilización de la Dedicación al utilizar 1.19 Encuentra los múltiplos
descomposición en la descomposición en comunes de dos números
factores primos para factores primos para menores que 100 usando la
hallar múltiplos comunes hallar múltiplos comunes descomposición en factores
de dos números menores de dos números menores primos, con dedicación.
que 100. que 100.
Resolución de Valoración por la utilidad 1.20 Calcula el mcm y el mcd a partir
problemas utilizando de los factores primos de los factores primos, valorando
la descomposición en en el cálculo del mcm y su uso.
factores primos para hallar el mcd.
el mcm y el mcd de dos
números. 1.21 Resuelve problemas utilizando
la descomposición en factores
primos para hallar el mcm y el
mcd de dos números.

68
Programa de estudio de quinto grado
Objetivo UNIDAD 2
¸ Identificar las características de la suma de ángulos internos de triángulos y cuadriláteros
y las relaciones entre ángulos formados bajo diferentes condiciones, por medio de
actividades de manipulación e investigación, y utilizarlas con seguridad para la
RELACIONEMOS
identificación de polígonos y otras figuras que rodean su entorno.
ÁNGULOS

Tiempo probable: 10 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ángulos. Medición de los ángulos Precisión al medir ángulos 2
2.1 Mide ángulos internos de un
internos de un triángulo. internos de un triángulo. triángulo, con precisión.
Ángulos internos de un
triángulo. Verificación de que la Confianza al comprobar 2.2 Verifica que la suma de
2
suma de los ángulos que la suma de la medida los ángulos internos de un
internos de un triángulo de los ángulos internos de triángulo es de 180º, con
es 180º. un triángulo es de 180º. confianza.
Participación activa en el 2.3 Encuentra la medida de uno de
2
Cálculo de la medida de cálculo de la medida de los ángulos internos del triángulo
un ángulo interno de un un ángulo interno de un si conoce la medida de los
triángulo a partir de la triángulo a partir de la otros dos ángulos, participando
medida de los otros medida de los otros activamente en ello.
dos ángulos. dos ángulos.

69
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ángulos internos de un Medición de los Precisión al medir 2
2.4 Mide ángulos internos de un
cuadrilátero. ángulos internos de un ángulos internos de un cuadrilátero, con precisión.
cuadrilátero. cuadrilátero.
Verificación de que la Interés por comprobar que 2.5 Verifica que la suma de
2
suma de los ángulos la suma de los ángulos los ángulos internos de un
internos de un cuadrilátero internos de un cuadrilátero cuadrilátero es de 360º, con
es 360º. es 360º. interés.
Cálculo de la medida de Dedicación para calcular 2.6 Encuentra la medida de uno
2
un ángulo interno de un la medida de un ángulo de los ángulos internos del
cuadrilátero a partir de interno de un cuadrilátero cuadrilátero si conoce la medida
la medida de los otros a partir de la medida de de los otros ángulos, con
ángulos. los otros ángulos. dedicación.

Ángulos complementarios. Deducción de la Precisión al deducir 2.7 Calcula la medida de un


2
medida de ángulos la medida de ángulos ángulo complementario a
complementarios. complementarios. partir de un ángulo conocido.
Uso de la regla y del Precisión al trazar 2.8 Traza ángulos complementarios
2
compás en el trazo de ángulos complementarios utilizando con precisión regla y
ángulos complementarios. utilizando regla y compás. transportador.

Ángulos suplementarios. Deducción de la Precisión al deducir la 2.9


2 Encuentra mediante el cálculo la
medida de los ángulos medida de los ángulos medida del ángulo suplementario
suplementarios. suplementarios. a un ángulo dado, con precisión.
Uso de la regla y del Precisión al trazar ángulos 2.10
2 Traza ángulos suplementarios
compás en el trazo de suplementarios utilizando utilizando con precisión regla y
ángulos suplementarios. regla y compás. transportador.

70
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ángulos opuestos por el Identificación de ángulos Interés en identificar 2
2.11 Identifica ángulos opuestos
vértice. opuestos por el vértice. ángulos opuestos por el por el vértice, con interés.
vértice.
Medición de los ángulos Exactitud al medir ángulos 2.12 Mide los ángulos opuestos por el
2
opuestos por el vértice. opuestos por el vértice. vértice, con exactitud.

Ángulos adyacentes. Identificación de ángulos Seguridad al identificar 2


2.13 Identifica ángulos adyacentes,
adyacentes. ángulos adyacentes. con seguridad.
Cálculo de la medida Interés por calcular la 2.14 Encuentra la medida de tres
2
de los ángulos entre dos medida de los ángulos de los ángulos comprendidos
rectas, conociendo al entre dos rectas cuando entre dos rectas a partir de uno
menos uno. se conoce la medida de al conocido, con interés.
menos uno.

71
Programa de estudio de quinto grado
Objetivo UNIDAD 3
¸ Utilizar el cálculo vertical de números decimales, estableciendo adecuadamente el valor
posicional, para resolver con esmero y precisión, problemas de la vida cotidiana.
UTILICEMOS
NÚMEROS DECIMALES

Tiempo probable: 41 horas clase

CONTENIDOS INDICADORES DE LOGRO

CONCEPTUALES PROCEDIMENTALES ACTITUDINALES


Multiplicación de Multiplicación de un Exactitud al multiplicar un 3.1 Multiplica un número decimal
números decimales. número decimal hasta con número decimal con un hasta con décimas, por un
décimas, por un número número natural. número natural de una cifra,
CDU.d x n.n con exactitud.
natural de una cifra.
DU.d x n.n 3.2 Multiplica números decimales,
Multiplicación de números
U.d x n.n decimales, hasta las hasta las décimas, por números
0.d x n.n décimas, por números naturales de dos o tres cifras,
naturales de dos o con exactitud.
tres cifras.

U.dc x n.n Multiplicación de números Precisión al multiplicar 3.3 Multiplica números decimales,
3
DU.dc x n.n decimales, hasta las números decimales, hasta hasta las milésimas, por
milésimas, por números las milésimas, por números naturales de hasta
U.dcm x n.n naturales de hasta números naturales de tres cifras, con precisión.
DU.dcm x n.n tres cifras. hasta tres cifras.

72
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Aplicación del sentido Seguridad al aplicar 3.4 Aplica el sentido de la
de la multiplicación para el sentido de la multiplicación para encontrar el
encontrar el producto de multiplicación para producto de números naturales
números naturales por encontrar el producto de por decimales, con seguridad.
decimales. números naturales por
decimales.
Resolución de problemas 3.5 Resuelve problemas utilizando el
utilizando el sentido de la sentido de la multiplicación.
multiplicación

Ud x Ud Multiplicación de un Confianza al multiplicar 3


3.6 Multiplica un número decimal
Udc x Ud número decimal por un un número decimal por un por un número decimal, con
número decimal, con número decimal. resultados hasta las centésimas,
Udc x 0d resultados hasta las con confianza.
Ud x Ud centésimas.
0d x 0d Multiplicación de dos 3.7
3 Multiplica dos números
números decimales con decimales con resultados hasta
0dc x 0d resultados hasta las las milésimas, con confianza.
milésimas.
Explicación de que Seguridad al explicar que 3.8
3 Explica que cuando el
cuando el multiplicador cuando el multiplicador multiplicador es menor que 1,
es menor que 1, el es menor que 1, el el producto es menor que el
producto es menor que el producto es menor que el multiplicando, con seguridad.
multiplicando. multiplicando.
Explicación del proceso de Seguridad al explicar 3.9
3 Explica el proceso de agrupar
agrupar y/o tachar ceros el proceso de agrupar y/o tachar ceros en el producto
en el producto y la manera y/o tachar ceros en el y la manera correcta de la
correcta de colocar el producto y la manera colocación del punto decimal,
punto decimal. correcta de la colocación con seguridad.
del punto decimal.

73
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Área de triángulos con Aplicación de la Confianza al aplicar la 3
3.10 Aplica la multiplicación de
lados decimales. multiplicación de dos multiplicación de dos dos números decimales para
números decimales para números decimales para encontrar el área de un
encontrar el área de un encontrar el área de un rectángulo, con confianza.
rectángulo rectángulo
Propiedades: conmutativa, Aplicación de las Confianza al aplicar las 3.11 Aplica las propiedades
3
distributiva y asociativa. propiedades conmutativa, propiedades conmutativa, conmutativa, distributiva y
distributiva y asociativa distributiva y asociativa asociativa de la multiplicación de
de la multiplicación de de la multiplicación de números decimales para facilitar
números decimales para números decimales para el cálculo, con confianza.
facilitar el cálculo. facilitar el cálculo.
Resolución de problemas Trabajo en equipo para 3.12 Resuelve problemas
3
aplicando la multiplicación resolver problemas aplicando la multiplicación
de dos números aplicando la multiplicación de dos números decimales,
decimales. de dos números decimales. trabajando en equipo.

División. División de números Seguridad al dividir 3.13 Divide números decimales hasta
3
U.d ÷ n.n decimales hasta las números decimales las décimas, entre números
décimas, entre números hasta las décimas, entre naturales de una cifra, con
U.dc ÷ n.n naturales de una cifra. números naturales de una seguridad.
U.dcm ÷ n.n cifra, con seguridad.
Valor posicional División de números Exactitud al dividir 3.14 Divide números decimales
3
del residuo. decimales hasta las números decimales hasta hasta las décimas entre un
décimas entre un natural las décimas entre un natural menor que 1,000 con
menor que 1,000. natural menor que 1,000 exactitud.
con exactitud.

74
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ud ÷ U División de números Dedicación al dividir 3
3.15 Divide números decimales hasta
decimales hasta las números decimales las milésimas entre números
DUd ÷ DU
milésimas entre números hasta las milésimas naturales menores que 1,000
D0d ÷ DU naturales menores que entre números naturales agregando ceros para obtener el
Udc ÷ U 1,000 agregando ceros menores que 1,000 cociente, con dedicación.
para obtener el cociente. agregando ceros para
0dc ÷ U obtener el cociente.
0dc ÷ DU Confianza al establecer 3.16 Establece el valor posicional
3
Establecimiento del valor
00c ÷ U posicional del residuo al el valor posicional del del residuo al dividir hasta las
dividir hasta las décimas. residuo al dividir hasta las décimas, con confianza.
décimas.
División de números Constancia al dividir 3.17 Divide números decimales
3
decimales agregando números decimales agregando ceros al dividendo
ceros al dividendo después agregando ceros al después de la última cifra
de la última cifra decimal. dividendo después de la decimal, con constancia.
última cifra decimal.
Resolución de problemas Trabajo en equipo al 3.18 Resuelve problemas que
3
que requieran la división resolver problemas que requieran la división de un
de un número decimal requieran la división de un número decimal entre un
entre un número natural. número decimal entre un número natural, trabajando
número natural. en equipo.

75
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Udc ÷ Ud División vertical de dos Confianza al dividir 3
3.19 Utiliza el cálculo vertical de
números decimales verticalmente dos números la división de dos números
U0c ÷ Ud decimales trasladando el
trasladando el punto decimales trasladando
Udcm ÷ Udc decimal en el cociente, el punto decimal en el punto decimal en el cociente,
convirtiéndolo en número cociente, convirtiéndolo en convirtiéndolo en número entero,
Udcm ÷ Udc con confianza.
entero. número entero.
Udcm ÷ Ud
0dcm ÷ Ud
U ÷ Udc
Udc ÷ 0d
Udcm ÷ 0dcm
Ud ÷ 0d

Redondeo
R d d dde un cociente. Resolución
R l dde problemas
bl T b en equipo all
Trabajo 3.20 Resuelve problemas que
3
que requieren de la resolver problemas que requieren de la división
división entre números requieren de la división entre números decimales,
decimales, interpretando el entre números decimales, interpretando el cociente,
cociente. interpretando el cociente. trabajando en equipo.
División de números Dedicación al dividir
decimales colocando 3.21 Divide números decimales
3
números decimales
cero en el cociente o en colocando cero en el cociente
colocando cero en el
el dividendo cuando sea o en el dividendo cuando sea
cociente o en el dividendo
necesario. necesario, con dedicación.
cuando sea necesario.

76
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
División de un entero entre Dedicación al dividir un 3
3.22 Divide un entero entre un
un decimal agregando entero entre un decimal decimal agregando tantos
tantos ceros al dividiendo agregando tantos ceros ceros al dividiendo como
como decimales tiene el al dividiendo como decimales tiene el divisor,
divisor. decimales tiene el divisor. con dedicación.

Explicación de la relación Seguridad al explicar la 3.23 Explica la relación entre el


3
entre el dividiendo y el relación entre el dividiendo dividiendo y el cociente cuando
cociente cuando el divisor y el cociente cuando el el divisor es menor que 1,
es menor que 1. divisor es menor que 1. con seguridad.
Resolución de problemas Constancia en la 3.24 Resuelve problemas de división
3
de división incluida resolución de problemas incluida, aplicando lo aprendido
aplicando lo aprendido en de división incluida en la división equitativa, con
la división equitativa. aplicando lo aprendido en constancia.
la división equitativa.
Resolución de problemas Trabajo en equipo al 3.25 Resuelve problemas utilizando
3
utilizando la división de resolver problemas la división de dos números
dos números decimales utilizando la división de decimales estableciendo el
estableciendo el valor dos números decimales valor posicional del residuo,
posicional del residuo. estableciendo el valor con seguridad, trabajando
posicional del residuo. en equipo.

Utilización del redondeo Seguridad al utilizar el 3.26 Redondea un cociente hasta las
3
en el cociente. redondeo de un cociente. décimas, con seguridad.
3.27 Redondea un cociente hasta las
3
centésimas, con seguridad.
3.28 Redondea un cociente hasta las
3
milésimas, con seguridad.

77
Programa de estudio de quinto grado
Objetivos UNIDAD 4
¸ Establecer relaciones de longitud entre el radio, el diámetro y la circunferencia
determinando fórmulas que permitan encontrar una de ellas a partir de otra para resolver
con interés problemas de perímetro de círculos o sectores circulares de objetos o lugares
del entorno.
DIBUJEMOS CON
¸ Clasificar los polígonos en regulares e irregulares construyendo mosaicos con creatividad CÍRCULOS Y POLÍGONOS
para utilizarlos en la decoración de objetos y espacios de la escuela y el hogar.

Tiempo probable: 20 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Círculo. Comparación de la Interés en la comparación 4
4.1 Establece por comparación
diferencia entre círculo y de la diferencia entre la diferencia entre círculo y
- Circunferencia. circunferencia, con interés.
circunferencia. círculo y circunferencia.
- Diámetro.
Ubicación y trazo del Exactitud al ubicar y
- Radio. centro, diámetro, cuerda y trazar el centro, diámetro, 4.2 Ubica y traza centro,
4
- Centro. radio de la circunferencia. cuerda y radio de la diámetro, cuerda y radio de la
circunferencia. circunferencia, con exactitud.
- Arco.
Cálculo del diámetro a Exactitud al calcular el
- Cuerda. partir del radio o viceversa. diámetro a partir del radio 4.3
4 Calcula el diámetro a partir del
- Ángulo central. o viceversa. radio o viceversa, con exactitud.
Trazo de cuerdas, arcos Precisión al trazar cuerdas,
y ángulos centrales sin arcos y ángulos centrales 4.4
4 Traza cuerdas, arcos y ángulos
utilizar compás. sin utilizar compás. centrales sin utilizar compás, con
precisión.

78
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Trazo de circunferencias Precisión al trazar 4
4.5 Traza circunferencias con un
con un radio determinado circunferencias con un radio determinado usando
usando compás. radio determinado usando compás con seguridad.
compás.
Utilización del compás Seguridad al utilizar el 4.6 Utiliza el compás para
4
para comparar longitudes, compás, para comparar comparar longitudes, dividir
dividir longitudes en longitudes. longitudes en segmentos
segmentos iguales y medir iguales y medir la longitud de
la longitud de una línea una línea quebrada sobre una
quebrada sobre una recta. recta, con seguridad.
Dibujo de figuras usando Creatividad al dibujar 4.7 Dibuja figuras usando regla y
4
regla y compás. figuras usando regla y compás, con creatividad.
compás.
Utilización de la regla y Creatividad para utilizar 4.8
4 Utiliza la regla y compás para
compás para el diseño de la regla y compás para el hacer diseños propios, con
figuras. diseño de figuras. creatividad.

π (Pi). Relación entre el diámetro Interés en relacionar el 4.9 Establece la relación entre
y perímetro de una diámetro y perímetro de el diámetro y perímetro de
circunferencia, con un una circunferencia, con una circunferencia, con un
número aproximado un número aproximado número aproximado de π (Pi),
de π (Pi). de π (Pi). con interés.
Asociación del valor Interés en asociar el valor 4.10 Asocia el valor de π con el
de π con el resultado de π con el resultado resultado de dividir “longitud de
de dividir “longitud de de dividir “longitud de la circunferencia ÷ diámetro”,
la circunferencia ÷ la circunferencia ÷ con interés.
diámetro”. diámetro”.

79
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Longitud de la Utilización de la fórmula Seguridad al aplicar la 4.11 Aplica la fórmula para encontrar
circunferencia. para encontrar la longitud fórmula para encontrar la longitud de una circunferencia,
de una circunferencia. la longitud de una con seguridad.
- Fórmulas:
circunferencia.
- Circunferencia =
Resolución de problemas Trabaja en equipo para 4.12 Resuelve problemas que
diámetro x π.
que involucran el resolver problemas que involucran el perímetro de
- Circunferencia = perímetro de la involucran el perímetro la circunferencia, trabajando
radio x 2 x π. circunferencia. de la circunferencia. en equipo.

Sector. Identificación de los Dedicación en identificar 4.13 Identifica los sectores, ángulos
4
- Ángulo central. sectores, ángulos centrales los sectores, ángulos centrales y semicírculos de un
y semicírculos de un centrales y semicírculos de círculo, con dedicación.
- Semicírculos. círculo. un círculo.
- Perímetro de un sector. Trazo de sectores Precisión en el trazo 4.14 Traza sectores circulares y
4
circulares y semicirculares de sectores circulares y semicirculares conociendo
conociendo el radio y el semicirculares conociendo el radio y el ángulo central,
ángulo central. el radio y el ángulo con precisión.
central.
Utilización del radio y Confianza en el uso 4.15 Encuentra el perímetro de un
4
el ángulo central para del radio y el ángulo sector a partir del radio y el
encontrar el perímetro de central para encontrar el ángulo central, con confianza.
un sector. perímetro de un sector.

Polígonos regulares Aplicación del concepto Seguridad al aplicar el 4.16 Aplica el concepto de polígono
4
Polígonos irregulares. de polígono regular para concepto de polígono regular para identificarlos,
identificarlos. regular para identificarlos. con seguridad.
Polígonos inscritos.

80
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Resolución de problemas Perseverancia al resolver 4
4.17 Resuelve problemas
que involucran círculo y problemas que involucran que involucran círculo
circunferencia. círculo y circunferencia. y circunferencia, con
perseverancia.
Identificación de polígonos Claridad en la 4.18 Identifica, con claridad,
4
regulares. identificación de polígonos polígonos regulares, con
regulares. claridad.
Construcción de polígonos Dedicación al construir 4.19 Construye polígonos regulares
4
regulares con materiales polígonos regulares con con materiales del ambiente
del ambiente utilizando el materiales del ambiente utilizando el círculo como base,
círculo como base. utilizando el círculo como con dedicación.
base.
Resolución problemas Seguridad al resolver 4.20 Resuelve problemas utilizando
4
utilizando polígonos problemas utilizando polígonos regulares, con
regulares. polígonos regulares. seguridad.
Construcción de mosaicos Creatividad al construir 4.21 Construye diseños de mosaicos
4
utilizando figuras de mosaicos utilizando figuras utilizando figuras de polígonos
polígonos regulares. de polígonos regulares. regulares, con creatividad.

81
Programa de estudio de quinto grado
Objetivo UNIDAD 5
¸ Utilizar el mínimo común múltiplo y las fracciones equivalentes al sumar y restar fracciones
propias, impropias y mixtas; simplificando resultados y aplicándolos para dar una
respuesta adecuada a problemas del entorno. UTILICEMOS LAS
FRACCIONES
Tiempo probable: 20 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Fracciones y decimales. Representación como Interés en representar 5
5.1 Expresa como fracción el cociente
fracción del cociente de la como fracción el cociente de la división de números
Representación de
división de dos números de la división de dos naturales, con interés.
fracciones.
naturales. números naturales.

Conversión de decimales. Conversión de números Dedicación al convertir 5.2


5 Convierte a fracción un número
Conversión de fracciones. decimales hasta las números decimales hasta decimal hasta las décimas,
décimas en fracciones, las décimas en fracciones, simplificando a su mínima
simplificando el resultado. simplificando el resultado. expresión, con dedicación.
Conversión de fracciones Dedicación al convertir 5.3
5 Convierte una fracción con
con denominador 2, 5 y fracciones con denominador 2, 5 ó 10 en
10 en números decimales. denominador 2, 5 y 10 en número decimal, con dedicación.
números decimales.

82
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Conversión de números Dedicación al convertir 5.4 Convierte a fracción un
decimales hasta las números decimales número decimal hasta las
milésimas en fracciones. hasta las milésimas en milésimas, con dedicación.
fracciones.

Adición de fracciones Adición de fracciones con Interés en sumar 5.5 Efectúa y explica la adición
heterogéneas. diferente denominador fracciones. de fracciones con diferente
utilizando gráficas. denominador utilizando
gráficas, con interés.

Adición de dos 5.6 Suma dos fracciones propias


fracciones propias con con diferente denominador
diferente denominador y y resultado menor que 1,
resultado menor que 1, simplificando el resultado, con
simplificando el resultado. interés.

Adición de fracciones Adición de números mixtos Seguridad al sumar 5.7 Suma fracciones mixtas, sin llevar
mixtas. sin llevar de la fracción a números mixtos. de la fracción a la parte entera,
la parte entera. con seguridad.

Adición de números mixtos 5.8 Suma fracciones mixtas llevando


llevando de la fracción a de la fracción a la parte entera,
la parte entera. con seguridad.

Resolución de problemas Trabaja en equipo para 5.9 Resuelve problemas que


que involucran adición de resolver problemas que involucran adición de
fracciones. involucran adición de fracciones, trabajando en
fracciones. equipo.

83
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sustracción de fracciones Utilización de gráficas Seguridad al utilizar 5.10 Efectúa y explica la sustracción
heterogéneas. para calcular la resta de gráficas para calcular la de fracciones propias con
dos fracciones propias de resta de dos fracciones diferente denominador utilizando
diferente denominador. propias de diferente gráficas, con seguridad.
denominador.
Utilización de las Seguridad al utilizar 5.11 Resta dos fracciones propias
fracciones equivalentes fracciones equivalentes con diferente denominador,
para sustraer fracciones para sustraer fracciones simplificando el resultado, con
propias de diferentes propias de diferentes seguridad.
denominadores. denominadores.

Sustracción de fracciones Sustracción de fracciones Interés en la resta de 5.12 Resta fracciones mixtas sin prestar
mixtas con diferente mixtas sin prestar de la fracciones mixtas. de la parte entera para efectuar
denominador. parte entera para restar las la resta.
fracciones.

Sustracción de fracciones 5.13 Resta fracciones mixtas prestando


mixtas prestando de la de la parte entera para efectuar
parte entera para efectuar la resta, con interés.
la resta y simplificando.

Resolución de problemas Trabaja en equipo para 5.14 Resuelve problemas que


que involucran sustracción resolver problemas que involucran sustracción de
de fracciones. involucran sustracción de fracciones, trabajando en
fracciones. equipo.

84
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Propiedades asociativa y Aplicación de las Seguridad en la aplicación 5
5.15 Aplica las propiedades
conmutativa de la adición propiedades asociativa y de propiedades de la asociativa y conmutativa a
de fracciones. conmutativa de la adición. adición de fracciones. la adición de fracciones, con
seguridad.

85
Programa de estudio de quinto grado
Objetivos UNIDAD 6
¸ Encontrar el área de rombos, romboides y trapecios construyendo las fórmulas a partir de
la observación, descomposición y transformación de las figuras; valorando su utilidad para
dar soluciones a problemáticas del entorno que requieren de la medición de superficies ENCONTREMOS EL ÁREA
planas.
DE CUADRILÁTEROS

Tiempo probable: 10 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Cuadriláteros. Cálculo del área de un Interés en calcular el 6
6.1 Encuentra el área de
cuadrilátero utilizando una área de un cuadrilátero cuadriláteros utilizando una
Área de un
cuadrícula. utilizando una cuadrícula. cuadrícula como base, con
cuadrilátero.
interés.

Área de un romboide. Deducción y aplicación la Interés para deducir y 6.2 Deduce y aplica la fórmula para
- Fórmula: fórmula para calcular el aplicar la fórmula para calcular el área de romboides,
área de romboides. calcular el área de con interés.
- Área = base x altura romboides.
- Área de un rombo Identificación de la altura Seguridad al identificar 6.3 Identifica la altura del
- Fórmula: del romboide cuando es la altura del romboide romboide cuando es externa
externa y aplicación de la cuando es externa y y aplica la fórmula para
- Área = (Diagonal fórmula para encontrar su aplicar la fórmula para encontrar su área, con
mayor x diagonal área. encontrar su área. seguridad.
menor) ÷ 2
- Área de un trapecio.

86
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Utilización de diversas Confianza al seleccionar 6.4 Encuentra el área del rombo
estrategias para encontrar diversas estrategias para usando diversas estrategias,
el área del rombo. encontrar el área del con criterio.
rombo
Deducción y aplicación de Interés para deducir y 6.5 Deduce y aplica la fórmula
la fórmula para calcular el aplicar la fórmula para para calcular el área de rombos,
área de rombos. calcular el área de con interés.
rombos.

Área del trapecio. Utilización de diversas Confianza al seleccionar 6.6


6 Encuentra el área del trapecio
Fórmula: estrategias para encontrar diversas estrategias para usando diversas estrategias,
el área del trapecio. encontrar el área del con confianza.
Área = (base mayor + trapecio.
base menor) x altura ÷ 2
Deducción de la fórmula Dedicación al deducir 6.7 Deduce la fórmula del área
6
del área del trapecio y la fórmula del área del del trapecio y la aplica
aplicación de la fórmula trapecio y aplicación de la al cálculo de áreas, con
al calcular áreas. fórmula al calcular áreas. dedicación.
Descomposición del área Dedicación al 6.8 Calcula el área de
6
de figuras en triángulos descomponer el área de figuras geométricas
para calcular su área. figuras en triángulos, para descomponiéndolas en
calcularla. triángulos, con dedicación.
Resolución de problemas Trabaja en equipo al 6.9 Resuelve problemas que
6
que involucren el cálculo resolver problemas que involucren el cálculo de áreas
de áreas de cuadriláteros. involucren el cálculo de de cuadriláteros.
áreas de cuadriláteros.

87
Programa de estudio de quinto grado
Objetivos UNIDAD 7
¸ Trasladar figuras realizando con seguridad desplazamientos horizontales y/o verticales
de sus vértices sobre cuadrículas y utilizar esta habilidad en la decoración del entorno.
¸ Identificar la simetría en una figura o entre dos figuras a partir del eje de simetría interno
o externo, utilizando este conocimiento en el trazo de figuras que encuentra en objetos TRACEMOS FIGURAS
del entorno.

Tiempo probable: 18 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Traslación de figuras Traslación horizontal y Precisión al trasladar 7.1 Traslada figuras desplazándolas
geométricas. vertical de una figura a figuras. vertical u horizontalmente, con
partir del movimiento de precisión.
sus vértices. 7.2 Traslada una figura
Traslación de una figura combinando movimientos
combinando movimientos verticales y horizontales, con
verticales y horizontales. precisión.

Figuras simétricas. Identificación de figuras Interés en identificar 7.3


7 Identifica figuras con simetría
con simetría axial. figuras con simetría axial. axial, con interés.

Eje de simetría. Clasificación de figuras Seguridad al clasificar 7.4


7 Clasifica las figuras geométricas
geométricas por su figuras geométricas por su por su simetría, con seguridad.
simetría. simetría.
Ubicación de los ejes de Precisión al ubicar los ejes 7.5 Ubica los ejes de simetría
7
simetría en las figuras de simetría en las figuras en figuras geométricas,
geométricas. geométricas. con precisión.

88
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Vértices, lados y puntos de Ubicación de vértices, Precisión al ubicar 7.6 Encuentra los vértices, lados y
figuras simétricas. lados y puntos vértices, lados y puntos puntos correspondientes en una
correspondientes de una correspondientes de una figura simétrica, con precisión.
figura simétrica. figura simétrica.
Trazo de figuras simétricas. Exactitud al trazar figuras 7.7 Traza figuras simétricas utilizando
simétricas. cuadrículas, con exactitud.
7.8 Traza figuras simétricas a partir
de líneas perpendiculares al eje
de simetría, con exactitud.
Resolución de problemas Trabajo en equipo en la 7.9 Resuelve problemas que
que involucran simetría y resolución de problemas involucran el uso de simetría
traslación. que involucran el uso de y traslación, trabajando en
simetría y traslación. equipo.

Simetría axial. Ubicación de puntos Precisión al ubicar puntos 7.10 Encuentra puntos
7
correspondientes en correspondientes en correspondientes en figuras que
figuras que tienen simetría figuras que tienen simetría tienen simetría con respecto a un
con respecto a un eje. con respecto a un eje. eje, con precisión.
Trazo de figuras que Seguridad al trazar figuras 7.11 Traza figuras que tienen simetría
7
tienen simetría con que tienen simetría con con respecto a un eje, con
respecto a un eje. respecto a un eje. seguridad.

Construcción de figuras Interés en construir figuras 7.12 Dibuja figuras con simetría
7
con simetría respecto a con simetría respecto a respecto a un eje, con interés.
un eje. un eje.
Aplicación de los Seguridad al aplicar los 7.13 Aplica los conocimientos sobre
7
conocimientos sobre conocimientos sobre simetría axial en juegos, con
simetría axial en juegos. simetría axial en juegos. seguridad.

89
Programa de estudio de quinto grado
Objetivos UNIDAD 8
¸ Organizar datos en tablas de doble entrada utilizando diferentes criterios de clasificación
para interpretar y apreciar la información que recopilamos en nuestro entorno o
encontramos publicada en los medios de comunicación.
¸ Elaborar gráficos de líneas para expresar cambios de tendencia en los datos y utilizarlos
para representar y analizar con interés informaciones del entorno que presentan relación.
INTERPRETEMOS
¸ Utilizar con seguridad la media aritmética y la mediana, ordenando los datos de menor DATOS
a mayor para interpretar una serie con datos recopilados en la escuela, la familia y la
comunidad.
¸ Combinar elementos de dos conjuntos o dos sucesos, usando diagramas de árbol para
determinar todos los posibles resultados de la ocurrencia de eventos de nuestro entorno y
considerarlos para la toma de decisiones. Tiempo probable: 20 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Datos. Organización de datos en Orden y limpieza en la 8
8.1 Organiza datos en tablas
tablas usando diferentes organización de datos. usando diferentes criterios
Organización. de clasificación, con orden y
criterios de clasificación.
Tablas de doble limpieza.
entrada. 8.2 Organiza los datos
8
Organización de los datos
Interpretación. recolectados en una tabla recolectados en una tabla de
de doble entrada. doble entrada, con orden y
limpieza.
Interpretación de datos Seguridad al interpretar 8.3 Interpreta datos organizados
8
organizados en una tabla datos organizados en una en una tabla de doble
de doble entrada. tabla de doble entrada. entrada, con seguridad.

90
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Gráficas lineales. Asociación de la Interés en asociar la 8
8.4 Asocia la gráfica de líneas con
gráfica de líneas con la gráfica de líneas con la la representación de cambios en
Nivel de cambio.
representación de cambios representación de cambios función del tiempo, con interés.
en función del tiempo. en función del tiempo.
Interpretación de los datos Confianza al interpretar los 8.5
8 Interpreta los datos presentados
presentados en una datos presentados en una en una gráfica en líneas, con
gráfica de líneas. gráfica en líneas. confianza.
Identificación de los Seguridad al identificar 8.6
8 Identifica los cambios a partir de
cambios a partir de los cambios a partir de la inclinación de los segmentos
la inclinación de los la inclinación de los en una gráfica de líneas, con
segmentos en una gráfica segmentos en una gráfica seguridad.
de líneas. de líneas.
Símbolo de corte ≈≈≈≈. Utilización del símbolo de Seguridad en el uso del 8.7
8 Utiliza el símbolo de corte en el
corte en el eje y en una símbolo de corte en el eje eje y en una gráfica de líneas,
gráfica de líneas. y en una gráfica de líneas. con seguridad.
Construcción de gráficas Dedicación al construir 8.8
8 Construye una gráfica de líneas
de líneas aplicando o no gráficas de líneas aplicando o no el símbolo para
el símbolo para indicar aplicando o no el símbolo indicar corte en el eje y, con
corte en el eje y. para indicar corte en el dedicación.
eje y.
Interpretación de gráficas Seguridad al interpretar 8.9 Lee e interpreta gráficas de
8
de líneas dobles. gráficas de líneas dobles. líneas dobles, con seguridad.

Resolución de problemas Trabajo en equipo para 8.10 Resuelve problemas aplicando


8
aplicando gráficas de resolver problemas gráficas de líneas, trabajando en
líneas. aplicando gráficas de equipo.
líneas.

91
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Moda. Reconocimiento de la Interés en reconocer la 8
8.11 Reconoce la moda de una serie
moda de una serie de moda de una serie de de datos, con interés.
datos. datos.
Mediana. Organización de datos Dedicación al ordenar 8.12 Ordena datos de menor a mayor
8
de menor a mayor para datos de menor a mayor para ubicar el dato central o
ubicar el dato central o para ubicar el dato central mediana, con dedicación.
mediana. o mediana.
Cálculo de la moda y la Perseverancia en el cálculo 8.13 Calcula la moda y la mediana en
8
mediana en una serie con de la moda y la mediana una serie con números pares de
números par de datos. en una serie con números datos, con perseverancia.
pares de datos.

Combinaciones. Combinación de Interés en combinar 8.14 Combina elementos de dos


elementos de dos elementos de dos conjuntos, haciendo arreglos de
conjuntos para encontrar conjuntos para encontrar dos elementos, con interés.
arreglos. arreglos.
Diagrama de árbol. Elaboración de diagramas Interés en elaborar 8.15 Encuentra todos los posibles
de árbol para encontrar diagramas de árbol arreglos utilizando un
todos los posibles arreglos. para encontrar todos los diagrama de árbol, con
posibles arreglos. interés.

Sucesos seguros, posibles Clasificación de sucesos Confianza, al clasificar 8.16 Clasifica sucesos en seguros,
e imposibles. en seguros, posibles e sucesos en seguros, posibles e imposibles, con
imposibles. posibles e imposibles. confianza.

92
Programa de estudio de quinto grado
Objetivos UNIDAD 9
¸ Construir prismas y pirámides, triangulares y rectangulares elaborando los patrones a partir
de las relaciones de perpendicularidad y palelismo entre aristas y caras para mejorar la
imagen tridimensional que tenemos de nuestro entorno..
ENCONTREMOS
¸ Encontrar el volumen de prismas triangulares y rectangulares aplicando la fórmula y VOLÚMENES
establecer relaciones de volumen y capacidad para aplicarlas con interés en el cálculo de las
dimensiones y la capacidad de objetos y contenedores que encontramos en la comunidad.
Tiempo probable: 24 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Prisma rectangular. Construcción de patrones Constancia al construir 9.1 Dibuja patrones del prisma
del prisma rectangular. patrones del prisma rectangular con las medidas
rectangular. adecuadas que permitan armar
una caja, con constancia.

Construcción de diversos Creatividad al construir 9.2 Construye varios patrones de


patrones de un mismo diversos patrones de un un mismo prisma rectangular,
prisma rectangular. mismo prisma. con creatividad.

Caras laterales. Identificación de Seguridad al identificar 9.3


9 Identifica las relaciones de
Bases. las relaciones de diferentes relaciones entre perpendicularidad y paralelismo
perpendicularidad y caras y aristas del prisma de las aristas en prismas
Altura. paralelismo de las aristas rectangular. rectangulares, con seguridad.
en prismas rectangulares.
Identificación y explicación 9.4
9 Identifica y explica la
de la perpendicularidad perpendicularidad entre las
entre las aristas y las caras aristas y las caras del prisma
del prisma rectangular. rectangular, con seguridad.

93
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Identificación y explicación 9.5 Identifica y explica el paralelismo
del paralelismo entre entre las caras del prisma
las caras del prisma rectangular, con seguridad.
rectangular.

Patrones. Construcción de patrones Constancia al construir 9.6


9 Elabora patrones diferentes para
- Cubo. de cubos. patrones. armar cubos, con constancia.
- Prisma triangular. Construcciones de 9.7
9 Construye un patrón para
patrones de prismas el prisma triangular, con
- Pirámides triangulares. constancia.
rectangulares.
Diferenciación entre Interés en diferenciar entre 9.8 Establece diferencias entre
9
- Pirámides triangulares. pirámides cuadrangulares pirámides cuadrangulares pirámides cuadrangulares y
y triangulares. y triangulares. triangulares, con interés.
Reconocimiento y Seguridad al reconocer y 9.9 Reconoce y explica la altura en
9
explicación de la altura explicar la altura en una una pirámide, con seguridad.
en una pirámide, con pirámide, con seguridad.
seguridad.
Construcción de Constancia al construir 9.10 Construye el patrón para armar
9
patrones de pirámides patrones de pirámides. pirámides cuadrangulares, con
cuadrangulares. constancia.
Construcción de patrones 9.11 Construye el patrón para
9
para armar pirámides armar pirámides triangulares,
triangulares. con constancia.

Volumen. Deducción de la fórmula Interés al deducir la 9.12 Deduce la fórmula del volumen
- Prismas triangulares del volumen de primas fórmula del volumen de de primas cuadrangulares, con
y rectangulares. cuadrangulares. primas cuadrangulares. interés.

94
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Unidades. Cálculo el volumen de un Seguridad en el cálculo de 9
9.13 Calcula el volumen de un
prisma triangular usando volúmenes de prismas. prisma triangular usando la
- Metro cúbico. fórmula, con seguridad.
la fórmula.
- Decímetro cúbico. Cálculo el volumen de un 9.14 Calcula el volumen de un
9
m3 = 1000 dm3 prisma cuando se conoce prisma cuando se conoce el
el área de la base. área de la base, con dedicación.
Cálculo el volumen de Perseverancia en el 9.15 Calcula el volumen de sólidos
9
sólidos compuestos. cálculo de volúmenes compuestos, con perseverancia.
de sólidos compuestos.
Cálculo del volumen de 9.16 Calcula el volumen de un sólido
9
un sólido rectangular y rectangular y cuadrangular,
cuadrangular, utilizando utilizando el metro cúbico y el
el metro cúbico y el decímetro cúbico como unidad
decímetro cúbico como de medida, con precisión.
unidad de medida.
Cálculo del volumen de 9.17 Calcula el volumen de
9
prismas rectangulares prismas rectangulares y
y cuadrangulares cuadrangulares expresando
expresando la respuesta la respuesta en m3 y dm3,
en m3 y dm3. con precisión.

Relación entre volumen y Relación entre unidades de Confianza al relacionar 9.18 Encuentra la relación entre
medidas de capacidad. volumen y unidades unidades de volumen y unidades de volumen (cm3) con
1 m3 = 1000 lts. de capacidad. unidades de capacidad. unidad de capacidad (l), con
confianza.
1 dm3 = 1 lt.
Resolución de problemas Trabajo en equipo al 9.19 Resuelve problemas que
que involucran medidas de resolver problemas que involucran medidas de
capacidad y volumen. involucran medidas de capacidad y de volumen,
capacidad y de volumen. trabajando en equipo.

95
Programa de estudio de quinto grado
Objetivos UNIDAD 10
¸ Utilizar unidades de longitud del Sistema Inglés; yardas, pie, pulgadas y millas terrestres,
relacionando equivalencias y conversiones para resolver problemas de la vida cotidiana
con satisfacción.
UTILICEMOS OTRAS
¸ Realiza medidas de peso en gramos y kilogramos, utilizando conversiones, sumas y restas MEDIDAS
para resolver con entusiasmo e interés problemas de la vida cotidiana.
¸ Encontrar equivalencia entre monedas centroamericanas y realizar con entusiasmo
conversiones para relacionar costos de mercancías, comidas, estancias y otros de países
centroamericanos. Tiempo probable: 20 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Unidades de longitud Identificación de las Seguridad al identificar 10.1 Identifica las unidades del
del Sistema Inglés. unidades del Sistema las unidades del Sistema Sistema Inglés: la pulgada, el pie,
Inglés: la pulgada, Inglés: la pulgada, la yarda y sus equivalencias, con
- Pulgada. seguridad.
el pie, la yarda y sus el pie, la yarda y sus
- Pie. equivalencias. equivalencias.
- Yarda. Conversión entre Confianza al convertir 10.2 Realiza conversiones entre las
- Milla. las unidades del entre unidades del unidades del Sistema Inglés, con
Sistema Inglés. Sistema Inglés. confianza.
- Equivalencias.
Medición con las unidades Precisión al medir 10.3 Mide la longitud y la distancia
- 1 pie = 12 pulgadas. del Sistema Inglés. con las unidades del usando las unidades del Sistema
- 1 yarda = 3 pies ó Sistema Inglés. Inglés, con precisión.
36 pulgadas.
- 1 milla ó 1,760 yardas.

96
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Identificación y conversión Exactitud en la 1
10.4 Identifica y convierte unidades
de las equivalencias de identificación y conversión del Sistema Inglés en unidades
unidades del Sistema de las equivalencias de del Sistema Internacional y
Inglés con el Sistema unidades del Sistema viceversa, con exactitud.
Internacional. Inglés con el Sistema
Internacional.

Unidades métricas de Identificación de las Seguridad al identificar 10.5 Identifica las unidades métricas
peso: gramo y kilogramo. unidades métricas unidades métricas de peso: el gramo y el kilogramo
Equivalencias: de peso: el gramo de peso: el gramo y la equivalencia entre ellas, con
y el kilogramo y la y el kilogramo y la seguridad.
1 kg = 1,000 g. equivalencia entre ellas. equivalencia entre ellas.
Conversión g a kg y Precisión al convertir g a 10.6 Convierte g a kg y viceversa,
viceversa. kg y viceversa. al resolver situaciones del
entorno, con precisión.
Realización de Interés en la realización 10.7 Realiza investigaciones sobre el
investigaciones sobre de investigaciones sobre uso en el entorno de las unidades
el uso en el entorno de el uso en el entorno de métricas de peso: gramos y
las unidades métricas las unidades métricas kilogramos, con interés.
de peso: gramos y de peso: gramos y
kilogramos. kilogramos.
Resolución de problemas Trabajo en equipo para 10.8 Resuelve problemas de pesos
de pesos aplicando resolver problemas aplicando la equivalencia
la equivalencia de las de pesos aplicando de las unidades métricas,
unidades métricas. la equivalencia de las trabajando en equipo.
unidades métricas.

97
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Conversión de monedas Investigación y Interés en investigar y 1
10.9 Investiga y reconoce las
utilizadas en Centro reconocimiento de las reconocer las unidades unidades monetarias de los
América. unidades monetarias monetarias de los países países centroamericanos y de los
de los países centroamericanos y de Estados Unidos de América, con
Equivalencias
centroamericanos y de los Estados Unidos de interés.
Fórmulas: los Estados Unidos de América.
Equivalencia del colón América.
al dólar x la cantidad de Conversión de colones a Seguridad al convertir 10.10
10 Convierte colones a dólares y
dólares = la cantidad en dólares y viceversa. colones a dólares y viceversa, con seguridad.
colones. viceversa.
La cantidad en colones ÷ Utilización de la Seguridad en el uso de la 10.11 Encuentra la equivalencia de
1
la equivalencia del colón equivalencia de monedas equivalencia de monedas monedas centroamericanas al
al dólar = la cantidad en centroamericanas al dólar centroamericanas al dólar dólar y compara entre ellas, con
dólares. y comparación entre ellas. y comparación entre ellas. seguridad.
Equivalencia del lempira Conversión de Seguridad en la conversión 10.12 Convierte monedas de los
1
al dólar x la cantidad de monedas de los países de monedas de los países países centroamericanos al
dólares = la cantidad en centroamericanos al dólar centroamericanos al dólar dólar y viceversa, aplicándolos
lempiras. y viceversa. y viceversa. a situaciones de la vida, con
seguridad.
La cantidad en quetzales ÷ Conversión de monedas Seguridad en la conversión 10.13 Convierte monedas de otros
1
la equivalencia del quetzal de otros países de de monedas de otros países de Centroamérica,
al dólar = la cantidad en Centroamérica, utilizando países de Centroamérica, utilizando el dólar como
dólares. el dólar como unidad utilizando el dólar como unidad referente, con
referente. unidad referente. seguridad.

Ver ejemplo en el documento Evaluación al Servicio del Aprendizaje. MINED, 2007.


98
Programa de estudio de quinto grado
CIENCIA, SALUD Y
MEDIO AMBIENTE
Presentación de la asignatura Competencias a desarrollar
La asignatura Ciencia, Salud y Medio Ambiente propicia Comunicación de la información con lenguaje científico
la aplicación de procedimientos y actitudes científicas como
la observación, clasificación de objetos y fenómenos, el Esta competencia consolida la comunicación efectiva,
reconocimiento de problemas, representación, formulación mediante el uso apropiado del lenguaje científico y la
de supuestos y experimentación, entre otros. Orienta la interpretación de diferentes tipos de textos, promoviendo
el análisis crítico-reflexivo en un ambiente de libertad,
aplicación de la tecnología y la comprensión de las leyes de
responsabilidad y respeto. El lenguaje y la comunicación
la naturaleza, aplicadas a su realidad personal, familiar,
son parte esencial del trabajo científico, ya que permiten
comunitaria, y al medio natural. Se pretende que el adquirir y producir información, representándola a través
alumnado tome conciencia de las alteraciones del medio de tablas, gráficos, modelos simbólicos y verbales que
ambiente producidas por la actividad humana para prevenir le dan neutralidad, precisión, universalidad y sentido al
el agotamiento de los recursos naturales, así como de la lenguaje común.
importancia de la ciencia, la higiene y la prevención para
mejorar las condiciones de vida. Aplicación de procedimientos científicos
Esta competencia implica la utilización de procedimientos de
Enfoque de la asignatura investigación para resolver problemas de la vida cotidiana,
científicos y tecnológicos. Facilita al estudiante una mejor
Investigativo para la resolución de problemas comprensión de la naturaleza de la ciencia y la actividad
Este enfoque orienta la construcción del conocimiento científica como una acción humana. En este contexto, la
al aplicar procedimientos científicos en la resolución de resolución de problemas forma parte de la construcción del
situaciones de su vida cotidiana, la ciencia y la tecnología. conocimiento científico, generando en las y los estudiantes
Potencia la interdisciplinariedad y la formación integral aprendizajes permanentes que apliquen en situaciones de
de la persona mediante actividades de investigación, la vida para actuar eficazmente en el ámbito individual,
desarrollando proyectos adecuados a la edad y la profesional y otros.
madurez psicológica de las y los estudiantes, en los cuales Razonamiento e interpretación científica
aprendan haciendo, apliquen el conocimiento, razonen
científicamente, comuniquen, argumenten y representen Esta competencia propicia el razonamiento crítico, reflexivo
sus ideas. e inventivo, desarrollando una valoración ética de las
aplicaciones científico-tecnológicas en la vida de los seres
humanos. Cultiva el interés y el respeto por las iniciativas
científicas, la comprensión de los fenómenos de la naturaleza,
el análisis e interpretación de datos para una mejor toma
de decisiones.

100
Programa de estudio de quinto grado
Bloques de contenido alimentarios; asimismo, algunas formas de prevenir
intoxicaciones y quemaduras. Finalmente, se promueven
Los bloques de contenido en los cuales se ha organizado la medidas para evitar el paludismo, la rubéola y el VIH-
asignatura de Ciencia, Salud y Medio Ambiente responden SIDA con el propósito de tener una buena salud.
a las diferentes áreas disciplinares de las Ciencias
Naturales: 4. Ecología y medio ambiente
En este bloque se orienta al alumnado para que analice,
1. Anatomía y fisiología animal y vegetal
En este bloque se continúa con el estudio de las plantas, discuta y divulgue el impacto que ocasiona la destrucción
clasificando a las hojas por su forma, relacionándolas de la flora y la fauna en el ecosistema, con el propósito de
con la respiración y la fotosíntesis. Finalmente, se indaga protegerlos con una base legal nacional e internacional
acerca de la reproducción natural y artificial de las plantas establecida. Asimismo, se hace énfasis en la identificación
y cómo el ser humano ha aprovechado este conocimiento de situaciones de riesgo tales como terremotos, derrumbes
en la agricultura para satisfacer sus necesidades. e inundaciones, y de los sitios seguros o peligrosos en
2. Anatomía y fisiología humana el hogar, la escuela y la comunidad, a fin de proteger la
Se continúa con el estudio de la anatomía interna vida durante la ocurrencia de un evento adverso.
del cuerpo humano, representando y describiendo la 5. Física y química
estructura y funcionamiento del sistema esquelético, En este bloque el alumnado combina distintos tipos
nervioso y su relación con el tacto; la interrelación que de sustancias para formar mezclas homogéneas
existe entre el sistema circulatorio y respiratorio en y heterogéneas. También aplica algunos métodos
la oxigenación de la sangre. También la estructura y
de separación física de sustancias. Se construyen
cuidado de los riñones en la excreción y el funcionamiento
de algunas glándulas anexas del sistema digestivo. electroimanes sencillos para relacionar la electricidad y
Asimismo, se destaca la importancia de los órganos el magnetismo, así como algunos modelos de máquinas
reproductores en la concepción y formación del simples y compuestas que contribuyen a la comprensión
ser humano. de la actividad científica y tecnológica al facilitar el
trabajo del ser humano.
3. Salud alimentaria y profilaxis
Se orienta al estudiante para evitar el consumo 6. Geología y astronomía
de alimentos contaminados o en descomposición, Se estudia la estructura interna de la Tierra: núcleo,
identificando y clasificando los distintos alimentos que manto y corteza. En este último subsistema se destaca la
se producen y comercializan en el país, de acuerdo importancia de la protección de las hidrocuencas como
a los grupos de alimentos propuestos en la Guía de la del río Lempa. Por otra parte, la astronomía comprende
alimentación para la familia salvadoreña. Se fomenta la incidencia de la luz solar, el movimiento de traslación
la adquisición y práctica de hábitos higiénicos y del planeta y los tipos de eclipses.

101
Programa de estudio de quinto grado
Relación de bloques de contenido y unidades didácticas
del programa anterior y programa actual de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 1 : Así somos los seres vivos Unidad 1 : La salud y algunos movimientos de los cuerpos

Anatomía Anatomía y Ecología Profilaxis Anatomía y fisiología Profilaxis Física


y fisiología fisiología animal y y medio humana
humana vegetal ambiente

Unidad 2 : Vivamos sanos y felices Unidad 2 : Nuestra amiga el agua

Profilaxis Ecología y medio Salud alimentaria Ecología y medio ambiente Anatomía y fisiología humana
ambiente

Unidad 3 : Los seres vivos y su medio ambiente Unidad 3 : Alimentación, nutrición y transformación de la energía

Ecología y medio ambiente Física y química Anatomía y Salud Anatomía y Profilaxis


fisiología humana alimentaria fisiología vegetal

Unidad 4 : Previniendo accidentes y riesgos

Profilaxis Ecología y medio ambiente Geología

Unidad 5 : El mundo físico que nos rodea

Ecología y medio ambiente Física y química

102
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 6 : Previniendo enfermedades

Anatomía y fisiología Profilaxis Salud alimentaria Física


humana

Unidad 7 : ¿Cómo nos reproducimos los seres vivos?

Anatomía y fisiología humana Anatomía y fisiología vegetal Profilaxis

Unidad 8 : La Tierra, nuestro gran hogar

Ecología y medio ambiente Geología Astronomía

Relación entre los bloques de contenido y las La necesidad de incorporar contenidos de Ciencias Naturales
unidades didácticas en el currículo nacional en áreas como la astronomía, la
física y la química obedece a las sugerencias realizadas
Los bloques de contenido del programa actual se han por estudios nacionales e internacionales: pruebas TIMSS
distribuido y organizado en ocho unidades de aprendizaje, (Pruebas de tendencias internacionales de Ciencias
integrando diferentes situaciones del mundo natural a la y Matemáticas) o Pisa (Programa para la evaluación
vida del estudiante. El incremento en el número de unidades internacional de los alumnos), debido a que dichas áreas
y contenidos obedece a las siguientes razones: incluían pocos contenidos.
Una estructura curricular con unidades más cortas clarifica Las unidades cortas con un enfoque sistémico e integral
la secuencia de la enseñanza de los contenidos y favorece permiten un mejor aprendizaje vivencial o experimental
la planificación de más períodos de retroalimentación al alrededor de un eje o hilo conductor que le da un sentido más
inicio y finalización de cada unidad didáctica. Las unidades específico a los contenidos o temáticas, como se sugiere en
didácticas se organizan en el contexto de las situaciones de este nivel de educación básica.
la vida cotidiana del estudiante. Dichas unidades integran
los diferentes bloques y contenidos; por ejemplo, el estudio
de las enfermedades es la situación oportuna para introducir
aspectos anatómicos, fisiológicos y hábitos.

103
Programa de estudio de quinto grado
El siguiente cuadro muestra los nombres y una breve descripción de las unidades didácticas en quinto grado:

PROGRAMA ANTERIOR PROGRAMA ACTUAL


Unidad 1: Así somos los seres vivos Unidad 1 : La salud y algunos movimientos de los cuerpos

Interrelación de los animales y las plantas; Sistema esquelético; sistema nervioso; tipos de drogas y medidas preventivas
funciones vitales de las plantas; fisiología y para evitar su consumo; noción de flotación de los cuerpos y fuerza de empuje;
práctica de hábitos para cuidar el sistema máquinas simples y compuestas.
nervioso, digestivo, respiratorio, circulatorio,
urinario y genital; procesos básicos de la
fecundación, el embarazo, el parto y el
puerperio.

Unidad 2 : Vivamos sanos y felices Unidad 2 : Nuestra amiga el agua

Práctica de hábitos higiénicos y formas Importancia de las cuencas hidrográficas y su protección; estructura y
de preparar los alimentos; enfermedades funcionamiento de los riñones, vejiga y uréteres; hábitos que contribuyen al buen
infectocontagiosas y parasitarias; huertos funcionamiento de los riñones.
escolares; práctica de primeros auxilios en
caso de accidentes comunes y desastres.

Unidad 3 : Los seres vivos y su


Unidad 3 : Alimentación, nutrición y transformación de la energía
medio ambiente

Dependencia de los seres vivos con Estructura y funcionamiento del sistema digestivo y glándulas anexas;
la energía solar, interrelaciones de la enfermedades buco dentales más comunes y hábitos higiénicos para prevenirlas;
comunidad biológica y el equilibrio biológico; grupos de alimentos de la Guía de alimentación para la familia salvadoreña;
componentes del medio ambiente: aire y agua; beneficios del consumo de una dieta balanceada; las hojas y noción de
características del medio ambiente y diferentes fotosíntesis; intercambio de gases en el proceso de respiración de las plantas.
causas que originan su deterioro; formas de
trabajo y su relación con la energía.

104
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 4 : Previniendo accidentes y riesgos

Accidentes comunes, medidas preventivas y de emergencia en caso de intoxicaciones y quemaduras;


fallas geológicas y cadena volcánica en El Salvador; sismos y fenómeno de subducción de las Placas
de Cocos y el Caribe; causas, características y efectos de los riesgos en la comunidad; acciones de
prevención y mitigación en caso de derrumbes e inundaciones.

Unidad 5 : El mundo físico que nos rodea

Mezclas homogéneas y heterogéneas; algunos métodos de separación de sustancias: filtración,


tamizado, evaporación y decantación; la erosión como efecto de la deforestación de los suelos;
electricidad y magnetismo; formación de sombras de los objetos debido a la luz solar; cuerpos
transparentes u opacos.

Unidad 6 : Previniendo enfermedades

El tacto y medidas para proteger la piel; formas de evitar la contaminación de los alimentos;
estructura y funcionamiento del sistema respiratorio; interrelación del sistema respiratorio y
circulatorio; la respiración o intercambio de gases; agente transmisor y medidas para evitar el
paludismo o malaria; uso del termómetro.

Unidad 7 : ¿Cómo nos reproducimos los seres vivos?

Reproducción en las plantas: natural y artificial; estructura y funcionamiento de los órganos


reproductores externos e internos masculinos y femeninos; concepción y formación del ser humano;
importancia de la vacuna para evitar la rubéola y sus efectos en el embarazo; causas de VIH-SIDA y
medidas preventivas.

Unidad 8 : La Tierra, nuestro gran hogar

La energía solar; algunos bosques de El Salvador; cadenas y redes alimenticias; acciones para
proteger y cuidar la flora y la fauna en el ecosistema; la estructura interna de la Tierra; incidencia
solar y el movimiento de traslación de la Tierra; los eclipses de Sol y Luna.
105
Programa de estudio de quinto grado
Objetivos de quinto grado 7. Analizar con objetividad el comportamiento de la Tierra,
indagando y representando su estructura interna y
1. Indagar con interés los procesos de respiración, movimientos, a fin de comprender y explicar algunos
fotosíntesis y reproducción en las plantas, clasificando fenómenos del planeta relacionados con otros cuerpos
hojas, experimentando y realizando injertos con el fin celestes del universo.
de valorar el aprovechamiento de algunas tecnologías
desarrolladas por el ser humano en la agricultura. Lineamientos metodológicos
2. Describir y representar correctamente algunos sistemas El proceso de enseñanza aprendizaje de Ciencias
de órganos internos del ser humano, indagando y Naturales demanda utilizar metodologías participativas
explicando su anatomía y función con el fin de practicar como la investigación experimental, documental y de campo,
hábitos y medidas higiénicas para protegerlos de algunas que promuevan la creatividad e invención del estudiantado,
enfermedades. en un clima de libertad y confianza en el aula y la escuela.
3. Indagar e identificar con disposición los tipos de Para desarrollar este proceso de enseñanza aprendizaje se
alimentos, clasificándolos en diferentes grupos basados establece una secuencia didáctica que incluye una serie de
en la Guía de alimentación para la familia salvadoreña, fases con un orden lógico, las cuales se desarrollan en cada
lección del Libro de texto; dicha secuencia puede mejorarse
con el fin de aprovechar su valor nutritivo y consumir una con la experiencia docente, los recursos tecnológicos y
dieta balanceada de acuerdo a la talla y edad de las y materiales con los que cuenta la escuela.
los niños.
4. Analizar y discutir con responsabilidad el impacto que Fase 1. Exploración de conocimientos y destrezas
ocasiona la destrucción de la flora y la fauna en el Al inicio de cada lección en el Libro de texto, la y el estudiante
ecosistema, identificando las acciones del ser humano observan una situación de la vida real, ilustrada o descrita,
y relacionándolas con la legislación ambiental, a fin de para responder preguntas generadoras con el objetivo de
cuidarlo y conservarlo para las futuras generaciones. despertar el interés y contextualizar el contenido científico a
una situación cotidiana.
5. Explicar con interés algunas causas y efectos de los
riesgos en la comunidad, indagando y describiendo La o el docente presenta la situación o ilustración,
sus características, con el fin de realizar y divulgar lee las preguntas a las y los estudiantes, escucha y
acciones de prevención para proteger la vida en caso de copia en la pizarra las respuestas, permitiéndoles
la ocurrencia de un evento adverso. expresarlas independientemente de que sean correctas
6. Experimentar con distintos tipos de mezclas y métodos de o incorrectas.
separación de sustancias, identificando sus componentes Fase 2. Comprensión del problema
para valorar con autonomía el proceso de transformación
de la materia y la energía en los fenómenos del entorno. Se recomienda que en equipo, las y los estudiantes escuchen
o lean una pregunta de investigación, como por ejemplo:

106
Programa de estudio de quinto grado
¿Desde qué altura se puede lanzar una bolita para que respondiendo a las preguntas: ¿Sabes qué sucedió?
caiga dentro de un vaso? Esta pregunta de investigación ¿Por qué?
se caracteriza por ser un problema, no tener una solución
La o el docente facilita la discusión de los resultados
inmediata, ser significativa y de relevancia científica. Las obtenidos entre los equipos de estudiantes, apoya la
y los estudiantes necesitan buscar información en libros o construcción de la información y valora la certeza de las
Internet, hacer nuevas preguntas y conversar las posibles
respuestas de forma interactiva. hipótesis o supuestos elaborados.

El Libro de texto y el Cuaderno de ejercicios son materiales Fase 5. Contrastación científica


de apoyo que contienen secciones de lectura, historias de Las y los estudiantes comparan e interpretan los resultados
la ciencia, inventos y hechos curiosos en la naturaleza. obtenidos con la información establecida por la comunidad
La o el docente presenta la pregunta de investigación, científica, de esta manera contrastan sus ideas y
propicia la discusión entre el alumnado, orienta la lectura y conclusiones.
facilita herramientas para la investigación. La o el docente invita a las y los estudiantes a leer un texto
relacionado con el problema, de forma que reflexionen sobre
Fase 3. Representación y explicación los datos obtenidos, identifiquen equivocaciones o certezas y
En esta fase la y el estudiante hacen narraciones, descripciones nuevas preguntas de investigación. Debe enfatizarse en que la
y representaciones sencillas (dibujos o esquemas) en actividad científica es un modelaje aproximado de una parte
su cuaderno de apuntes, estableciendo relaciones y de la realidad y no una respuesta a toda ocurrencia.
explicaciones tentativas de causa-efecto, que en los
procesos de investigación se denominan hipótesis o Fase 6. Consolidación del aprendizaje
supuestos, los cuales les permiten predecir resultados Las y los estudiantes elaboran dibujos o secuencias de dibujos,
lógicos con relación al problema. informes sencillos u otros que ayuden a la sistematización y
La y el docente apoya a las y los estudiantes haciendo comprensión científica de los contenidos.
nuevas preguntas relacionadas con las explicaciones del La o el docente explica y ejercita formas de elaborar un
alumnado, las escribe en la pizarra, modelando así el paso informe o representar las ideas científicas estudiadas, orienta
de la palabra oral a la escrita y visualizando las evidencias la utilización del Cuaderno de ejercicios para realizar otras
del razonamiento. actividades de aprendizaje que ayuden a consolidar y
profundizar el conocimiento.
Fase 4. Comprobación
Es importante que la metodología guarde la integridad de la
La y el estudiante realizan experimentos, observaciones naturaleza del planeta, asegure la sostenibilidad, concretando
de campo, buscan información bibliográfica, indagan leyes nacionales e internacionales tales como la Ley de
con líderes de la comunidad u otros; de esta manera, protección de los animales, la Declaración universal sobre
prueban sus hipótesis o supuestos antes elaborados. el bienestar animal aprobada por la UNESCO y la ONU, la
Comparten y comparan los resultados obtenidos Carta de la Tierra y la Ley de protección del medio ambiente

107
Programa de estudio de quinto grado
salvadoreño para evitar destruir los recursos naturales y las puede diagnosticar cuando las y los estudiantes realizan
especies vegetales y animales innecesariamente. una tarea específica, por ejemplo, expresar sus ideas con
espontaneidad, clasificar correctamente a los seres vivos
La metodología debe garantizar que las tareas sean realizadas
en animales o plantas, manipular adecuadamente una
por las y los estudiantes de acuerdo con la edad, el desarrollo
psicomotriz y los recursos disponibles del alumnado, es cuchara con cubitos de hielo exponiéndolos a una llama
decir, trascender a la significatividad de cada actividad en la para comprobar los cambios de los estados físicos del
vida del estudiante, y anticiparse con la pregunta ¿para qué agua, etc.
le servirá? Asimismo, es fundamental obtener información sobre los
conocimientos y las actitudes de los estudiantes. Por ejemplo:
Lineamientos de evaluación curiosidad por explorar el entorno, seguridad para expresar
sus ideas, interés en formular preguntas, entre otros.
La asignatura de Ciencia, Salud y Medio Ambiente evalúa
el progreso del alumnado mediante la demostración de una De manera general, se recomienda retomar los contenidos
conducta o actuación esperada, por ejemplo: identifica el e indicadores de logro del grado o nivel anterior, o de
problema, aplica procedimientos de investigación, entre unidades didácticas previas, poniendo especial atención
otros. También es importante evaluar la comprensión en los indicadores priorizados que aparecen resaltados en
de conceptos mediante representaciones gráficas, la negrita en el programa de estudio.
expresión oral o en la aplicación de los procedimientos de No debe olvidarse que la finalidad de la evaluación
experimentación o comprobación. diagnóstica es adecuar la planificación y aplicar estrategias
Para que la evaluación sea integral, flexible y significativa para nivelar al alumnado en el grado que cursa, de manera
deberá retomar los principales tipos de evaluación y sus que tenga las condiciones de éxito para su aprendizaje.
actores.
Evaluación formativa
Evaluación diagnóstica La finalidad de la evaluación formativa es conocer los logros
Por medio de la observación directa, la revisión de dibujos, y dificultades de aprendizaje de las y los estudiantes para
las respuestas a preguntas exploratorias, descripciones facilitarles ayuda adecuada y oportuna en la adquisición
o explicaciones previas, la o el docente puede obtener de las competencias. Por ejemplo, si la o el estudiante no
información sobre las habilidades que poseen las y los logra identificar y clasificar los materiales conductores y no
estudiantes antes de iniciar nuevos contenidos. conductores de calor, la o el docente debe indagar las causas
del error. Conocer el nivel de razonamiento del alumnado
Se debe hacer una evaluación inicial para conocer el grado permite comprender las causas de sus dudas o errores
de dominio de algunos procedimientos que el alumnado y da la posibilidad de intervenir proponiendo actividades
necesitará aplicar en las clases. Por ejemplo: la manipulación específicas y oportunas que refuercen su aprendizaje.
de una balanza, una lupa, una regla, un termómetro o la
aplicación de destrezas intelectuales como la observación, Merecen especial atención los conocimientos equivocados
la descripción, la clasificación y el análisis, entre otras. Se o acientíficos de las y los estudiantes. Estos deben ser

108
Programa de estudio de quinto grado
escuchados y comprendidos sin la inmediata corrección. entre otras. Se debe diseñar de manera que evalúe
Las competencias de esta asignatura demandan el contenidos conceptuales y procedimentales independientes
descubrimiento, abrir espacios para el ensayo o error y la o integrados; no necesita ser exhaustiva y con muchas
comprobación de supuestos, por lo tanto, se debe preguntar preguntas, sino diseñada de acuerdo a los indicadores de
primero: “¿por qué piensas así?”, y explorar el razonamiento logro.
del estudiante, antes de corregir o, lo que es peor, juzgar
negativamente su opinión. Se recomienda incluir actividades que evalúen los
aprendizajes de las y los estudiantes enfrentándolos a una
Esta actitud es fundamental al evaluar formativamente a las situación problema que se resuelva con la aplicación de
niñas y los niños, porque permite detectar las causas de sus procedimientos: identificar, clasificar, analizar, explicar,
errores o confusiones para ayudarles a superarlos antes de representar, argumentar, predecir, inventar; y la aplicación
adjudicar una calificación. de conocimientos con determinadas actitudes.
La evaluación formativa se apoya en la autoevaluación, Este tipo de actividades permiten a las y los estudiantes
heteroevaluación y coevaluación. Por lo tanto, se debe aplicar el conocimiento y los procedimientos a nuevas
permitir a las y los estudiantes exponer, compartir resultados situaciones de la vida real.
y procedimientos realizados, valorar el trabajo en equipo,
expresando cómo se sintieron, qué hicieron bien y qué
cosas deben mejorar en actividades futuras. Una pregunta Recomendaciones generales según el
específica, permite conocer el grado de competencia del tipo de contenido referido en los
alumnado e identificar el tipo de ayuda que necesita para indicadores de logro
mejorar su nota y nivel de competencia.
La evaluación de contenidos conceptuales debe reconocer
Este tipo de evaluación debe incluir la observación y el grados o niveles de profundización y comprensión, así como
registro de actitudes referidas a la participación, el trabajo la capacidad para utilizar convenientemente los conceptos
en equipo y los procedimientos seguidos. aprendidos. Se recomienda verificar el uso que cada
estudiante hace de los conceptos en diversas situaciones,
Evaluación sumativa individuales o en equipo; la resolución de conflictos o
La evaluación sumativa certifica y asigna una calificación problemas a partir del uso de los conceptos; las pruebas
al desempeño del estudiante, por medio de diversas objetivas que requieran relacionar y utilizar los conceptos
actividades de evaluación: pruebas escritas, cerradas en unas situaciones determinadas. El diálogo, el debate y
o de ítems abiertos, revisión de cuadernos, trabajos la conversación, pueden tener un enorme potencial para
grupales, investigaciones y otros. Permite evaluar el nivel saber lo que el estudiantado conoce.
de adquisición y comprensión de hechos, conceptos y Las actividades de evaluación para conocer el nivel de
principios científicos.
comprensión conceptual son todas aquellas en las que la
De acuerdo con la naturaleza de la adquisición de las o el estudiante puede comunicarse verbalmente y/o aplicar
competencias, la prueba objetiva sólo es una actividad el conocimiento en una nueva situación, por ejemplo, al

109
Programa de estudio de quinto grado
definir un concepto, es capaz de enunciarlo y explicarlo en Exactitud: uso del lenguaje científico de acuerdo a la
un momento determinado. edad cronológica de las y los estudiantes y el contexto.
Los contenidos procedimentales implican saber hacer y Creatividad: selección y uso de diferentes materiales para
se pueden evidenciar en situaciones de aplicación. La
observación sistemática de cada una de las y los alumnos representar modelos, maquetas, simuladores y otros, al
en situaciones en que se utilicen dichos contenidos ser elaborados por las y los estudiantes.
procedimentales; las actividades abiertas, hechas en clase, Disposición para cumplir indicaciones.
permiten comprender cómo las y los alumnos desarrollan
habilidades y destrezas entre ellas: identificar, clasificar, Aplicación del conocimiento científico a diferentes
analizar, explicar, representar, argumentar y predecir, situaciones para resolver problemas de la vida cotidiana
entre otras. y otros.
Una forma de evaluar la aplicación de procedimientos Pertinencia en el establecimiento de supuestos como
científicos en las y los estudiantes es presentándoles una probables respuestas a una situación problema.
situación experimental, de campo o documental, similar a
las desarrolladas en el aula, en la cual la y el estudiante Claridad en la formulación de preguntas a sí mismo y a los
puede ordenar los pasos y explicar cómo la resuelve. demás acerca de los problemas del entorno relacionados
La evaluación de los contenidos actitudinales en las y los con la salud, el medio ambiente, los fenómenos naturales,
estudiantes demanda la observación y la utilización de una entre otros.
lista de cotejo, estableciendo criterios claros que evidencien Práctica de hábitos higiénicos, posturales y medidas que
la práctica de principios y valores en el trabajo individual y
de equipo. conserven el buen estado de la salud.
La o el docente puede aplicar diferentes actividades de Curiosidad e interés cuando se realizan procesos de
evaluación para el logro de las competencias, tomando en investigación.
cuenta los indicadores para conocer el nivel alcanzado por Precisión de sus ideas al razonar científicamente sobre
la y el estudiante. causas y efectos de los fenómenos naturales, mediciones,
registro de datos y otros.
Importancia de los criterios para ponderar
La revisión de cuadernos suele ser una de las actividades
las actividades de evaluación de evaluación para asignar calificaciones a las niñas y
La o el docente tienen la oportunidad de establecer criterios los niños. El cuaderno es un reflejo de la manera en que
en el proceso de evaluación, estos son aplicables a los los docentes desarrollan sus clases, así como del trabajo
indicadores de logro, algunos ejemplos de criterios de del alumnado. Es un recurso potente para reflejar la
evaluación en Ciencias son los siguientes: aplicación de procedimientos y el grado de comprensión
Coherencia: escribe la mayoría de las ideas con de los contenidos. De ahí la importancia de definir criterios
orden lógico. pertinentes para la evaluación del cuaderno.

110
Programa de estudio de quinto grado
Objetivos UNIDAD 1
¸ Identificar y describir con interés los principales órganos del sistema esquelético y nervioso
del cuerpo humano, relacionándolos con sus funciones y los efectos de las drogas a fin de
practicar hábitos y medidas para mantener una buena salud.
LA SALUD Y ALGUNOS
¸ Indagar con curiosidad el principio de flotación, empuje de los cuerpos y la importancia de MOVIMIENTOS DE
las máquinas por medio de experimentos para valorar su aplicación en la vida cotidiana.
LOS CUERPOS
Tiempo probable: 21 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sistema esquelético. Identificación y Creatividad al representar 1.1 Identifica y representa con
representación del sistema el sistema esquelético del creatividad, las partes del
esquelético del ser ser humano. sistema esquelético humano.
humano.

Descripción y explicación Curiosidad e interés por 1.2 Explica y describe con


de las funciones de los explicar la función de los curiosidad e interés, la función
principales huesos del principales huesos del de los huesos del esqueleto
esqueleto humano. esqueleto humano. humano.

Descripción y práctica de Valoración de la 1.3 Describe y practica con


medidas para el cuidado importancia del cuidado responsabilidad medidas para
de los huesos. de los huesos. el cuidado de los huesos.

111
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sistema nervioso. Representación e Interés y creatividad al 1.4 Representa con creatividad e
identificación de los representar los principales identifica los principales órganos
principales órganos del órganos del sistema del sistema nervioso: cerebro,
sistema nervioso humano: nervioso. cerebelo, bulbo raquídeo y
cerebro, cerebelo, bulbo médula espinal.
raquídeo y médula espinal.
Relación y explicación Interés por relacionar las 1.5 Relaciona de manera correcta las
de la fisiología del partes del sistema nervioso partes del sistema nervioso con
sistema nervioso con sus con su funcionamiento. sus respectivas funciones.
respectivos órganos.
Identificación y Curiosidad por identificar 1.6 Identifica y describe con interés
descripción de algunas y describir algunas algunas enfermedades que
enfermedades que alteran enfermedades que alteran alteran el funcionamiento del
el funcionamiento del el funcionamiento del sistema nervioso.
sistema nervioso. sistema nervioso.
Análisis y explicación de Actitud crítica al analizar 1.7 Analiza y explica en forma
algunas causas y efectos los daños al sistema crítica las causas y efectos
de la alteración del nervioso causados por que alteran al sistema
sistema nervioso: golpes, el uso de drogas y el nervioso: golpes, uso de
uso de drogas y alcohol. consumo de bebidas drogas y alcohol.
alcohólicas.

Tipos de drogas: tabaco, Investigación, análisis y Disposición por 1.8 Investiga, analiza y describe con
marihuana, coca y crack. descripción de las causas investigar y analizar las claridad, los efectos que causan
y consecuencias del causas y consecuencias el alcoholismo y otras drogas en
alcoholismo y la fármaco del alcoholismo, el la salud de las personas.
dependencia. tabaquismo y otras drogas.

112
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Discusión y análisis de Objetividad al discutir y 1.9 Discute y analiza de manera
casos relacionados con el analizar algunos casos crítica las causas que inducen
alcoholismo y la fármaco relacionados con el a las personas al consumo de
dependencia. alcoholismo y la fármaco alcohol, tabaco y drogas.
dependencia.

Medidas preventivas Formulación de preguntas Valoración de los 1.10 Formula preguntas y explica con
para evitar el consumo y explicaciones sobre la beneficios a la salud al objetividad la importancia de la
de drogas. importancia de la atención evitar el consumo de las atención médica y psicológica
médica y psicológica para drogas, el tabaco y para evitar el consumo
evitar el consumo el alcohol. de drogas.
de drogas.
Proposición y divulgación Respeto a sí mismo y 1.11 Propone y divulga con respeto
de medidas preventivas fortalecimiento de la medidas preventivas para evitar
para evitar el consumo autoestima. el consumo de drogas.
de drogas.

Noción de flotación de Identificación y Interés por identificar los 1.12 Identifica y clasifica con interés
los cuerpos. clasificación de objetos objetos que flotan en el objetos que flotan en el agua.
que flotan en el agua. agua.
Indagación y explicación Curiosidad al indagar 1.13 Indaga y explica con
del principio de flotación sobre el principio de curiosidad el principio de
de Arquímedes y su flotación de Arquímedes. flotación de Arquímedes
aplicación en la vida y su aplicación en la vida
cotidiana. cotidiana.

113
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Noción de fuerza Experimentación y Disposición por 1.14 Experimenta y explica de manera
de empuje. explicación de los efectos experimentar y explicar correcta, los efectos de la fuerza
de la fuerza de empuje en los efectos de la de empuje en diversos casos de
diversos casos de la fuerza de empuje. la vida cotidiana.
vida cotidiana.
Experimentación con 1.15 Experimenta de forma objetiva
algunos líquidos para con algunos líquidos para
comprobar la fuerza de comprobar la fuerza de empuje
empuje en distintos en diferentes objetos sólidos.
objetos sólidos.

Máquinas simples y Explicación y Interés y disposición por 1.16 Explica y representa con certeza
compuestas: automotores, representación del uso de explicar y representar los el uso de las máquinas simples
bicicletas y molinos. las máquinas simples y usos de las máquinas y compuestas: automotores,
compuestas: simples y compuestas: bicicletas y molinos, en las
automotores, bicicletas y automotores, bicicletas y actividades cotidianas del
molinos, en las actividades molinos, en las actividades ser humano.
cotidianas del ser humano. cotidianas del ser humano.

114
Programa de estudio de quinto grado
Objetivo UNIDAD 2
¸ Indagar y explicar con interés las formas de protección del agua relacionando la
importancia de este recurso con la salud del cuerpo humano, a fin de practicar y divulgar
medidas de conservación del agua. NUESTRA AMIGA EL
AGUA
Tiempo probable: 15 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Importancia de las Identificación y explicación Actitud crítica al valorar 2.1 Identifica y explica con interés
cuencas hidrográficas y de las principales cuencas la importancia de la las principales cuencas
su protección. hidrográficas de El protección de las hidrográficas de El Salvador.
Salvador y la importancia cuencas hidrográficas.
de su protección.
Discusión y divulgación Interés e iniciativa por 2.2 Discute y divulga con interés
acerca de la importancia divulgar cómo proteger la importancia de proteger las
de proteger los ríos, lagos, las cuencas hidrográficas cuencas hidrográficas.
lagunas y en general todas del país.
las fuentes de agua.

Formas de protección Formulación de Disposición por formular 2.3 Formula con objetividad
del agua. preguntas y explicaciones preguntas y explicaciones preguntas y explica sobre
sobre cómo evitar la sobre cómo evitar la cómo evitar la contaminación
contaminación del agua, contaminación del agua. del agua y cómo usarla en
y cómo usarla en forma forma racional.
racional.

115
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Proposición y divulgación Interés por proponer y 2.4 Propone y divulga con iniciativa,
de algunas medidas para divulgar algunas medidas algunas medidas para conservar
conservar las fuentes para conservar las fuentes las fuentes principales de agua.
principales de agua. principales de agua.

Estructura de los riñones, Identificación, explicación Curiosidad por explicar y 2.5 Identifica, explica y representa
la vejiga y los uréteres. y representación de la representar la estructura con destreza, la estructura de los
estructura de los riñones, de los riñones, la vejiga y riñones, la vejiga y los uréteres.
la vejiga y los uréteres. los uréteres.

Funcionamiento de Explicación sobre el Valoración de la 2.6 Explica con interés el


los riñones. funcionamiento y la importancia del sistema funcionamiento y la importancia
importancia del sistema urinario en la eliminación de los riñones, la vejiga y los
urinario, en especial de de las impurezas del uréteres para la eliminación de
los riñones, la vejiga y cuerpo. las impurezas del cuerpo.
los uréteres en la
eliminación de las
impurezas del cuerpo.

Hábitos que contribuyen al Descripción y práctica de Promoción de hábitos para 2.7 Describe y practica con
buen funcionamiento de hábitos y acciones que el buen funcionamiento de responsabilidad hábitos y
los riñones. contribuyen al buen los riñones. acciones que contribuyen al
funcionamiento de los buen funcionamiento de los
riñones. riñones.
Discusión, argumentación Valoración de la 2.8 Discute, argumenta y divulga
y divulgación de la necesidad de consumir de manera crítica la necesidad
importancia de consumir el agua necesaria para e importancia de consumir
el agua necesaria para purificar la sangre suficiente agua para purificar
purificar la sangre y eliminar toxinas e la sangre y eliminar toxinas e
y eliminar toxinas e impurezas del organismo. impurezas del organismo.
impurezas del organismo.

116
Programa de estudio de quinto grado
Objetivo UNIDAD 3
¸ Investigar y describir con claridad las transformaciones de la energía en los procesos de
alimentación y nutrición de los seres vivos relacionando y explicando la importancia de ALIMENTACIÓN,
los diferentes grupos de alimentos al consumir una dieta balanceada para mantener una
buena salud. NUTRICIÓN Y
TRANSFORMACIÓN DE LA
ENERGÍA
Tiempo probable: 43 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Estructura del sistema Representación y Interés por describir y 3.1 Describe y representa en forma
digestivo y las glándulas descripción de la representar la estructura correcta la estructura del sistema
anexas. estructura del sistema del sistema digestivo y las digestivo y las glándulas anexas
digestivo y las glándulas glándulas anexas del ser del ser humano: páncreas,
anexas del ser humano: humano: páncreas, hígado hígado y glándulas salivales.
páncreas, hígado y y glándulas salivales.
glándulas salivales.
Observación, análisis y Objetividad al comparar 3.2 Compara con certeza las
comparación entre los los órganos del sistema semejanzas y diferencias entre
órganos del sistema digestivo de aves y el sistema digestivo de aves y
digestivo de aves y mamíferos. mamíferos.
mamíferos, por medio de
representaciones.

117
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Funcionamiento del Discusión, explicación y Participación activa en la 3.3 Discute, explica y analiza con
sistema digestivo y las análisis sobre el discusión sobre el certeza el funcionamiento del
glándulas anexas. funcionamiento del sistema funcionamiento del sistema sistema digestivo humano y sus
digestivo humano y sus digestivo humano y sus glándulas anexas.
glándulas anexas. glándulas anexas.

Ingestión, digestión y Indagación y descripción Curiosidad e interés por 3.4 Indaga y describe con curiosidad
excreción. de los procesos de indagar los procesos de: e interés los procesos de
ingestión, digestión y ingestión, digestión y ingestión, digestión y excreción
excreción en el sistema excreción en el sistema en el sistema digestivo.
digestivo. digestivo.
Indagación, análisis y Participación activa en el 3.5 Indaga, analiza y explica de
explicación de las causas análisis de las causas de manera asertiva las causas de las
de las enfermedades más las enfermedades más enfermedades más comunes del
comunes del sistema comunes del sistema sistema digestivo humano.
digestivo humano. digestivo humano.

Enfermedades buco Investigación y descripción Interés por describir las 3.6 Investiga y describe con
dentales más comunes: de las enfermedades buco enfermedades buco seguridad las enfermedades buco
caries, gingivitis y halitosis. dentales más comunes: dentales más comunes: dentales más comunes: caries,
caries, gingivitis y halitosis. caries, gingivitis y halitosis. gingivitis y halitosis.
Indagación y explicación Curiosidad por indagar 3.7 Indaga y explica con interés los
de los daños que pueden y explicar los daños que daños que pueden causar las
causar las enfermedades causan las enfermedades enfermedades buco dentales a
buco dentales a nuestra buco dentales a nuestra nuestra salud.
salud. salud.

118
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Hábitos higiénicos para Proposición y divulgación Iniciativa en la práctica de 3.8 Propone, practica y divulga
prevenir la caries, gingivitis de hábitos higiénicos para hábitos higiénicos para con iniciativa hábitos
y halitosis. prevenir la caries, gingivitis prevenir la caries, gingivitis higiénicos como uso del hilo
y halitosis. y halitosis. dental y enjuague bucal para
prevenir la caries, gingivitis
Práctica de lavado de
y halitosis.
dientes, empleo de hilo
dental y enjuague bucal
para prevenir la caries,
gingivitis y halitosis.

Grupos de alimentos de Indagación, interpretación Curiosidad e interés por 3.9 Indaga y elabora gráficos
la Guía de alimentación y representación por conocer los alimentos que con creatividad e interpreta
para la familia medio de gráficas acerca se consumen en el hogar información recopilada acerca
salvadoreña. de los alimentos que se de las y los salvadoreños. de los alimentos que se
consumen con mayor consumen en el hogar de las y
frecuencia en el hogar de los salvadoreños.
las y los salvadoreños.

Identificación y Interés por describir los 3.10 Identifica y describe con interés
descripción de los grupos grupos de alimentos de la los grupos de alimentos de la
de alimentos de la Guía Guía de alimentación para Guía de alimentación para la
de alimentación para la la familia salvadoreña. familia salvadoreña.
familia salvadoreña.

119
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Alimentos que forman el Indagación, explicación Curiosidad e interés por 3.11 Indaga, explica y representa
grupo de los granos, las y representación de los representar y explicar los con creatividad los principales
raíces y los plátanos. principales alimentos principales alimentos del alimentos que forman el grupo
del grupo de los granos grupo de granos (cereales de granos, raíces y plátanos,
(los cereales y las y leguminosas), raíces en la alimentación de las y los
leguminosas), las raíces y y plátanos que forman salvadoreños.
los plátanos que forman parte de la alimentación
parte de la alimentación salvadoreña.
salvadoreña.
Descripción y análisis del Valoración de la 3.12 Describe con interés y analiza el
valor nutritivo de los importancia nutricional y valor nutritivo de los alimentos
granos, las raíces y el consumo de alimentos que forman el grupo de los
los plátanos en la que forman el grupo de granos, las raíces y los plátanos.
alimentación. granos, raíces y plátanos.

Alimentos que forman el Identificación y Disposición para preparar 3.13 Identifica y representa con
grupo de las frutas. representación de las y consumir los diferentes creatividad las principales frutas
principales frutas de la tipos de frutas disponibles de la alimentación salvadoreña.
alimentación salvadoreña. en su comunidad.

Indagación de la Valoración de la 3.14 Indaga la disponibilidad y el


disponibilidad y el valor importancia nutricional valor nutritivo de las frutas
nutritivo de las frutas de las frutas en la durante las dos épocas del
durante las dos épocas alimentación salvadoreña. año con la intención de
del año. consumirlas.

120
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Alimentos que forman el Identificación y Interés por indagar las 3.15 Representa con creatividad las
grupo de las verduras y representación de las diferentes hojas usadas principales verduras y hojas
las hojas verdes. principales verduras y como especias para verdes en especial las que se
hojas verdes incluidas sazonar las comidas. consumen en la comunidad.
en la alimentación
salvadoreña, en especial
las que se consumen en
la comunidad.
Investigación y explicación Interés por explicar el 3.16 Investiga y explica con interés
del valor nutritivo de las valor nutritivo de las hojas el valor nutritivo de las hojas
hojas verdes y verduras verdes y verduras del país. verdes y las verduras en
del país. especial de las que se
consumen en la comunidad.
Proposición y divulgación Disposición para 3.17 Propone y divulga con iniciativa
de recetas para consumir consumir los diferentes recetas para el consumo de
verduras y hojas verdes. tipos de verduras y hojas diferentes tipos de verduras y
verdes presentes en su hojas verdes.
comunidad.

Beneficios del consumo Investigación, explicación Iniciativa para divulgar los 3.18 Investiga, explica y divulga
de una dieta diaria y divulgación de los beneficios de una dieta con interés los beneficios
balanceada. beneficios del consumo de balanceada. del consumo de una dieta
una dieta balanceada. balanceada.
Clasificación de los Iniciativa por clasificar 3.19 Clasifica con iniciativa los
alimentos que se los alimentos que se alimentos que se consumen
consumen en el hogar consumen en el hogar en el hogar, según su función.
según su función. según su función.

121
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Indagación, comparación Interés por indagar y 3.20 Indaga, compara y explica con
y explicación de la comparar la pirámide interés la pirámide alimenticia
pirámide alimenticia con alimenticia con la Guía con la Guía de alimentación
la Guía de alimentación de alimentación para la para la familia salvadoreña.
para la familia familia salvadoreña.
salvadoreña.

Cantidad de alimentos Discusión y análisis sobre Participación en la 3.21 Discute y analiza con objetividad
que deben consumirse de la clase y cantidad de discusión y análisis sobre la clase y cantidad de alimentos
acuerdo a la edad y las alimentos que deben la cantidad de alimentos que deben consumirse de
actividades diarias. consumirse de acuerdo que deben consumirse de acuerdo con la edad y las
con la edad y las acuerdo con la edad y las actividades diversas.
actividades diarias. actividades diarias.

Formulación de preguntas Interés por formular 3.22 Formula preguntas y explica


y explicaciones acerca preguntas y explicaciones con interés las actividades
de las actividades que acerca de las actividades que requieren mayor o menor
requieren mayor o menor que requieran mayor consumo de alimentos.
consumo de alimentos. consumo de alimentos.

Diferenciación y Iniciativa por aplicar las 3.23 Diferencia y explica con


explicación del normas para alimentarse objetividad el requerimiento
requerimiento de con las cantidades de de alimentos en la niñez, la
alimentos en la niñez, la alimento de acuerdo a adolescencia, la adultez y
adolescencia, la adultez y su edad. la tercera edad.
la tercera edad.

122
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Formulación de preguntas Objetividad al formular 3.24 Formula preguntas y explica con
y explicaciones acerca preguntas y explicar coherencia acerca de la
de la influencia de los la influencia que los importancia de ingerir alimentos
alimentos como un factor alimentos tienen según necesarios según la talla y el
que incide en la talla y la talla y el peso del ser peso del ser humano.
peso del ser humano. humano.

Formas de las hojas: Clasificación, comparación Interés y curiosidad por 3.25 Clasifica, compara e ilustra
acorazonadas, elípticas, e ilustración de las hojas clasificar y comparar los con creatividad las hojas del
ovaladas y otras. del entorno por su forma: distintos tipos de hojas en entorno de acuerdo a su forma:
acorazonadas, elípticas, plantas del entorno. acorazonadas, elípticas,
ovaladas y otras. ovaladas y otras.
Indagación y divulgación Valoración de la utilidad 3.26 Indaga y divulga de manera
acerca de la utilidad alimentaria y medicinal de espontánea, la utilidad
alimentaria y medicinal de las hojas del entorno. alimentaria y medicinal de
algunas hojas del entorno. algunas hojas del entorno.

Noción de fotosíntesis y la Identificación y descripción Curiosidad e interés por 3.27 Identifica y describe en forma
presencia de clorofila en de la hoja como órgano identificar y describir a correcta a la hoja como el
las hojas. responsable de la la hoja como el órgano órgano responsable de la
fotosíntesis en las plantas. responsable de la fotosíntesis en las plantas.
fotosíntesis en las plantas.
Descripción del proceso Claridad al describir el 3.28 Describe con seguridad la
de la fotosíntesis y su proceso de la fotosíntesis función de las hojas en el
importancia para la vida en las plantas. proceso de la fotosíntesis y su
del planeta. importancia para la vida
del planeta.

123
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Experimentación y Objetividad al comprobar 3.29 Experimenta y verifica con certeza
comprobación de la la presencia de clorofila en la presencia de la clorofila en las
presencia de clorofila en las plantas. hojas verdes de las plantas.
las hojas verdes.
Discusión y argumentación Valoración acerca de 3.30 Discute y argumenta
acerca de la importancia la importancia de la con seguridad sobre la
de la fotosíntesis y su fotosíntesis en la vida del importancia de la fotosíntesis
relación con la respiración planeta. en la respiración de los seres
de los seres vivos. vivos.

Intercambio de gases en el Experimentación y Curiosidad e interés por 3.31 Experimenta y explica con
proceso de respiración de explicación acerca de la comprobar la liberación objetividad acerca de la
las plantas. liberación del oxígeno y el de oxígeno y bióxido de liberación de oxígeno y el
bióxido de carbono. bióxido de carbono durante la
carbono durante la respiración vegetal.
respiración vegetal.
Relación y discusión de Valoración de la 3.32 Relaciona y discute en forma
la importancia de la importancia de la adecuada la importancia de la
fotosíntesis y la respiración respiración de las plantas fotosíntesis y la respiración de las
de las plantas para los para los seres vivos. plantas para los seres vivos.
seres vivos.

124
Programa de estudio de quinto grado
Objetivo UNIDAD 4
¸ Indagar y explicar con responsabilidad algunos tipos de accidentes y riesgos más comunes
representándolos y describiendo sus causas y características, con el propósito de practicar PREVINIENDO
y divulgar algunas medidas de prevención.
ACCIDENTES Y
RIESGOS
Tiempo probable: 21 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Accidentes comunes: Indagación, discusión y Emisión de juicio crítico 4.1 Indaga, discute y explica en
intoxicaciones y explicación de las causas y al indagar las causas y forma responsable las causas y
quemaduras. efectos de accidentes efectos de los accidentes formas de prevenir accidentes
comunes: intoxicaciones y comunes. comunes en la escuela y en
quemaduras. el hogar: intoxicaciones y
quemaduras.
Clasificación y explicación Responsabilidad al clasificar 4.2 Clasifica y explica con
de los diferentes tipos de y explicar los distintos tipos responsabilidad los diferentes
quemaduras de primero, de quemaduras. tipos de quemaduras de primero,
segundo y tercer grado. segundo y tercer grado.

Identificación y Interés por clasificar 4.3 Identifica y clasifica con interés


clasificación de algunas algunas sustancias tóxicas algunas sustancias tóxicas para
sustancias tóxicas para para nuestro organismo. nuestro organismo.
nuestro organismo.

125
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Medidas preventivas y de Investigación, proposición Interés por proponer 4.4 Propone, divulga e investiga
emergencia en caso de y divulgación de las y divulgar medidas en forma correcta algunas
intoxicaciones y medidas preventivas y preventivas y de medidas preventivas y de
quemaduras. de emergencia en caso emergencia en caso emergencia en caso de
de intoxicaciones y de intoxicaciones y intoxicaciones y quemaduras.
quemaduras. quemaduras.
Aplicación en forma Disposición a brindar 4.5 Aplica en forma correcta
correcta de los primeros primeros auxilios en primeros auxilios en caso de
auxilios en caso caso de intoxicaciones intoxicaciones y quemaduras.
de intoxicaciones y y quemaduras.
quemaduras.
Identificación de entidades Cooperación y honestidad 4.6 Identifica y menciona con
de servicios de emergencia al reportar casos de seguridad las entidades de
en caso de accidentes accidentes al número servicios de emergencias y utiliza
como intoxicaciones y telefónico de emergencia. los números telefónicos en
quemaduras. situaciones necesarias.

Fallas geológicas y cadena Indagación y explicación Disposición por buscar 4.7 Indaga y explica con interés, las
volcánica en El Salvador. de las fallas geológicas y y organizar información fallas geológicas y su relación
su relación con la cadena sobre las fallas geológicas con la cadena volcánica en
volcánica en El Salvador. y la cadena volcánica en El Salvador.
El Salvador.

Sismo causado por el Explicación y Curiosidad e interés por 4.8 Representa y explica de forma
movimiento de fallas representación de un sismo conocer sobre los sismos coherente acerca de un sismo
geológicas y el fenómeno causado por el movimiento causados por movimientos causado por el movimiento de
de subducción de las de fallas geológicas y el de fallas geológicas y el fallas geológicas y el fenómeno
Placas de Cocos y fenómeno de subducción. fenómeno de subducción. de subducción de las placas de
del Caribe. Cocos y del Caribe en el país.

126
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación y descripción Interés por investigar y
del fenómeno de describir el fenómeno de
subducción de las Placas subducción de las Placas
de Cocos y del Caribe. de Cocos y del Caribe.
Formulación de preguntas Disposición por formular 4.9 Formula con interés preguntas y
y explicaciones acerca del preguntas y explicaciones explica acerca del epicentro de
epicentro de un sismo. acerca del epicentro un sismo.
de un sismo.

Causas, características y Indagación y descripción Valoración de las 4.10 Indaga y describe en forma
efectos de los riesgos en la de las causas, implicaciones sociales clara las causas, características
comunidad. características y efectos de los riesgos en una y efectos de los riesgos en la
de los riesgos en la comunidad. comunidad.
comunidad.
Relación y explicación de Interés por relacionar y 4.11 Relaciona y explica de forma
la magnitud y profundidad explicar la magnitud y coherente la magnitud y
de un sismo con las profundidad de un sismo. profundidad de un sismo con las
amenazas a las que se amenazas a las que se expone la
expone la comunidad. comunidad.

Acciones de prevención y Proposición y divulgación Interés por proponer y 4.12 Propone y divulga con interés
mitigación en caso de de acciones para prevenir divulgar acciones para acciones para prevenir y
derrumbes e inundaciones. y mitigar los riesgos en prevenir y mitigar los mitigar los riesgos en caso de
caso de derrumbes e riesgos en caso de derrumbes e inundaciones.
inundaciones. derrumbes.

127
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Indagación de Responsabilidad por 4.13 Indaga con responsabilidad las
instituciones que indagar instituciones que instituciones que prestan auxilio
prestan auxilio en prestan auxilio en caso de en caso de derrumbes
caso de derrumbes e derrumbes e inundaciones. e inundaciones.
inundaciones.

Mapa de riesgos y Representación y Participación activa en la 4.14 Representa y divulga en


recursos de la comunidad. explicación del mapa de elaboración y divulgación forma responsable el mapa
riesgos y recursos de la del mapa de riesgos y de riesgos y recursos de la
escuela y la comunidad. recursos de la escuela y escuela y la comunidad.
la comunidad.
Divulgación de rutas
a seguir en caso de
emergencia en la escuela
y en la comunidad.

128
Programa de estudio de quinto grado
Objetivos UNIDAD 5
¸ Explicar y clasificar con interés los distintos tipos de mezclas, experimentando con
algunos métodos de separación de sustancias para valorar su importancia y usos en la
vida cotidiana. EL MUNDO FÍSICO
¸ Indagar y explicar con responsabilidad las causas y efectos de la erosión del suelo,
proponiendo y divulgando medidas para proteger este recurso. QUE NOS RODEA
¸ Investigar y describir con curiosidad algunas características de las ondas y el
electromagnetismo, experimentando y construyendo instrumentos sencillos para explicar
su aplicabilidad en situaciones reales de la vida. Tiempo probable: 25 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Mezclas homogéneas y Experimentación y Curiosidad por 5.1 Experimenta con curiosidad
heterogéneas en líquidos- clasificación de mezclas diferenciar sustancias y clasifica sustancias de la
líquidos, líquidos-sólidos, homogéneas y de la cotidianidad en cotidianidad en mezclas
sólidos-sólidos. heterogéneas en líquidos- mezclas homogéneas y homogéneas y heterogéneas.
líquidos, líquidos- heterogéneas en líquidos-
sólidos, sólidos-sólidos; líquidos, líquidos-sólidos,
encontradas en la sólidos-sólidos.
vida cotidiana.
Explicación y Interés por comparar y 5.2 Compara y explica con interés las
comparación de las explicar las mezclas mezclas homogéneas y
mezclas homogéneas y homogéneas y heterogéneas.
heterogéneas. heterogéneas.

129
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Algunos métodos de Experimentación, Interés por la utilización 5.3 Experimenta, diferencia y
separación de sustancias: diferenciación y de métodos sencillos explica con interés los métodos
filtración, tamizado, explicación de algunos de separación de de separación de sustancias:
evaporación y métodos de separación sustancias: filtración, filtración, tamizado, evaporación
decantación. de sustancias: filtración, tamizado, evaporación y y decantación, utilizados en la
tamizado, evaporación y decantación. vida cotidiana.
decantación, aplicados en
la vida cotidiana.

Pérdida de minerales del Indagación y explicación Curiosidad por indagar y 5.4 Indaga y explica con certeza
suelo por la lluvia. de las causas de la explicar las causas de la las causas de la pérdida de
pérdida de minerales del pérdida de minerales por minerales del suelo por efecto
suelo por efecto de la efecto de la lluvia. de la lluvia.
lluvia.
Proposición y divulgación Claridad al divulgar 5.5 Propone y divulga con iniciativa
de algunas medidas algunas medidas para medidas para evitar la pérdida
para evitar la pérdida de evitar la pérdida de de minerales del suelo por
minerales del suelo por minerales del suelo por efecto de la lluvia.
efecto de la lluvia. efecto de la lluvia.

La erosión como efecto Investigación, discusión y Interés por investigar y 5.6 Investiga, discute y explica
de la deforestación de los explicación del daño que explicar los efectos que con objetividad los efectos
suelos. ocasiona la deforestación ocasiona la deforestación que ocasiona la deforestación
en los suelos. en los suelos. en los suelos.

Relación de electricidad y Indagación y descripción Curiosidad e interés por 5.7 Indaga con curiosidad y describe
magnetismo. de la relación de relacionar la electricidad la relación entre la electricidad y
la electricidad y el con el magnetismo. el magnetismo.
magnetismo.

130
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación y Orden y creatividad al 5.8 Investiga y experimenta con
experimentación de experimentar fenómenos orden y creatividad algunos
algunos fenómenos relacionados con fenómenos relacionados con la
relacionados con la electricidad y el electricidad y el magnetismo.
la electricidad y el magnetismo.
magnetismo.

Electroimán. Indagación y descripción Curiosidad por indagar y 5.9 Indaga y explica con interés
de la relación entre explicar el funcionamiento el funcionamiento de
la electricidad y el de los electroimanes. los electroimanes y su
magnetismo. importancia en la vida diaria.

Construcción y explicación Iniciativa y precaución 5.10 Construye y explica con iniciativa


de electroimanes sencillos. en la construcción de un electroimán sencillo.
electroimanes sencillos.

Formación de las sombras Indagación y explicación Curiosidad e interés al 5.11 Indaga y explica con curiosidad
de los objetos debido a la de las sombras como un explicar y relacionar las las sombras como un fenómeno
luz solar. fenómeno relacionado con sombras con la luz solar. relacionado con la luz solar.
la luz solar.

Experimentación de la Curiosidad e interés 5.12 Experimenta con interés la


formación de las sombras para experimentar con la formación de las sombras de los
de los objetos debido a la formación de las sombras objetos debido a la luz solar.
luz solar. de los objetos debido a la
luz solar.

131
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Cuerpos transparentes Identificación y Curiosidad por identificar 5.13 Identifica y clasifica con interés
u opacos. clasificación de los cuerpos transparentes los cuerpos como transparentes
los cuerpos como u opacos. u opacos.
transparentes u opacos
según su capacidad para
permitir el paso de la luz.
Experimentación y Curiosidad por realizar 5.14 Experimenta y clasifica con
clasificación de objetos de experimentos con los curiosidad algunos objetos de la
la vida cotidiana en cuerpos transparentes u vida cotidiana en transparentes
transparentes u opacos. opacos. u opacos.

132
Programa de estudio de quinto grado
Objetivo UNIDAD 6
¸ Identificar y representar con creatividad la estructura de algunos órganos del
cuerpo humano, indagando y explicando el funcionamiento e interrelación del
sistema circulatorio y respiratorio, a fin de proponer, practicar y divulgar medidas PREVINIENDO
para prevenir enfermedades.
ENFERMEDADES
Tiempo probable: 30 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Órgano del sentido del Indagación y comparación Cooperación e interés en 6.1 Indaga y compara con interés las
tacto: la piel. de las características de los la indagación de las características que existen entre
tipos de piel que protegen características de los los tipos de piel que protegen a
a algunos animales. tipos piel que protegen a algunos animales.
algunos animales.

Observación y Interés al observar y 6.2 Representa con claridad la


representación de la representar la estructura estructura de la piel de algunos
estructura de la piel de de la piel de algunos mamíferos.
algunos mamíferos y otros mamíferos.
animales.

Explicación de las Valoración de la función 6.3 Explica con certeza la función


funciones de la piel y la de la piel y su relación con e importancia de la piel y la
relación con el sentido del el sentido del tacto. relación con el sentido del tacto.
tacto.

133
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Medidas para proteger Discusión y argumentación Argumentación crítica 6.4 Discute y argumenta de manera
la piel. sobre las causas que sobre las causas que crítica las causas que provocan
provocan algunas provocan algunas algunas enfermedades de la piel.
enfermedades de la piel. enfermedades de la piel.
Indagación, discusión y Participación activa en la 6.5 Indaga y describe en forma
descripción de algunas indagación y discusión de correcta algunas medidas para
medidas para proteger la algunas medidas para proteger la piel.
piel. proteger la piel.

Proposición, práctica y Aceptación de la 6.6 Propone y divulga hábitos


divulgación de hábitos importancia de practicar higiénicos, personales y
higiénicos, personales y hábitos higiénicos, nutricionales para proteger
nutricionales para proteger personales y nutricionales la piel.
la piel. para proteger la piel.

Formas de evitar la Proposición, práctica y Disposición para proponer, 6.7 Propone, practica y divulga con
contaminación de los divulgación de medidas practicar y divulgar interés medidas higiénicas para
alimentos. higiénicas para evitar la medidas higiénicas a fin de evitar la contaminación de los
contaminación de los evitar la contaminación de alimentos.
alimentos en el hogar y la los alimentos.
comunidad.

Causas y consecuencias Investigación, discusión Curiosidad por investigar, 6.8 Investiga y analiza con curiosidad
del consumo de y análisis de las causas discutir y analizar las las causas y consecuencias de
alimentos en proceso de y consecuencias del causas y las consecuencias la ingestión de alimentos en
descomposición. consumo de alimentos de consumir alimentos en proceso de descomposición.
en proceso de descomposición y el daño
descomposición. que ocasionan a la salud.

134
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Identificación, descripción Interés por describir 6.9 Divulga con entusiasmo
y divulgación de las y divulgar algunas algunas características de los
características de los características de los alimentos en buen estado:
alimentos en buen estado, alimentos en buen estado el aspecto, la lectura de
tales como el aspecto, para su consumo. las viñetas de caducidad
lectura de viñetas con de los alimentos, antes de
caducidad, entre otros. comprarlos e ingerirlos,
entre otros.

Estructura y Descripción y Interés por conocer la 6.10 Describe y representa con


funcionamiento del representación de la estructura de algunos creatividad la estructura del
sistema respiratorio. estructura del sistema órganos del sistema sistema respiratorio humano.
respiratorio humano. respiratorio humano.
Comparación de algunos Disposición y objetividad 6.11 Compara y analiza con interés
órganos del sistema al analizar y comparar el los órganos del sistema
respiratorio de aves y sistema respiratorio de respiratorio en aves y mamíferos
mamíferos con el del ser aves y mamíferos con el con el de los humanos.
humano. de los humanos.
Indagación, discusión y Objetividad al indagar y 6.12 Discute y analiza con objetividad
análisis de las funciones analizar las funciones del las funciones del sistema
del sistema respiratorio sistema respiratorio en respiratorio en aves, mamíferos y
en aves, mamíferos y los aves y mamíferos. el ser humano.
seres humanos.

Interrelación del sistema Discusión, análisis Participación activa en 6.13 Discute, analiza y explica con
respiratorio y circulatorio. y explicación de la la discusión y análisis interés la interrelación del sistema
interrelación del sistema de la interrelación del respiratorio con el circulatorio.
respiratorio con el sistema respiratorio con el
circulatorio. circulatorio.

135
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Indagación y explicación Curiosidad e interés 6.14 Indaga y explica con interés
de algunas enfermedades por conocer y explicar algunas enfermedades del
del sistema respiratorio y algunas enfermedades del sistema respiratorio y circulatorio.
circulatorio. sistema respiratorio y del
circulatorio.
Proposición, práctica Solidaridad por las 6.15 Propone y divulga con
y divulgación de personas que presentan entusiasmo la importancia de
hábitos higiénicos, enfermedades en el practicar hábitos higiénicos,
alimentarios, posturales y sistema respiratorio y alimentarios, posturales y
ambientales para prevenir circulatorio. ambientales para prevenir
enfermedades de los enfermedades de los sistemas
sistemas respiratorio y respiratorio y circulatorio.
circulatorio.

La respiración o el Descripción y Curiosidad e interés por 6.16 Describe y explica en forma


intercambio de gases: explicación del proceso explicar el proceso de la acertada el proceso de la
bióxido de carbono y de la respiración o el respiración. respiración o el intercambio
oxígeno. intercambio de gases: de gases.
bióxido de carbono y
oxígeno.

Agente transmisor del Investigación y discusión Participación activa en la 6.17 Investiga y discute con interés
paludismo o malaria. sobre los efectos discusión sobre los efectos los efectos en la salud causados
producidos en la salud por producidos en la salud por por el agente transmisor del
el agente transmisor del el agente transmisor del paludismo o malaria.
paludismo o malaria. paludismo o malaria.

Análisis e interpretación Curiosidad e interés por 6.18 Analiza e interpreta de forma


de las causas del analizar e interpretar las correcta las causas del paludismo
paludismo o malaria. causas del paludismo o o malaria.
malaria.
136
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Medidas para evitar el Investigación y explicación Curiosidad e interés 6.19 Investiga y explica con
paludismo o malaria. de algunos signos y por investigar y explicar objetividad algunos signos
síntomas característicos algunos signos y síntomas y síntomas del paludismo o
del paludismo o malaria. del paludismo o malaria. malaria.

Proposición, práctica y Disposición para practicar 6.20 Practica, propone y divulga


divulgación de algunos las medidas para evitar el con interés algunas medidas
hábitos y medidas para paludismo o malaria. para evitar el paludismo o
evitar el paludismo o malaria.
malaria.

Uso del termómetro. Explicación de cómo Disposición por explicar 6.21 Explica con interés cómo
funcionan los termómetros el funcionamiento de los funcionan los termómetros de
de inmersión. termómetros de inmersión. inmersión.
Práctica del uso correcto Interés por practicar el uso 6.22 Utiliza en forma correcta el
del termómetro clínico. correcto del termómetro termómetro clínico.
clínico.
Investigación y explicación Disposición para utilizar 6.23 Investiga y explica la importancia
acerca de la importancia los termómetros y tomar la de conocer la temperatura del
de conocer la temperatura temperatura corporal. cuerpo utilizando diferentes tipos
corporal. de termómetro.
Investigación sobre los Valoración y
diferentes tipos de responsabilidad al
termómetros en la investigar sobre los
medicina. diferentes tipos de
termómetro en la
medicina.

137
Programa de estudio de quinto grado
Objetivo UNIDAD 7
¸ Indagar con objetividad las formas de reproducción en las plantas, la concepción del ser
humano y el riesgo de adquirir el VIH-SIDA y la rubéola, explicando la estructura y función
de los órganos reproductores, proponiendo y divulgando medidas de prevención, a fin de
¿CÓMO NOS
cuidar y mantener una buena salud. REPRODUCIMOS LOS
SERES VIVOS?
Tiempo probable: 21 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Reproducción en las Indagación y descripción Iniciativa por indagar y 7.1 Indaga y describe con juicio
plantas: natural y artificial acerca de algunas formas descubrir algunas formas crítico algunas formas de
(polinización, injertos e de reproducción natural de reproducción natural y reproducción natural y artificial
híbridos). y artificial en plantas: artificial de las plantas. en las plantas.
polinización, injertos e
híbridos.
Experimentación, Interés y creatividad al
descripción y representar los injertos en
representación de los las plantas.
injertos en las plantas.
Discusión y análisis de Interés por emitir juicio 7.2 Discute y analiza de manera
la reproducción en las crítico acerca de la espontánea sus opiniones
plantas y la intervención reproducción en las acerca de la reproducción en las
del ser humano para plantas y la intervención plantas y la intervención del ser
conservarlas del ser humano para humano para conservarlas y/o
y/o modificarlas. conservarlas y/o modificarlas.
modificarlas.

138
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Indagación y explicación Valoración de la 7.3 Indaga y explica con interés
sobre tecnologías modificación de las sobre tecnologías apropiadas
apropiadas para mejorar plantas para mejorar para mejorar las especies
las especies vegetales las especies vegetales, vegetales en el país.
desarrolladas en el país. desarrolladas en el país.

Estructura de los órganos Descripción y Respeto y objetividad en 7.4 Identifica, representa y describe
reproductores externos e representación de los la representación de la con respeto la estructura de los
internos: masculinos y órganos reproductores estructura de los órganos órganos reproductores externos e
femeninos del ser humano. masculinos y femeninos reproductores externos internos: masculinos y femeninos.
con sus partes externas e e internos masculinos y
internas. femeninos.

Funcionamiento de los Investigación y explicación Valoración del 7.5 Explica con respeto, el
órganos sexuales externos del funcionamiento de los funcionamiento de los funcionamiento de los órganos
e internos: masculinos órganos sexuales externos órganos sexuales externos sexuales externos e internos:
y femeninos del ser e internos: masculinos e internos: masculinos y masculinos y femeninos.
humano. y femeninos. femeninos.

Concepción y formación Discusión y análisis de la Respeto y objetividad al 7.6 Discute y analiza con
del ser humano. importancia de la analizar los problemas que objetividad las causas y
reproducción humana ocasiona el embarazo en consecuencias que conlleva
responsable. adolescentes. la reproducción sexual en la
adolescencia.

139
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación y descripción Disposición por investigar 7.7 Investiga y describe con
de los procesos la importancia de los respeto en qué consiste la
de menstruación, procesos de menstruación, fecundación, el embarazo, el
fecundación, embarazo, fecundación, embarazo, parto y el puerperio en el ser
parto y puerperio en el ser parto y puerperio en el ser humano.
humano. humano.
Discusión y análisis
sobre las causas y las
consecuencias del
embarazo en adolescentes.
Análisis y descripción de Juicio crítico sobre los 7.8 Analiza y describe con objetividad
los efectos psicológicos, problemas que ocasionan los efectos psicológicos,
biológicos y económicos los embarazos en biológicos y económicos de los
que puede ocasionar un adolescentes. embarazos en la adolescencia.
embarazo en adolescentes.

Análisis y comparación Valoración y criticidad de 7.9 Analiza y compara con


sobre las ventajas las ventajas y desventajas criticidad las ventajas y
y desventajas de del uso de métodos que desventajas que implica
la regulación de la regulan la fecundidad. la planificación familiar.
fecundidad.

Importancia de la vacuna Discusión y explicación Participación en la 7.10 Discute y explica con seguridad,
para evitar la rubéola y sus acerca de la importancia discusión sobre la cuál es la importancia de
efectos en el embarazo. de la vacuna para evitar la importancia de la vacuna vacunarse contra la rubéola.
rubéola y sus efectos en el para evitar la rubéola.
embarazo.

140
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Causas de VIH-SIDA en Investigación, discusión y Objetividad al analizar y 7.11 Investiga, discute y explica con
el país. explicación de las causas discutir las causas del responsabilidad las causas del
del VIH-SIDA en el país. VIH-SIDA en el país. VIH-SIDA en el país.

Medidas preventivas del Investigación, discusión y Valoración de los hallazgos 7.12 Investiga, discute y explica con
VIH–SIDA. explicación sobre medidas y descubrimientos de las juicio crítico algunas medidas
preventivas del VIH-SIDA. ciencias médicas para preventivas para evitar y reducir
disminuir el VIH-SIDA. la infección por VIH-SIDA.
Divulgación de algunas Toma decisiones 7.13 Divulga con responsabilidad
medidas para evitar el responsables para algunas medidas para evitar
VIH-SIDA. evitar el VIH-SIDA. el VIH-SIDA.

141
Programa de estudio de quinto grado
Objetivo UNIDAD 8
¸ Representar con creatividad la estructura interna de la Tierra, relacionando e indagando
con responsabilidad las causas del deterioro de sus recursos naturales con el propósito de LA TIERRA,
practicar y divulgar acciones para protegerlos.
NUESTRO GRAN
HOGAR
Tiempo probable: 24 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Beneficios de la energía Investigación, discusión Valoración de los 8.1 Discute y describe con
solar en el medio y descripción de la beneficios de la energía objetividad la importancia que
ambiente. importancia que tiene la solar para el ser humano y tiene la energía solar en el
energía solar en el planeta el planeta. planeta.
Tierra.
Investigación y descripción Interés al investigar y 8.2 Investiga y describe con
de la dependencia de los describir la dependencia interés la dependencia de los
seres vivos por la luz solar. de los seres vivos por la seres vivos por la luz solar.
luz solar.

Bosques de El Salvador Identificación y descripción Curiosidad por identificar 8.3 Clasifica y describe en forma
según su especie del manglar, morral y el manglar, el morral y correcta, los bosques de El
dominante: manglar, pinar como especies el pinar como especies Salvador, según la especie
morral y pinar. dominantes de los dominantes de los dominante: el manglar, el morral
bosques de El Salvador. bosques de El Salvador. y el pinar.

142
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Clasificación de los Interés por clasificar los
bosques de El Salvador, bosques de El Salvador
según su especie según su especie
dominante. dominante.

Cadenas y redes Explicación y Valoración de la 8.4 Explica y representa con


alimenticias. representación de cadenas importancia de las creatividad las cadenas
alimenticias como interrelaciones de los alimenticias.
eslabones de energía. organismos con el medio
ambiente.
Proposición de ejemplos
de cadenas alimenticias.

Destrucción de la flora, la Discusión y divulgación del Criticidad sobre el 8.5 Discute, analiza y emite
fauna y los ecosistemas. impacto que ocasiona la impacto que ocasiona la opiniones con respeto sobre
destrucción de la flora y la destrucción de la fauna en el impacto que ocasiona la
fauna en el ecosistema. el ecosistema. destrucción de la flora y fauna
Análisis y emisión de en el ecosistema.
juicio crítico sobre el
impacto que ocasiona la
destrucción de la flora y la
fauna en el ecosistema.

Acciones para proteger y Proposición y divulgación Respeto y amor por la 8.6 Propone y divulga con iniciativa,
cuidar la flora y la fauna. de acciones a realizar naturaleza. acciones para proteger y cuidar
para proteger y cuidar la la flora y fauna.
flora y la fauna.

143
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La estructura interna de Identificación, descripción Creatividad y objetividad 8.7 Representa y describe con
la Tierra: núcleo, manto y y representación de las al representar las capas seguridad, la estructura interna
corteza. capas internas de la Tierra. internas de la Tierra. de la Tierra.
Relación entre la Curiosidad por conocer 8.8 Relaciona, en forma correcta, los
composición interna de la relación entre la movimientos de la corteza
la Tierra y su dinámica composición interna de terrestre con la composición
interna. la Tierra y su dinámica interna de la Tierra.
interna.

Incidencia solar y el Investigación y explicación Curiosidad por los 8.9 Investiga y explica en forma
movimiento de traslación de la incidencia solar y el efectos del movimiento objetiva la incidencia solar y
de la Tierra. movimiento de traslación de traslación en las del movimiento de traslación
de la Tierra en las estaciones del año. de la Tierra en las estaciones
estaciones del año. del año.

Descripción y Interés por describir y 8.10 Describe y representa con


representación del representar el movimiento creatividad el movimiento de
movimiento de traslación de traslación de la Tierra. traslación de la Tierra.
de la Tierra.

Los eclipses de Sol y Representación, Interés por describir cómo 8.11 Representa con creatividad y
de Luna. diferenciación y se producen los eclipses explica la diferencia entre un
descripción de los eclipses de Sol y de Luna. eclipse de Sol y otro de Luna.
de Sol y de Luna.
Explicación y divulgación Precaución y cuidado al 8.12 Explica y divulga con
de las normas de observar un eclipse de Sol. interés algunas medidas de
seguridad cuando se seguridad cuando observa
observa un eclipse de Sol. un eclipse de Sol.

144
Programa de estudio de quinto grado
ESTUDIOS
SOCIALES
Presentación de la asignatura Investigación de la realidad social e histórica: promueve en
el alumnado la observación y la comprensión del porqué
Los Estudios Sociales son uno de los pilares fundamentales y cómo ocurren los hechos, y encontrar las razones de los
para propiciar y fomentar la formación y consolidación de mismos, realizar predicciones y sugerir soluciones.
valores morales y cívicos de ahí que esta asignatura capacite
al alumnado para interpretar las relaciones sociedad- Participación crítica y responsable en la sociedad: es decir,
naturaleza en las dimensiones geográfica, histórica, política que el alumnado comprenda claramente su contexto y
su cultura, y participe en ellos de forma crítica, creativa y
y económica; y fortalezca el conocimiento y la convivencia en responsable, promoviendo situaciones morales y éticas frente
la escuela, el hogar, la localidad, el país, la región y el mundo, al análisis de los problemas del país y de la región para que
a fin de insertarse de manera efectiva en la sociedad. rechace toda forma de falsedad y que adopte una posición
En este sentido se propone la formación de una salvadoreña y comprometida en la construcción de la democracia y la paz,
de un salvadoreño con la capacidad de construir socialmente además de expresar su afecto y vivir relaciones basadas en
su escala de valores para que, a partir de ella, desarrollen el reconocimiento del otro y en el respeto a su identidad.
criterios para el análisis, la intervención y la transformación
de la realidad. Bloques de contenido
Los bloques de contenido que integran la asignatura de
Enfoque de la asignatura: integrador de la Estudios Sociales para el segundo ciclo de Educación
realidad y de participación social Básica son. Bloque Nº 1: El medio geográfico y la realidad
de América Central. Bloque Nº 2: El medio socio-cultural de
El enfoque de la asignatura retoma los contenidos de las América Central. Bloque Nº 3: Desarrollo histórico de América
diferentes disciplinas de las Ciencias Sociales con la finalidad Central.
de formar estudiantes capaces de ejercer ciudadanía
responsable y crítica, y que contribuyan al desarrollo de una Bloque Nº 1: El medio geográfico y la realidad de
sociedad democrática. Los conocimientos se organizan en América Central.
función de las necesidades de los educandos, sin dejar a un
lado la rigurosidad y coherencia conceptual para construir Al tratar este bloque se le da énfasis al medio físico geográfico
una escala de valores que les permita comprender, analizar como los espacios en que vivimos para establecer los límites
y transformar la realidad. También incluye habilidades y dónde habitar y a quién le pertenecen y a prolongar al
actitudes en el ámbito familiar, escolar, comunitario, nacional alumnado en la comprensión de la realidad social de América
y mundial. Central. Se fomenta en los educandos la capacidad de
observar, imaginar, interpretar y explicar el medio geográfico
en su interacción recíproca con el espacio cultural de
Competencias a desarrollar América Central.
Análisis de la problemática social: pretende crear conciencia Bloque Nº 2: El medio socio-cultural de América Central.
y compromiso en el educando a partir de la reflexión crítica
de los problemas políticos, económicos, sociales, ecológicos Al incorporar este bloque se le da relevancia al medio socio-
y culturales presentes en la sociedad. cultural para entender la realidad social y cultural.

146
Programa de estudio de quinto grado
Se trata de que el alumnado adquiera aprendizajes medio geográfico y la realidad de América” con “El continente
significativos que le permitan comprender la realidad en la donde vivimos” y “Recursos naturales humanos: tesoro
cual están inmersos, autorrealizarse y transformarla si es americano”, de sexto grado. En este bloque se hace énfasis
necesario, continuando así, el desarrollo de su proceso de en el conocimiento del espacio porque es el escenario
socialización. Se trata de colocar al alumnado en contacto donde se dan los intercambios de los diversos fenómenos e
significativo con la realidad socio-cultural que le rodea, a influencias recíprocas entre ellos. Por otra parte, sabemos
fin de que valore y aprecie con una actitud crítica, cívica y que la actividad transformadora del ser humano es capaz de
participativa que le han de permitir acciones responsables construir paisajes culturales y organizar económica, política
dentro de una sociedad democrática. y administrativamente los diversos espacios: salvadoreño,
de América Central y americano.
Bloque Nº 3: Desarrollo histórico de América Central.
Hoy en día, los educandos necesitan conocer cual es
Comprende la vida del pasado de América Central para el impacto de su presencia en el mundo y como están
introducir al alumnado en la noción de tiempo y espacio donde vinculados a un espacio geográfico para que busquen el
se desarrollaron los hechos y de sus análisis históricos. Los desarrollo, el bienestar económico, social y ambiental;
momentos históricos que se analizan son un hilo conductor por lo que el segundo bloque de contenidos se refiere a
hacia la comprensión de los mismos para que los retomen y “El medio socio-cultural de El Salvador”, que da respuesta
les permitan conocer, analizar problemas y participar en la a las unidades didácticas tres y cuatro: “Así vivimos las
solución de los mismos. Además inferir la interdependencia salvadoreñas y los salvadoreños” y “Problemas, realidades
entre los hechos históricos y percibir la realidad como una y esperanzas” de cuarto grado; y “El medio socio – cultural
totalidad. Se trata de debatir los cambios del presente de América Central” con “Así vivimos los de América Central”
teniendo como punto de partida los del pasado inmediato y y “América Central: realidades, desafíos y esperanzas” de
lejano, a nivel de la totalidad histórica del continente y de la quinto grado; y “El medio socio – cultural de América” con
historia particular de cada país. “Así vivimos las americanas y los americanos” y “América:
problemas, realidades y esperanzas” de sexto grado.
Relación de los bloques de contenido con las El tercer bloque se refiere al “Desarrollo histórico de El
unidades didácticas Salvador”. El estudio de la historia es un proceso dinámico
donde el educando se encuentra a sí mismo, su origen y su
Desde el punto de vista de las disciplinas que fundamentan realidad. El proceso se inicia con la idea del pasado que le
las Ciencias Sociales se considera iniciar el programa permita construir una identidad presente y definir quién es
de estudio con el bloque de contenido sobre el medio y de donde viene. Sin embargo no termina ahí, continua con
geográfico y la realidad salvadoreña, de América Central y el encuentro de otras realidades mejores que se desean
americana; haciendo énfasis en el medio físico-geográfico alcanzar.
como el espacio en que vivimos: el país, la región y el
continente. El bloque uno: “El medio geográfico y la realidad Comprende dos unidades didácticas en cada grado: “La
Salvadoreña” está relacionado con las unidades uno y dos: identidad nacional a través de la realidad histórica” y
“El país donde vivimos” y “Recursos naturales: nuestro “Continuidad y cambio entre las sociedades pasadas
tesoro” de cuarto grado; “El medio geográfico y la realidad de y presentes” de cuarto grado; y “Desarrollo histórico de
América Central” con “La región donde vivimos” y “Recursos América Central“ con “La identidad de América Central a
naturales: tesoro que compartimos”, de quinto grado; y “El través de la realidad histórica” y “Continuidad y cambio de

147
Programa de estudio de quinto grado
las sociedades pasadas y presentes en América Central” Las unidades se han articulado atendiendo a la lógica
de quinto grado; y “Desarrollo histórico de América” con “La de las disciplinas, a las necesidades, los intereses y las
identidad americana a través de la realidad histórica” y aspiraciones del alumnado, y considerando planteamientos
“Continuidad y cambio en las sociedades de América” de pedagógicos.
sexto grado.
Las unidades se han organizado de la siguiente manera:
El programa de estudio muestra claramente el carácter
interdisciplinario de la asignatura: Geografía, Sociología, Unidad 1: La región donde vivimos.
Historia, Demografía, Economía, Antropología, Psicología Unidad 2: Recursos naturales: tesoros que compartimos.
social, Filosofía, Política, Derecho, Ecología. Muestra, Unidad 3: Así vivimos los de América Central.
además, su relación con las Ciencias Naturales, Lenguaje,
Matemática, Educación Física, Educación Artística, por Unidad 4: América Central: Realidades, desafíos y
medio de los ejes transversales: Educación en valores, esperanzas.
Educación ambiental, Educación en Derechos Humanos, Unidad 5: La identidad de América Central a través de
Educación para la equidad de género, Educación moral y la realidad histórica.
cívica, Educación para el consumidor, Educación para la
salud, Educación en población, Educación para la paz. Unidad 6: Continuidad y cambio de las sociedades
pasadas y presentes en América Central.
Comparación de las unidades didácticas de los programas anteriores y los actuales
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad
U id d 1:
1 El llugar ddonde
d vivimos
ii Unidad
U id d 1:
1 La
L región
ió donde
d d vivimos
ii Bloques dde contenidos
Bl id
Se promueve el aprendizaje en el niño – niña a Posición geográfica (Puntos cardinales y coordenadas Bloque No. 1:
ser capaz de ubicar Centroamérica en América, geográficas). Fronteras naturales y convencionales.
su posición de acuerdo a la latitud y longitud Perfil administrativo y división política. El relieve y El Medio Geográfico y
geográfica, límites y ventajas de su posición; clima. Regiones geográficas. Cambio climático. El la realidad de América
describir las características geográficas de la región calentamiento global. Sistema de prevención de riesgos Central.
centroamericana; influencia del relieve y los mares ante desastres.
sobre el clima y éste sobre los seres vivos y la
actividad humana; razonar sobre las ventajas de Unidad 2: Recursos naturales: tesoros que
las regiones con suelos fértiles y no fértiles y las compartimos
posibles soluciones, estudiar los recursos naturales,
conservación y mejora para mantener el equilibrio Recursos naturales y su conservación. Hidrografía
ambiental. y su función y protección. El suelo, formación y
características. Corredor biológico y áreas de
protección.

148
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad
U id d 2:
2 La
L nación
ió que fformamos Unidad
U id d 3:
3 Así
A í vivimos
ii llos dde A
América
éi C Central
t l Bl
Bloques dde contenidos
id
Se analiza las principales actividades económicas Economía y sectores económicos. Redes viales, Bloque No.2:
y la interrelación con las redes viales, medios medios de transporte y comunicación. El trabajo y las El medio socio-cultural
de transporte y de comunicación social. Trabajo ocupaciones. Trabajo individual, cooperativo y formas de América Central.
individual y cooperativo. El papel de la familia. La de organización. Higiene y seguridad ocupacional.
fecundidad y los tipos de crecimiento de la población. Marco legal y seguridad vial. La familia y la satisfacción
Migración del campo a la ciudad y de un país a otro. de necesidades, pautas y valores. Derecho para
Derecho y capacidad para formular su proyecto de formular metas personales.
vida. Igualdad de derechos entre mujeres y hombres.
Patrimonio cultural. Unidad 4: América Central: Realidades,
desafíos y esperanzas
La fecundidad y la mortalidad. Pirámides poblacionales
y condiciones de vida. Migración interna y externa,
causas y consecuencias. Migración y su influencia en la
conformación social y económica. Derechos Humanos
de la niñez, la mujer, el adulto mayor y la persona
con discapacidad. Constitución de la república y
convenciones internacionales.

Unidad 5: La identidad de América Central a


Unidad 3: Una cultura en el tiempo Bloques de contenidos
través de la realidad histórica
Se analizan los momentos históricos globales como Patrimonio cultural prehispánico y natural, conservación Bloque No.3:
la vida de nuestros aborígenes, conquista, vida y difusión. Primeros pueblos indígenas precolombinos y Desarrollo histórico
colonial, movimientos de liberación o independencia características. Descubrimiento y conquista. La colonia América Central.
hasta 1841; hechos económicos, sociales y políticos y organización (política, económica, social y religiosa).
más sobresalientes en los periodos de 1841 a 1930; Movimientos independentistas y sus protagonistas.
1930 a 1960; 1960 a 1969; 1970 a 1997, Independencias de las colonias. Federación
este último referido solo a El Salvador y enlazar con Centroamericana, organización política y territorial.
la vida actual. Hechos económicos, políticos y sociales de 1841 a
1929.

149
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 6: Continuidad y cambio de las sociedades pasadas y Bl
Bloques dde contenidos
t id
presentes de América Central

Hechos económicos, sociales y políticos relevantes


ocurridos entre 1930-1970 (Tipos de gobierno,
proceso de industrialización, apertura de carreteras,
construcción de presas, fundación de la Organización
de Estados Americanos, ODECA…) y de 1970-2000
(conflictos armados, procesos de paz, cumbres y
acuerdos, PARLACEN, migraciones, descubrimientos
científicos…) y para el siglo XXI. (Sistema de
Integración Centroamericana SICA. Tratados
comerciales, globalización, nuevas tecnologías…)

Objetivos de quinto grado Lineamientos metodológicos


1. Caracterizar con juicio crítico los factores físicos En Estudios Sociales, al igual que en las otras asignaturas,
y socioculturales de la región de América Central el papel del plantel docente es orientar a los educandos
analizando su interrelación a fin de valorar su importancia para que descubran y construyan sus conocimientos.
como elementos esenciales para la vida. Esto implica planificar una metodología que priorice que
los y las estudiantes observen, descubran y deduzcan
2. Argumentar con claridad los hechos económicos, políticos, conclusiones.
sociales y culturales del país y región de América Central
A fin de orientar la metodología de la asignatura se propone
analizando las problemáticas nacionales y regionales a una secuencia didáctica estructurada en seis fases que
fin de valorar su incidencia en el desarrollo humano. siguen un orden lógico para el desarrollo de cada contenido.
3. Analizar los procesos históricos de El Salvador y América Esta secuencia debe concebirse como un modelo, por lo
Central argumentando los hechos económicos, políticos y tanto puede adecuarse y enriquecerse con la experiencia
sociales ocurridos durante la época precolombina hasta docente, el conocimiento del alumnado, los recursos
tecnológicos y los materiales con que cuenta la escuela.
la actualidad para explicar sus causas, consecuencias y
su influencia en el desarrollo de la identidad nacional y La secuencia didáctica propuesta en este programa de
centroamericana. estudio es coherente con la desarrollada en los materiales
de apoyo que entregará el Ministerio de Educación: libro
de texto, guía metodológica y cuaderno de trabajo. Por
tanto se recomienda apoyarse durante la clase en dichos
150
Programa de estudio de quinto grado
materiales, adaptando su uso a las necesidades de las Fase 2. Construcción del conocimiento
niñas y los niños. Al familiarizarse con estos materiales será
más fácil enriquecerlos con otras experiencias en el aula o A partir de la realidad observada, las niñas y los niños
fuera de ella. descubren relaciones particulares que generalizan a
situaciones más amplias o al resto del mundo. Por lo
Fase 1. Actividad motivadora y de exploración de tanto, aprenden inductivamente. También se proponen
conocimientos previos procedimientos como la comparación para establecer
similitudes y diferencias entre los fenómenos y de ello
Esta fase debe promover que las niñas y los niños expresen sacar conclusiones que permitan la comprensión de
sus concepciones y percepciones de los contenidos los contenidos.
que serán abordados. Es importante que experimenten El alumnado entra en contacto con la información de las
que la realidad tiene distintas facetas o características, disciplinas de manera que pueda leerla, experimentarla
dependiendo de quien la mira y bajo qué circunstancias. e interpretarla sin necesidad del docente. Se recomienda
Debe potenciarse la curiosidad por explorar, orientando utilizar aproximaciones al contenido al menos de dos
también a examinar la forma en que las cosas cambian maneras:
constantemente. Ejemplo de actividades: Lea, observe,
reflexione, analice, opine, localice, ubique, concluya, Texto + imagen
entre otras. Texto + imagen + preguntas
Se espera que el alumno-alumna analice situaciones de A partir de la lectura, la reflexión y discusión de la
su entorno por medio de ilustraciones, fotografías, mapas, información, el alumnado formulará conclusiones. La o el
lectura de textos, estudio de casos, entre otras. Luego docente propicia la reflexión, el trabajo grupal y enriquecerá
responde a preguntas para evidenciar sus conocimientos y las conclusiones de las niñas y los niños, clarificando o
despertar su interés por los contenidos que se estudiarán. ampliando los contenidos.
El o la docente debe motivar para que sus estudiantes Fase 3. Construcción del conocimiento sobre el tema
comenten sus propias conclusiones y le encuentren sentido transversal
al fenómeno estudiado. Para ello puede preguntar sobre
el caso estudiado, por ejemplo: ¿Qué elementos son Nuestro mundo
proporcionados por la naturaleza? ¿Qué nombre reciben?
¿Qué elementos son elaborados por el ser humano? A partir de los conceptos descubiertos se identifican algunos
Expliquen la diferencia entre los elementos proporcionados problemas que generan la búsqueda de soluciones. Así se
por la naturaleza y los elaborados por el ser humano? invita a las o los estudiantes a trascender a una reflexión, un
cambio de actitud o un compromiso sobre problemáticas de
En el libro de texto que apoya el desarrollo curricular de su entorno cercano o lejano. Ejemplo: las niñas y los niños
la asignatura se proponen ilustraciones, fotografías, textos, observan la realidad del entorno (aire, agua, suelo, cerro,
mapas o casos de situaciones o ambientes de su realidad. volcán) y el deterioro ambiental, y reflexionan sobre cómo
solucionar el problema.
151
Programa de estudio de quinto grado
La maestra o el maestro solicitan al alumnado que opine Las niñas y los niños solucionan problemas, llevan a
sobre el problema provocado al no cuidar los árboles, el cabo actividades o contestan preguntas que les permitan
agua, el aire, el suelo del medio y proporciona indicaciones reafirmar su aprendizaje.
sobre los diversos cuidados que se necesitan. Ejemplo:
Fase 4. Actividades de representación y divulgación del Observa cada dibujo y explica qué tipo de recursos son:
conocimiento una gota de agua, una camisa, una estación de gasolina.
¿Cómo debe ser el agua para que el ser humano pueda
Fieles a la competencia y a la participación crítica y consumirla? La o el docente orienta a la elaboración de
responsable, se recomienda destinar tiempo para efectuar cada actividad para que el o la estudiante solucione los
actividades que activen y estimulen la imaginación, la problemas, y observa su desempeño y valora la pertinencia
de ofrecer refuerzo.
expresividad, el razonamiento y la motricidad, entre otras,
de manera que se sienta interés y compromiso al buscar, Fase 6. Consolidación del conocimiento
descubrir y compartir el conocimiento que ofrecen los
Estudios Sociales. Esta etapa se relaciona con el proyecto y Esta etapa requiere la comprensión del contenido, de
las actividades propuestas en el cuaderno de ejercicio. Las manera que se pueda explicar en forma resumida la
interrelación de los conceptos, principios o fases de cada
actividades son sencillas pero deben motivar e interesar a contenido.
las y los niños.
La alumna y el alumno lee e interpreta las ideas principales
Ejemplo: que se han trabajado en la lección y observa los dibujos
Los y las estudiantes contestan interrogantes, ubican un que le ayudan a comprender el significado del contenido
que ha sido tratado. La maestra o el maestro deberá aplicar
lugar en el espacio de acuerdo a los puntos cardinales diversas técnicas para lograr el desarrollo de esta habilidad
y coordenadas geográficas, localizan un lugar en un de sintetizar: collage, resúmenes, etc. Se recomienda de
mapa, etc., y descubren y aplican conceptos clave. Luego manera especial el uso de los mapas conceptuales y de los
comparten con sus compañeras, compañeros, familiares o resúmenes como herramientas apropiadas para sintetizar.
con su localidad. La o el docente orienta el trabajo del libro
y el cuaderno de ejercicios, y facilita las condiciones, los Resumen
recursos y apoyos para que las niñas y los niños puedan Los recursos naturales le sirven al ser humano para satisfacer
aprender de una manera activa e interesante y compartir sus necesidades de alimentación, vestido, vivienda, aire,
con otros sus hallazgos y propuestas. agua y electricidad.
Estos recursos se obtienen directamente de la naturaleza
Fase 5. Actividad de retroalimentación y pueden ser transformados para crear más cosas. Se
Como parte de la evaluación formativa se deberá clasifican en dos tipos: renovables y no renovables.
confirmar la comprensión de los conceptos clave o de los Los recursos renovables son inagotables porque siempre se
procedimientos esperados. regeneran, por ejemplo, el agua y el aire. Pero también es

152
Programa de estudio de quinto grado
importante cuidarlos, de lo contrario pueden contaminarse La evaluación formativa constituye un seguimiento que se
y agotarse. realiza a lo largo de ese proceso y que le proporcionará
información sobre los progresos y las dificultades de
Los recursos no renovables son aquellos que sólo existen las alumnas y los alumnos en el proceso de enseñanza
en una determinada porción y una vez se terminan, no aprendizaje. La razón de este seguimiento es entender sus
hay más. necesidades, darles ánimo, orientación y apoyo oportuno.
La forma de aprovechar los recursos naturales es usar la La observación directa del desempeño y la entrevista
energía que nos proporcionan el sol y el viento. personal permiten detectar dificultades oportunamente, así
como valorar las actitudes y las habilidades que las niñas
Lineamientos de evaluación y los niños están desarrollando. Por ejemplo, al observar
cómo expone un tema se puede detectar la manera en que
Evaluación diagnóstica una alumna o un alumno organiza sus ideas y las expresa.
En Estudios Sociales, como en otras áreas, es recomendable La coevaluación y la autoevaluación contribuyen a que las
y oportuno que siempre se haga una evaluación de inicio niñas y los niños tomen conciencia de sus progresos y de
cuando a las niñas y los niños se les está enfrentando a sus dificultades, de sus capacidades y de sus limitaciones.
un nuevo contenido o área temática, ya que comprenderán Demás está decir que observando los progresos y las
dificultades de sus estudiantes, el o la docente se puede
conceptos, procedimientos y actitudes y valores de forma evaluar a sí mismo. Como resultado, frecuentemente
integrada. deberá mejorar el desarrollo planificado para algunos
Al inicio del año escolar es muy conveniente orientar la temas, acelerar en otros o cambiar totalmente de estrategia
evaluación inicial en función de diagnosticar actitudes hacia metodológica.
sí mismos y hacia los demás, y las destrezas de ubicación
espacial. Estas son fundamentales para su interacción y La coevaluación
movilización en la vida cotidiana. La evaluación diagnóstica Es muy importante ya que propicia que las niñas y los niños
de las siguientes unidades del programa deberá partir del evalúen su comportamiento y participación en actividades
análisis de indicadores de logro de unidades anteriores o grupales (aprendizaje colaborativo). De esa manera el
de grados previos al que están cursando los estudiantes. alumnado puede comparar la valoración de su desempeño
con la opinión de sus compañeras y compañeros para
Evaluación formativa reflexionar sobre su aprendizaje. La o el docente debe
Evaluar los avances o progresos de la niña y del niño en orientar los aspectos que se valorarán en la coevaluación,
por ejemplo:
el desarrollo del manejo de conceptos, procedimientos,
actitudes y valores ha de ser un proceso sistemático y Aportó ideas para realizar la actividad (sí - no)
riguroso, que permita conocer oportunamente la información
requerida sobre el que aprende, el que enseña y el proceso Manifestó entusiasmo para trabajar en equipo (sí - no)
de enseñanza, a fin de que todos y todas se esfuercen en Fue responsable en las tareas que se le asignaron en el equipo
una mejora permanente. (sí - no)

153
Programa de estudio de quinto grado
Trató con respeto y amabilidad a sus compañeras y Pruebas específicas. Pueden ser orales y escritas.
compañeros (sí - no) En Estudios Sociales se debe insistir en evaluar, más
Evaluación sumativa que en memorizar la utilización correcta de términos y el
reconocimiento y la aplicación de conceptos. También se
Es la que se hace para registrar logros al finalizar una etapa debe evaluar procedimientos, presentando al alumnado un
de trabajo (trimestre) y al final del año lectivo. Su nombre material informativo nuevo para que apliquen conceptos y
indica que se evalúa sumando logros y objetivos cumplidos o procedimientos aprendidos anteriormente.
todo el producto del proceso educativo. Para ello se analizan Conviene valorar dentro de la evaluación sumativa los
y ponderan los resultados obtenidos de las actividades de resultados de la autoevaluación, para lo cual se debe
evaluación que reflejan el grado de aprendizaje respecto a brindar orientaciones precisas sobre los aspectos a evaluar,
los objetivos planteados al comienzo del proceso o período. de manera que el alumnado reflexione y tome conciencia
Los indicadores de logro que presenta el programa de de sus progresos y dificultades. Esto fomenta la motivación
estudio son un referente importante para planificar las y la autoestima.
actividades de evaluación, puesto que señalan evidencias
del aprendizaje expresado en los objetivos. El programa de estudio presenta indicadores de logro
que sirven de guía para determinar las evidencias de
Algunos de estos instrumentos que suelen utilizarse son: aprendizajes esperados. Potenciar competencias o logros
La observación sistemática. Deberá realizarse a lo largo por medio de Estudios Sociales supone una reflexión y
del período y materializarla en un registro. La técnica de la revisión de los criterios que se utilizan para ponderar y valorar
observación puede aplicarla en situaciones muy diversas, las actividades y los productos de las y los estudiantes.
como: Por ejemplo, si se pide que las y los estudiantes representen
El proceso seguido para elaborar un trabajo (evaluando las espacios mediante planos o mapas para orientarse y
tres fases: preparación, realización y aplicación posterior). desplazarse en lugares específicos, los criterios deben
Es importante observar actitudes de responsabilidad y atender tanto los elementos formales como los de contenido.
respeto, entre otras. Por ejemplo:
Las actividades de simulación (dramatizaciones y juegos). Funcionalidad: ubicación de un lugar específico, real.
Las actividades experimentales, muy propias para evaluar Estructura: presenta los referentes básicos para la
procedimientos: elaboración de representaciones gráficas, ubicación.
exposiciones, etc.
Claridad: representación de objetos o lugares de manera
La revisión de los trabajos. El cuaderno de clases con las comprensible.
actividades diarias, trabajos de indagación, actividades del
cuaderno de ejercicios, etc. Corrección: aplicación adecuada de relaciones espaciales.
Limpieza, orden y otros.

154
Programa de estudio de quinto grado
Objetivos UNIDAD 1
¸ Aplicar conceptos de orientación espacial para la ubicación de Centroamérica en el globo
terráqueo, el mapamundi y el mapa de América que permitan diferenciar con claridad sus
regiones y características geográficas a fin de valorar las ventajas y desventajas que ellas
tienen para el beneficio de la población de América Central. LA REGIÓN
¸ Diferenciar con juicio crítico la interrelación entre relieve y clima y éstos en las actividades
humanas en América Central, utilizando fuentes bibliográficas y la observación sistemática,
DONDE VIVIMOS
para participar en la planificación, ejecución de proyectos orientados a prevenir el
cambio climático.
¸ Adoptar una actitud solidaria y responsable en la planificación y ejecución de planes a nivel de
aula y el hogar participando con criticidad a fin de mitigar el riesgo ante los desastres naturales. Tiempo probable: 27 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Posición geográfica Representación y Precisión y seguridad al 1.1 Representa y ubica con
de América Central, descripción de la identificar la ubicación precisión la posición
extensiones territoriales, ubicación geográfica geográfica, las extensiones geográfica de los países
fronteras naturales y de América Central, territoriales, las fronteras de América Central, las
convencionales. extensiones territoriales naturales y convencionales extensiones territoriales,
y fronteras naturales de los países de América las fronteras naturales y
y convencionales en Central en el mapamundi, convencionales en el globo
el globo terráqueo, el el globo terráqueo y el terráqueo, el mapamundi y el
mapamundi y el mapa de mapa de América. mapa de América, partiendo
América partiendo de los de los puntos cardinales y las
puntos cardinales y las coordenadas geográficas.
coordenadas geográficas.

155
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ventajas y desventajas. Investigación y elaboración Participación activa en 1.2 Compara con seguridad las
de un cuadro comparativo la investigación y ventajas y desventajas de
de las ventajas y elaboración del cuadro la posición geográfica de
desventajas de la posición comparativo de ventajas América Central.
geográfica de América y desventajas de la
Central. posición geográfica de
América Central.

Perfil geográfico, división Investigación del Interés por investigar los 1.3 Investiga con interés los datos
política y administrativa de perfil geográfico, datos del perfil geográfico, del perfil geográfico, división
América Central. división política y división política y política y administrativa de
administrativa de cada administrativa de cada cada país de América Central.
país centroamericano. país de América Central.
(Extensión, capital,
religión, división política,
unidad monetaria,
fronteras y otros).

El relieve y el clima de Representación del mapa Reflexión crítica sobre 1.4 Identifica y valora con interés
América Central. Impacto orográfico y climático la interrelación entre el la interrelación del relieve y el
en las condiciones de vida de América Central relieve y el clima para la clima en la región geográfica
de la población. e identificación de la formación de las regiones de América Central.
interrelación del relieve y geográficas de América
el clima. Central.
Investigación de las Valoración de las 1.5 Investiga y valora con acierto
consecuencias positivas consecuencias positivas las consecuencias positivas y
y negativas de los y negativas de los negativas de los elementos y
elementos y factores del elementos y factores del factores del clima en la región
clima sobre la población clima sobre la población. de América Central y su
de América Central. impacto sobre la población.

156
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Las regiones geográficas Investigación y análisis de Interés por investigar 1.6 Investiga y analiza con
de América Central. las regiones geográficas y analizar con interés cada aspecto de las
de América Central responsabilidad los regiones geográficas de
en aspectos como: elementos que conforman América Central y las ubica
hidrografía, flora, fauna y las regiones geográficas de manera correcta en un
actividad humana; vías de de América Central. mapa geográfico.
comunicación, ciudades
y puertos principales y
ubicación en el mapa
geográfico.

Calentamiento global, Observación y análisis Criticidad al observar y 1.7 Observa y analiza con
cambio climático y de los hábitos de analizar los hábitos de juicio crítico hábitos de
hábitos de alimentación, alimentación, transporte y alimentación, transporte y alimentación, transporte y
transporte y consumo: consumo que contribuyen consumo que contribuyen consumo que contribuyen
causas y consecuencias. al cambio climático al cambio climático en al cambio climático en
en el país efecto del El Salvador, efecto del El Salvador, efecto del
calentamiento global. calentamiento global. calentamiento global.

Explicación de las Responsabilidad al 1.8 Explica con responsabilidad


consecuencias que tiene adoptar algunas las consecuencias que
para El Salvador el medidas para evitar el tiene para El Salvador el
calentamiento global. calentamiento global. calentamiento global e
Identificación y aplicación identifica y aplica las
de medidas para evitar el medidas para evitarlo.
calentamiento global.

157
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sistema de Prevención de Investigación y evaluación Disposición positiva para 1.9 Investiga y evalúa con
riesgo en América Central. de los planes existentes en realizar las acciones que seguridad los planes del
el sistema de prevención promueven los planes de sistema de prevención de
de riesgos de América los sistemas de prevención riesgos en América Central y
Central. de riesgos. se apropia de las propuestas a
nivel del aula y el hogar para
mitigar las consecuencias de
los desastres naturales.

Indagación sobre los Valoración de las acciones 1.10 Indaga con acierto los
mecanismos, instrumentos que se realizan a través mecanismos, instrumentos y
y organismos (Comité de de los mecanismos, organismos y se valoran las
protección civil, Cruz Roja, instrumentos y organismos acciones que se realizan para
Socorristas y otros) para para la prevención de la prevención de riesgos de
prevenir riesgos en cada riesgos de desastres. desastres en cada país de
país de América Central. América Central.

158
Programa de estudio de quinto grado
Objetivos UNIDAD 2
¸ Explicar con claridad y detalle algunas medidas de conservación de los recursos naturales
en América Central, investigando la relación entre el desarrollo industrial y la contaminación
ambiental, las consecuencias en la flora, fauna y cuencas hidrográficas por la deforestación, RECURSOS NATURALES:
basura y el uso de cocinas de leña y la influencia del crecimiento poblacional en el deterioro
de los recursos naturales a fin de planificar y ejecutar un proyecto de conservación. TESOROS QUE
¸ Explicar en forma correcta las funciones e importancia de las cuencas hidrográficas y
el corredor biológico centroamericano para el desarrollo de la región, identificando los
COMPARTIMOS
principales ríos que desembocan en el océano Atlántico y Pacífico y las áreas protegidas a fin
de apreciarlos y adoptar medidas para su protección y conservación como recursos vitales
para la población centroamericana. Tiempo probable: 18 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los recursos naturales de Investigación de los Aprecio por los recursos 2.1 Investiga los recursos
América Central. Uso y recursos naturales de naturales de su entorno naturales de América Central
conservación. América Central (suelo, como parte de América y aprecia las formas de uso y
agua, aire, minerales, Central. conservación de su entorno.
flora, fauna, entre
otros ) formas de uso y
conservación.

Hidrografía de América Representación en Valoración del recurso 2.2 Representa con acierto los
Central. Su función y un mapa de América hidrográfico con el que principales ríos y cuencas,
su protección para el Central de los principales cuenta la región de lagos y lagunas de la región
desarrollo económico. ríos y sus cuencas América Central y su de América Central y valora su
hidrográficas, lagos y función en el desarrollo importancia en el desarrollo
lagunas, clasificándolos económico. económico de la región.
según desemboquen en
el Océano Atlántico o el
Pacífico.

159
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Indagación de las partes Admiración e interés por 2.3 Indaga con interés y admiración
de un río y/o cuenca los resultados al indagar las partes de un río del entorno
hidrográfica del entorno sobre las partes de un río de la comunidad del niño-niña
de la propia comunidad o y/o cuenca hidrográfica desde donde nace hasta donde
país desde su nacimiento del entorno de su desemboca y describe un plan
hasta donde desemboca comunidad o país y los para su conservación.
y del plan gubernamental planes gubernamentales
o privado para su o privados para su
conservación. conservación.

El suelo de América Representación Colaboración para 2.4 Colabora y representa con


Central: formación y y explicación de realizar la representación interés el proceso y los factores
características. la formación y de la formación y que han influido en la formación
caracterización del suelo caracterización del suelo del suelo en la región de
de América Central y y los factores que han América Central.
los factores que han influido en su formación.
influido en su formación:
aluviones, cenizas
volcánicas, sedimentación.

El corredor biológico y sus Representación en un Respeto por las medidas 2.5 Representa con respeto
áreas protegidas. mapa de América Central, de protección de las áreas las áreas protegidas de
de las áreas protegidas protegidas de los países América Central y divulga
que integran el corredor de América Central y en su entorno alguna de
biológico de América adopción responsable las medidas de protección
Central. de alguna de ellas en su y conservación del corredor
entorno. biológico que ha adoptado.
Adopción y divulgación de
medidas de conservación
del corredor biológico de
América Central.

160
Programa de estudio de quinto grado
Objetivos UNIDAD 3
¸ Diferenciar con claridad las actividades económicas y localizar en un mapa de América
Central las redes viales y los medios de transporte explicando la importancia de ellos en el
desarrollo económico y social a fin de fortalecer la identidad e integración América Central. ASÍ VIVIMOS LOS DE
¸ Analizar y explicar en forma crítica el rol de la familia y el trabajo individual y cooperativo
para promover el bienestar personal y social, por medio de la reflexión del significado AMÉRICA CENTRAL
humano y social del trabajo y su relación con la formación y desarrollo de la familia y la
organización laboral a fin de valorarlos y planificar responsablemente metas personales
como miembro de una familia y como estudiante.
Tiempo probable: 36 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La economía de América Representación y Valoración positiva de la 3.1 Representa y explica con
Central: sectores de explicación precisa de los relación de los principales precisión los sectores
la producción. principales sectores de sectores económicos de productivos de América
producción de América producción en beneficio Central y valora los aportes
Central: primario, de la población. que éstos brindan a la
secundario, terciario y su población.
relación con la satisfacción
de las necesidades básicas
de la población.

Redes viales, medios Localización y Manifestación de 3.2 Localiza y representa con


de transporte y de representación grafica interés por representar interés en un mapa las
comunicación social de de las principales redes gráficamente las principales redes viales,
América Central. viales (terrestres, aéreas principales redes viales, medios de transporte y de
y marítimas), medios medios de transporte y de comunicación social en los
de transporte y de comunicación social en el
comunicación social en el desarrollo económico de países de América Central.
desarrollo económico de América Central.
América Central.

161
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación de la relación Valoración de la relación 3.3 Investiga y valora la relación
de las redes viales, de las redes viales, de las redes viales, medios de
medios de transporte con medios de transporte y transporte con los principales
los principales sectores los principales sectores sectores económicos de
productivos económicos: productivos de América América Central.
primario, secundario Central.
y terciario de América
Central.

El trabajo y las Representación y análisis Valoración del trabajo y 3.4 Representa, analiza y valora con
ocupaciones de América de la relación del trabajo y de las ocupaciones de interés sobre la relación de los
Central. las diferentes ocupaciones la sociedad de América trabajos y ocupaciones en la
de la sociedad de Central. sociedad de América Central.
América Central.

El trabajo individual y Representación y Participación activa en la 3.5 Representa y explica con


cooperativo como factor explicación del trabajo simulación y explicación acierto el trabajo individual
de producción. individual y el cooperativo del trabajo individual y el y cooperativo como factor de
como factores de cooperativo como factor producción y como un medio
producción y como medio de producción. para promover el bienestar de
para promover el bienestar las familias y los grupos de
de las familias y los grupos trabajo.
de trabajo.

Formas de organización Investigación y Adopción de actitudes 3.6 Investiga y caracteriza con


cooperativa. caracterización de las solidarias y responsables responsabilidad las diferentes
formas de organización en las actividades formas de organización
cooperativa. Ventajas y colectivas del centro cooperativa, ventajas y
desventajas. escolar. desventajas.

162
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Revisión y mejora de las 3.7 Revisa con responsabilidad
formas de trabajo que aspectos a mejorar en la
se llevan a cabo en las realización de actividades
actividades escolares que colectivas del centro escolar,
se realizan colectivamente. a partir de las ideas sobre
cooperativismo, proponiendo
formas de realizarlas de manera
solidaria y responsable.

Higiene y seguridad Investigación de las Apreciación de la 3.8 Investiga y aprecia la


ocupacional. normas de seguridad importancia de aplicar importancia de las normas
laboral y social en los las normas de seguridad de seguridad laboral y
ambientes de trabajo de laboral y seguridad seguridad social para
América Central. social para el bienestar el bienestar de las
de las trabajadoras y trabajadoras y los
los trabajadores en trabajadores de
América Central. América Central.

Marco legal y seguridad Investigación y explicación Respeta la aplicación en 3.9 Investiga y explica con respeto
vial en El Salvador. de los artículos de la la vida cotidiana de las los artículos de la Ley General
Ley General de Tránsito medidas de seguridad de Tránsito que se relacionan
relacionados con vial establecidas en la con los accidentes viales y los
los accidentes viales Ley General de Tránsito, aplica a su vida diaria.
y la descripción del en particular referidos al
comportamiento correcto peatón y al pasajero.
del peatón, el pasajero
y el conductor.

163
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Experimentación de la Reflexión crítica sobre 3.10 Experimenta con criticidad
utilidad que tiene la Ley la importancia de la la importancia de la utilidad
General de Tránsito como utilidad del marco legal de la Ley de tránsito como
documento preventivo y para la seguridad vial documento preventivo y
correctivo. de las salvadoreñas y los correctivo.
salvadoreños.

La familia y la satisfacción Caracterización de Valora y aprecia la familia 3.11 Valora y caracteriza con
de necesidades materiales, los tipos de familia y y su organización para interés cómo debe organizarse
emocionales y sociales. su organización, para satisfacer las necesidades la familia para cumplir
satisfacer sus necesidades básicas, afectivas y de con su rol positivo y lograr
básicas, afectivas y de buena comunicación. una auténtica convivencia
comunicación. armónica.

Pautas y valores en los Dramatización de pautas Muestra respeto, amor, 3.12 Dramatiza, valora y respeta las
miembros de la familia. y valores que antepone tolerancia, solidaridad, pautas de convivencia armónica
como niña o niño, para honestidad y rectitud con en la familia, en la escuela y la
mostrar respeto, amor, las personas que integran comunidad.
tolerancia, solidaridad, su familia, escuela y
honestidad y rectitud comunidad.
a su familia, escuela y
comunidad.

Derecho y capacidad para Formulación de metas Interés y autonomía al 3.13 Se interesa en la


formular metas personales. personales planificando formular metas personales formulación de metas
su vida futura, atendiendo como una autorrealización personales planificando
a sus valores familiares, personal. responsablemente su
sus propias aspiraciones y vida futura como una
convicciones. autorrealización personal.

164
Programa de estudio de quinto grado
Objetivos UNIDAD 4
¸ Expresar con detalle y claridad las diferencias entre las condiciones de vida de los
centroamericanos a partir de su fecundidad y mortalidad, crecimiento poblacional y la
migración interna y externa, para determinar la relación entre población y desarrollo.
AMÉRICA CENTRAL:
¸ Adoptar actitudes de respeto, promoción y defensa de los Derechos Humanos de la niñez, REALIDADES, DESAFÍOS
la mujer, el adulto mayor y las personas con discapacidad, identificando los propios
deberes dentro de la familia, el aula, el centro escolar, la localidad y el país para lograr un Y ESPERANZAS
mejor bienestar individual, familiar y social en la región de América Central.
Tiempo probable: 21 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La fecundidad, la Investigación sobre Se interesa por investigar 4.1 Investiga con interés sobre la
mortalidad y el la fecundidad y la el crecimiento poblacional fecundidad y la mortalidad en
crecimiento poblacional mortalidad y su impacto en América Central. América Central y su impacto
de América Central. en el crecimiento de la en el crecimiento poblacional.
población en América
Central.

Pirámides poblacionales, Construcción y lectura de Valoración y respeto 4.2 Construye y explica la


condición de vida de pirámides poblacionales por la población de condición de vida de la
los diferentes países de y diferenciación de América Central con población centroamericana,
América Central. los distintos sectores sus características y apoyándose en pirámides
poblacionales y su condiciones de vida poblacionales y otros datos
condición de vida. diversos. estadísticos, manifestando
respeto y valoración por las
personas.

165
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Causas y consecuencias Investigación sobre las Aceptación del fenómeno 4.3 Investiga las causas y
de la migración interna causas y consecuencias de las migraciones como consecuencias de las
y externa de América de la migración interna parte de la dinámica social migraciones internas y
Central. y externa en América de las poblaciones de externas de los pueblos de
Central. América Central. América Central y manifiesta
solidaridad por los habitantes
Elaboración de un que emigran.
Solidaridad con las
mapa conceptual de las poblaciones de América
migraciones externas de Central que emigran.
América Central.

El fenómeno de la Investigación de datos Responsabilidad al 4.4 Investiga y comenta con


migración en las últimas de la población que investigar y comentar las responsabilidad la influencia
décadas y su influencia en emigra fuera del área causas y consecuencias de la migración en la
la conformación social y centroamericana y su de la migración en el área consolidación de identidad
económica de los países relación con la sociedad de América Central en las de América Central en las
de América Central. y economía en las últimas últimas décadas. últimas décadas.
Causas y consecuencias. décadas, sus causas y
consecuencias.

Derechos Humanos Indagación bibliográfica Reflexión crítica sobre 4.5 Indaga con criticidad los
de la niñez, la mujer, e ilustración relacionada los derechos y deberes principales artículos de la
el adulto mayor y la con normas nacionales de la niñez, la mujer, el Constitución de la República
persona con discapacidad e internacionales de adulto mayor y la persona de El Salvador y las
en la Constitución protección de los derechos con discapacidad en la convenciones internacionales,
de la República de El y deberes de la niñez, la legislación nacional e referidos a los derechos y
Salvador y convenciones mujer, el adulto mayor y la internacional. deberes de la niñez, la mujer,
internacionales. persona con discapacidad. el adulto mayor y las personas
con discapacidad.
Formulación de propuestas Compromiso con prácticas 4.6 Propone prácticas que
para fortalecer el ejercicio que fortalecen el ejercicio fortalecen el ejercicio de
de derechos de la niñez, de los derechos humanos. los derechos humanos de
la mujer, el adulto la niñez, la mujer, el adulto
mayor y la persona con mayor y la persona con
discapacidad. discapacidad a partir de la
legislación estudiada.
166
Programa de estudio de quinto grado
Objetivos UNIDAD 5
¸ Comparar en forma responsable los hechos históricos y las características culturales
de los pueblos precolombinos de América Central, valorando la importancia de la
conservación, difusión del patrimonio cultural y su relación con el desarrollo de la identidad
LA IDENTIDAD DE
nacional, representando en un mapa de América Central los sitios arqueológicos, iglesias,
monumentos, personajes destacados en letras, música, poesía, arte y otros, a fin de participar AMÉRICA CENTRAL A
en su protección, conservación y difusión.
TRAVÉS DE LA REALIDAD
¸ Discutir con interés las causas y consecuencias de los procesos de descubrimiento, conquista
y colonización e independencia de América Central investigando su historia y explicando,
causas, consecuencias, los hechos ocurridos y sus protagonistas, para identificar eventos
HISTÓRICA
comunes y fortalecer la unidad de los estados centroamericanos.
Tiempo probable: 30 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El patrimonio cultural y Investigación y explicación Valoración y participación 5.1 Investiga y explica con claridad
natural centroamericano: sobre el patrimonio ante las diversas las medidas de conservación
conservación y difusión. cultural y natural manifestaciones del del patrimonio cultural y
centroamericano, material patrimonio cultural y natural centroamericano y las
e inmaterial, y sus medidas natural centroamericano. respeta.
de conservación.

Representación en un Muestra entusiasmo y 5.2 Representa con entusiasmo


mapa de los principales respeto por conocer en un mapa de América
sitios arqueológicos las raíces culturales Central los principales sitios
que conforman el centroamericanas.
patrimonio cultural y arqueológicos, como la Ruta
natural centroamericano, Maya, y respeta el significado
particularmente la Ruta de los bienes materiales e
Maya. inmateriales en el patrimonio
cultural.

167
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Divulgación y Creatividad y esmero 5.3 Divulga creativamente
concientización sobre al divulgar el respeto, información que promueve el
el respeto, cuidado y cuidado y apreciación respeto, cuidado y apreciación
apreciación del patrimonio del patrimonio cultural y del patrimonio cultural y natural
cultural y natural de natural centroamericano. centroamericano.
América Central.

Los primeros pueblos Representación en un Respeto y entusiasmo por 5.4 Representa y explica con
precolombinos de América mapa de los primeros comprender los momentos precisión las principales
Central. Características pobladores de América evolutivos de las culturas características de las culturas
culturales: políticas, Central. precolombinas en precolombinas en América
económicas, sociales, América Central.
ciencia, técnica, religión y Central e identifica las
cultura simbólica. regiones geográficas donde
Investigación de las Interés por identificar se desarrollaron.
características culturales y el legado histórico de 5.5 Investiga, interpreta y expone
el legado de los pueblos las principales culturas con interés y respeto las
indígenas precolombinos precolombinas en características y el legado de
en América Central. América Central.
la cultura Maya y Nahuatl en
América Central.

Descubrimiento y Elaboración de un mapa Interés por elaborar el 5.6 Elabora con interés el mapa de
conquista de América de América Central y mapa de América Central América Central y ubica con
Central. ubicación de los puntos y ubicar con exactitud exactitud los puntos geográficos
geográficos por donde los puntos geográficos por donde pasaron Cristóbal
pasaron Cristóbal Colón y por donde pasaron Colón y los conquistadores.
los conquistadores. Cristóbal Colón y los
conquistadores.

168
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación del proceso Respeto y juicio 5.7 Investiga, valora y explica con
de descubrimiento, crítico al dialogar respeto los hechos y personajes
conquista y colonización sobre los procesos de del descubrimiento, conquista y
de América Central. descubrimiento, conquista colonización de cada uno de los
Causas y consecuencias y colonización de América países de América Central.
culturales, económicas, Central.
sociales y políticas.

Las colonias españolas Indagación bibliográfica Participación activa en 5.8 Indaga y compara con interés
e inglesas en América sobre los hechos de la la indagación de los los hechos y personajes
Central y el Caribe. colonización de América hechos de la colonización involucrados en el proceso de
Central y algunas islas del española e inglesa en colonización de América Central
Caribe. América Central y el y el Caribe y diferencia en un
Localización en un Caribe. mapa las colonias españolas e
mapa y comparación inglesas de la región.
de los distintos tipos de
colonias que desarrollaron
españoles e ingleses en las
tierras centroamericanas y
caribeñas.

Organización política, Investigación y Apreciación del legado 5.9 Investiga con aprecio las
económica, social y elaboración de un histórico de la época características culturales de la
religiosa de la colonia en cuadro sinóptico de las colonial en la cultura de época colonial como legado
América Central. características políticas, América Central. histórico en la cultura de
económicas, sociales y América Central.
religiosas de la época
colonial en América
Central.

169
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Movimientos Representación en Juicio crítico al explicar 5.10 Representa con interés los
independentistas en un mapa de América los movimientos movimientos independentistas
América Central y sus Central de los independentistas y sus ocurridos en los países
protagonistas. diferentes movimientos protagonistas en América de América Central y sus
independentistas y sus Central. protagonistas y expresa su
protagonistas. valoración crítica sobre ellos.

La independencia de las Investigación, análisis Respeto por los ideales 5.11 Investiga e interpreta con
colonias españolas en e interpretación de las de Justicia, Igualdad juicio crítico las causas
América Central ocurrida causas externas e internas y Libertad que se externas e internas de la
entre 1810 y 1821. de la independencia de promulgaron en el período independencia de las colonias
las colonias españolas de Independencia españolas en América Central
entre 1810 y 1821 en en América Central. ocurridas entre 1810 y 1821.
América Central.
Elaboración de un 5.12 Expresa de forma creativa y
mapa conceptual de con respeto los ideales de
las causas internas justicia, libertad e igualdad
de la independencia que se promulgaron
centroamericana. en la independencia
centroamericana.
Investigación y explicación
de los ideales de justicia,
libertad e igualdad
de la independencia
centroamericana.

170
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La Federación Elaboración de un Valoración de la 5.13 Investiga y valora los
Centroamericana, resumen de las fechas importancia de hechos ocurridos, durante el
organización política y relevantes durante el la Federación origen, desarrollo y fin de la
territorial; y el surgimiento origen, desarrollo y Centroamericana en ese Federación Centroamericana.
posterior de los Estados fin de la Federación momento histórico.
Centroamericanos. Centroamericana.
Investigación y explicación Apreciación del 5.14 Investiga y explica con acierto
sobre el surgimiento de los surgimiento de los Estados el surgimiento de los Estados
Estados Centroamericanos tomando como precedente Centroamericanos y sus
y sus protagonistas. la independencia de las protagonistas.
colonias españolas en
América Central.

Hechos económicos, Elaboración de una línea Reflexión crítica en la 5.15 Elabora y explica con juicio
políticos y sociales de tiempo con los hechos explicación de los hechos crítico en una línea de tiempo
ocurridos en América económicos, políticos y económicos, políticos y los hechos económicos,
Central en el período sociales que ocurrieron en sociales sobresalientes en políticos y sociales ocurridos
1841-1929. el periodo 1841–1929 en el periodo 1841–1929. entre 1841-1929.
América Central.

171
Programa de estudio de quinto grado
Objetivos UNIDAD 6
¸ Investigar y analizar los principales hechos económicos, políticos y sociales de América
Central desde 1930 hasta las primeras décadas del siglo XXI, diferenciando y exponiendo
con juicio crítico sus causas y consecuencias en las condiciones de vida de la población a
fin de fortalecer la identidad salvadoreña y centroamericana.
CONTINUIDAD Y CAMBIO
DE LAS SOCIEDADES
PASADAS Y PRESENTES EN
AMÉRICA CENTRAL

Tiempo probable: 16 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Principales hechos Investigación y análisis de Juicio crítico en la 6.1 Investiga, analiza y expone
económicos, políticos los hechos económicos, investigación y el con juicio crítico y claridad los
y sociales ocurridos en sociales y políticos de análisis de los hechos hechos relevantes en América
América Central desde América Central ocurridos económicos, políticos y Central entre 1930 y 1960
1930 hasta 1970: tipos desde 1930 hasta 1970 sociales ocurridos entre en los aspectos: económicos,
de gobierno, proceso y los factores que le 1930 y 1970 y los políticos y sociales y los
de industrialización, favorecieron. factores que le factores que le favorecieron.
apertura de carreteras, favorecieron.
construcción de
presas, fundación de la
Organización de Estados
Centroamericanos
–ODECA– entre otros.

172
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Hechos económicos, Elaboración de una línea Reflexión crítica al explicar 6.2 Elabora en orden la línea de
políticos y sociales de tiempo de los hechos los hechos sociopolíticos y tiempo y explica los hechos
ocurridos en América que se dieron entre 1970 económicos ocurridos de sociopolíticos y económicos
Central de 1970 a y 2000. 1970 a 2000 en ocurridos de 1970 a 2000 en
2000: Conflictos América Central. América Central.
armados, procesos de
paz, cumbres y acuerdos
centroamericanos,
PARLACEN, migraciones,
descubrimientos
científicos, entre otros).
Investigación y Responsabilidad al 6.3 Investiga, explica y valora
explicación de los investigar y explicar los de manera responsable
hechos sociopolíticos y hechos sociopolíticos, las causas de los hechos
económicos en El económicos en El sociopolíticos y económicos
Salvador y América Salvador y América en El Salvador y América
Central entre 1970 y Central; sus Central desde 1970 hasta
2000; sus consecuencias consecuencias y el 2000 y sus consecuencias en
y el impacto en las impacto en las la condición de vida de
condiciones de vida de condiciones de vida de la población.
los de América Central. los habitantes de América
Central.

173
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Hechos económicos, Representación en un Interés al representar el 6.4 Representa con interés el
políticos y sociales cuadro cronológico de los cuadro cronológico de cuadro cronológico de los
ocurridos en América cambios ocurridos desde los cambios ocurridos cambios ocurridos de 2000 a
Central en el siglo XXI: 2000 a la fecha en de 2000 a la fecha en la fecha en América Central.
Sistema de Integración América Central. América Central.
Centroamericana –SICA–
tratados comerciales,
globalización, nuevas
tecnologías, entre otros.
Investigación y Interés por investigar 6.5 Investiga, explica y valora
explicación de los y explicar los hechos de manera responsable
hechos sociopolíticos sociopolíticos y las causas de los hechos
y económicos en El económicos en El sociopolíticos y económicos
Salvador y América Salvador y América en El Salvador y América
Central desde el Central desde el 2000 Central desde 2000 a la
2000 a la fecha; a la fecha; sus fecha y sus consecuencias en
sus consecuencias y el consecuencias y el la condición de vida de
impacto en las impacto en las la población.
condiciones de vida de condiciones de vida de
los habitantes de los habitantes de
América Central. América Central.

174
Programa de estudio de quinto grado
Glosario

Calentamiento global: es el fenómeno observado en las medidas de la Derechos humanos: toda persona, por su condición humana, es digna de
temperatura que muestra un incremento en la atmósfera terrestre y en los respeto y requiere ciertas condiciones de vida que le permitan desenvolverse
océanos en las últimas dos décadas. en la sociedad, satisfacer sus necesidades básicas y desarrollar sus
capacidades.
Cambio climático antropogénico: fenómeno ambiental cuyo efecto principal es
el recalentamiento de la atmósfera terrestre y sus causas se relacionan con Economía: analiza los procesos de producción, intercambio, distribución y
actividades humanas que están alterando la concentración de los gases que consumo de bienes y servicios, entendidos estos como medios de satisfacción
producen el efecto de invernadero. de necesidades humanas y resultado individual y colectivo de la sociedad.
Cambio climático o variabilidad natural del clima: es la modificación del clima Fecundidad: es el número promedio de hijos por mujer.
con respecto al historial climático a una escala global o regional. Tales
cambios se producen a muy diversas escalas de tiempo y sobre todo de Hecho: cuanto acontece o sucede en la naturaleza y en la sociedad.
parámetros climáticos: temperatura, precipitaciones, nubosidad, etc., Son
debidos a causas naturales. Hidrografía: parte de la geografía física que describe los mares, ríos y lagos.

Clima: condición promedio de la atmósfera de un punto o una región de la Independencia: es la situación de un país que no está sometido a la autoridad
superficie terrestre. de otro.
Confederación: unión de estados federados sometidos a un gobierno o poder Industrialización: es el paso de una economía basado en la agricultura a una
limitado, conservando altas cuotas de autonomía. fundamentada en el desarrollo de la industria, actividad económica en la que
los seres humanos realizan una serie de operaciones para la transformación
Conquista: proceso violento, desarrollado en períodos, cuyo objetivo es la de productos.
dominación de los pueblos nativos de América por parte de los europeos.
Istmo: lengua de tierra que une dos continentes: una península con un
Crisis: momento difícil en la economía y en la política, entre otros. continente, o una península con una isla.
Cuenca hidrográfica: es el área natural o región que recoge las aguas de Mercado Común Centroamericano: proyecto de integración de los mercados
manantiales, arroyos y quebradas, hasta formar la red de un río principal que centroamericanos, que se intentó implantar en la década de los sesentas del
generalmente desemboca en el mar. siglo XX.
Democracia: sistema de gobierno que se fundamenta en el funcionamiento Migraciones: fenómeno demográfico consistente en el desplazamiento
de un estado de derecho. En él rige el imperio de la ley que acatan sus individual o colectivo de personas de un lugar a otro.
gobernantes y gobernados. En el sistema democrático el pueblo es el que
ejerce la soberanía eligiendo a sus autoridades. Migrar: Trasladarse de una región o de un país a otro. El que abandona
su país nativo emigra; inmigrante es el extranjero que llega a un país para
radicar en él.

175
Programa de estudio de quinto grado
Mortalidad: se refiere a la tasa de defunciones o el número de defunciones en Sectores económicos: conjunto de actividades económicas que producen
un grupo determinado de personas en un período determinado. alimentos, carros, computadoras, recolección de basura, repartimiento de
mensajería y prestación de servicios de plomería, entre otros. Pueden ser
Paisaje geográfico: es el resultado de las interrelaciones de fenómenos físicos primarios, secundarios y terciarios. Lo realizan mujeres y hombres para
y biológicos que se producen en un lugar o espacio de la tierra. satisfacer las necesidades básicas de la población.
Patrimonio cultural: son todos los bienes muebles o inmuebles debidos a la Sector informal o economía informal: sector económico no regulado. Ejemplos
naturaleza del ser humano que representa interés desde el punto de vista de subempleo son los vendedores de dulces, flores, alimentos, etc., que
histórico, antropológico, arqueológico y artístico. trabajan en las calles.
Posición astronómica: es dada por una coordenada, proveniente de los Social: se refiere a lo relacionado con los seres humanos que viven en
meridianos y paralelos. Los meridianos se cuentan a partir de Greenwich, y asociación unos con otros.
dan un total de 360 grados; a estos se les llama longitudes, en tanto que a los Suelo: mezcla de minerales, materia orgánica, aire y agua, donde crecen las
paralelos se les llama latitudes y se dividen a partir del Ecuador en hemisferio plantas. El suelo forma la capa superior de la litosfera.
norte y hemisferio sur.
Sustentabilidad: mantener la capacidad de los recursos económicos para
Posición geográfica: cuando se habla del país o ciudad en relación a sus que sean capaces de beneficiar a generaciones posteriores.
vecinos, con quienes limita al norte, al sur, este y oeste, también se hace
relación a donde está localizado, por ejemplo en la región septentrional Territorio: área definida (incluyendo tierras y aguas) a menudo considerada
(norte) del continente. posesión de una persona, organización, institución, estado o país subdividido.
También se denomina territorio a la zona controlada o dominada por ciertos
Precipitación: la caída de lluvia, nieve, granizo o aguanieve sobre las superficies animales.
de las tierras y los mares. Tiempo atmosférico: es la variación de fenómenos que suceden en la atmósfera
Presión atmosférica: presión ejercida por la atmósfera no solo hacia abajo, de la tierra.
sino en todas direcciones; la presión ejercida sobre un cuerpo por el aire Trabajo cooperativo: entiende la cooperación como una asociación entre
equivale a 14.7 libras por pulgada cuadrada, al nivel del mar. personas que van en busca de ayuda mutua en tanto procuran realizar
actividades conjuntas, de manera tal que puedan aprender unos de otros.
Proceso de industrialización: Proceso de desarrollo de la actividad industrial
en la estructura económica de un país. Tratado de Libre Comercio: asociación comercial entre México, Estados Unidos
y Canadá.
Redes viales: son el conjunto de vías de un país o región; incluyen ferrocarriles,
carreteras, puertos aéreos y marítimos y fluviales. Son el sistema circulatorio Urbanización: acción de urbanizar. Está relacionada con el crecimiento de las
por el que transitan bienes y servicios (el transporte es un servicio y lleva ciudades y con el abandono de las áreas rurales por parte de la población.
bienes). Las importaciones y exportaciones dependen de esas redes. Urbano: lo que pertenece a una ciudad.
Región geográfica: es una porción de espacio terrestre cuya individualización Volcán: abertura de la superficie terrestre a través de la cual brotan rocas en
obedece a la combinación muy estrecha de las características físicas, de los estado de fusión (lava), cenizas, polvo volcánico, vapor de agua y gases.
hechos históricos, y de las actividades de las sociedades que lo ocupan.
Vertiente: declive de la superficie terrestre por donde corren o pueden correr
Relieve: son las formas de la corteza terrestre, superficie o litosfera. las aguas.

176
Programa de estudio de quinto grado
EDUCACIÓN
ARTÍSTICA
Presentación de la asignatura La particularidad de los programas de Educación Artística
en segundo ciclo es potenciar las capacidades analíticas de
La Educación Artística pone en contacto a los niños y a las y los estudiantes a través de actividades de investigación
las niñas con lenguajes artísticos fundamentales para teórica, histórica y cultural y su relación con las artes.
la expresión creadora y la comprensión de su cultura y
sociedad. Los fundamentos curriculares de la Educación Al mismo tiempo, se exploran las nuevas tecnologías
Básica han planteado la importancia de esta asignatura de aplicadas al arte y el acercamiento a los lenguajes
la siguiente manera: artísticos contemporáneos; se promueve una aproximación
más analítica al entorno de los niños y las niñas a través
“Desarrolla habilidades artísticas que enriquecen sus de las experiencias de enseñanza y aprendizaje, los
aptitudes, no solo para apreciar el arte, sino también círculos de opinión y análisis, las visitas de campo, la
para practicarlo, vivenciarlo y conservarlo mediante una revisión y valoración histórica y patrimonial, y finalmente el
variedad de técnicas. Se presenta en forma integrada, descubrimiento del papel de las artes en la vida cotidiana.
relacionando las áreas de expresión artística: la música, la
danza, las artes escénicas y las artes plásticas. Relación de la Educación Artística con otras asignaturas
Se organiza en torno a dos ejes fundamentales: Esta asignatura permite fortalecer habilidades importantes
para el aprendizaje de contenidos de Lenguaje, Matemática,
La percepción y el desarrollo de habilidades en Ciencia, Salud y Medio Ambiente, Estudios Sociales y
actividades musicales, plásticas y dramáticas. Educación Física. De ahí la importancia de integrar o
correlacionar contenidos de las diferentes asignaturas. A
La expresión personal gratificante de sentimientos e continuación, se mencionan algunos ejemplos de contenidos
ideas mediante el desarrollo de las diferentes formas de y habilidades afines:
manifestación artística”1.
Lenguaje
En este sentido, se espera que los y las estudiantes sean
receptores activos ante representaciones plásticas, La Educación Artística se relaciona con la asignatura
musicales y dramáticas, y que al mismo tiempo puedan de Lenguaje al interpretar textos literarios, que pueden
expresar su pensamiento, experiencia y fantasías a través ser ilustrados con dibujos y pinturas; o por medio de la
de estos mismos medios. construcción o representación de personajes con gestos y
ademanes y la ambientación con banda rítmica.
En segundo ciclo, esta asignatura profundiza en la Matemática
espontaneidad expresiva, el conocimiento progresivo y la
utilización de recursos y técnicas artísticas a partir de las La concepción y exploración de las figuras en el espacio
bases construidas en primer ciclo. Se da continuidad al bidimensional y tridmensional que aborda la Educación
desarrollo de la sensibilidad, imaginación y percepción Artística se relaciona con la construcción de cuadriláteros
de la sociedad y la cultura a través de los lenguajes y y sólidos geométricos planteados en los contenidos de
códigos artísticos. quinto grado de Matemática. Se encuentran analogías

178 1 Ministerio de Educación. (1999). Fundamentos curriculares de la Educación Básica, pág. 58.
Programa de estudio de quinto grado
aprovechables en la enseñanza del puntillo musical con el Educación Física
tema de sustracción de fracciones de la Unidad 5; además
La Educación Artística aborda el modelado de la figura
del recurso que constituyen las prácticas escénicas de humana con el reconocimiento de la estructura corporal y
realización de círculos y polígonos corporalmente. postura, lo cual establece analogías con los contenidos de
Educación Física. El uso del diafragma para estabilizar la
Ciencia, Salud y Medio Ambiente respiración, aumentar la capacidad de inhalación y mejorar
el control de expulsión del aire que se enfatizan de manera
Los contenidos de Educación Artística que señalan las permanente en las áreas de teatro y de música, también
relaciones de la música con la naturaleza y la utilización de se exponen en Educación Física; así como los contenidos
objetos reciclados en la elaboración de esculturas pueden sobre el cuerpo como expresión de identidad de la
aprovecharse en la Unidad 8 de Ciencia; de manera similar, Unidad 1 y la expresión corporal en la comunicación de la
Unidad 3, los cuales se relacionan estrechamente con la
el trabajo teatral con conceptos para su representación construcción de personajes en el área de escénicas.
corporal, como agua, energía, luz, enfermedad y su
representación corporal en imágenes, pueden apoyar los Por lo tanto, no es aceptable ni correcto suprimir parcial o
totalmente el desarrollo curricular de Educación Artística
aprendizajes de temas afines de dicha asignatura. por cumplir con objetivos de otras asignaturas, ya que
Estudios Sociales con ello se priva a las niñas y los niños de un aprendizaje
integral que fortalece habilidades y destrezas transversales
La Educación Artística desarrolla actividades que requieren y que aporta experiencias motivadoras y edificantes.
trabajo organizado y cooperativo para obtener resultados
óptimos en la puesta en escena de una coreografía, de un Enfoque de la asignatura:
guión teatral o en el montaje musical con coro o con banda artístico-comunicativo
rítmica, todo lo cual se relaciona con los contenidos de Enfatiza en el componente comunicativo de toda expresión
Formas de Organización Cooperativa de Ciencias Sociales. artística con la intención de fortalecer y potenciar los
De la misma manera, existen nexos entre los contenidos conocimientos, las habilidades y las actitudes que se ponen
que atañen al tema de patrimonio cultural de la Unidad 5 en juego al percibir (observar, escuchar), comprender y
de Ciencias Sociales con los que se desarrollan en música apreciar una obra artística como receptor de un mensaje,
sobre instrumentos salvadoreños antiguos y el baile de o bien al expresar ideas o sentimientos por medio de los
Historiantes. El área de Artes Plásticas destaca la utilidad recursos y las técnicas propias del arte.
de los mapas y su importancia en la agenda cultural del país Competencias a desarrollar
haciendo nexos con los contenidos de posición geográfica
del territorio nacional, estructura, composición y distribución Percepción estética
de la población, fronteras naturales y administrativas, Desarrolla la capacidad de observación de las
sectores económicos e historia de El Salvador que se representaciones plásticas, musicales y escénicas, además
abordan en Estudios Sociales. de promover la interpretación, indagación y análisis del
entorno natural y la actividad y creación humana (los objetos
179
Programa de estudio de quinto grado
y la creación artística). Supone la capacidad de conocer, Implica el desarrollo del pensamiento convergente y
analizar, reflexionar y disfrutar las producciones artísticas divergente, además de sensibilizar sobre las modas, gustos,
por medio de la observación activa de los elementos del tendencias del arte y la cultura del pasado y del presente.
mundo visual, la audición comprensiva de los componentes
de la música de varios géneros y el hallazgo de los Genera espacios y alternativas para el disfrute y el ocio.
elementos gestuales, orales y dramáticos más significativos. Permite la reflexión sobre las agresiones que deterioran
También implica el reconocimiento y disfrute del patrimonio la calidad de vida, ayudando a los niños y niñas a tomar
artístico local y obras emblemáticas de la humanidad; el
reconocimiento y diferenciación de los lenguajes artísticos conciencia de la importancia de contribuir a preservar un
y elementos que los caracterizan. entorno físico y social agradable y saludable.
Expresión estética Contribuye al desarrollo de la conciencia ciudadana a través
del trabajo en equipo en el que se requiere cooperación,
Promueve la iniciativa, la imaginación, la creatividad y la seguimiento de normas, respeto a las jerarquías, cuidado
espontaneidad, al mismo tiempo que enseña a valorar responsable de los espacios y recursos, además de
otras formas de expresión. Favorece la exploración de los proporcionar la satisfacción del fruto de un trabajo
lenguajes artísticos: sonidos, texturas, formas, espacios, colectivo.
el tiempo y la imagen. Implica la experimentación,
manipulación y tratamiento de los recursos por medio del Incluye contenidos que permiten conocer, valorar y disfrutar
desarrollo de las habilidades técnicas de cada disciplina expresiones artísticas y culturales nacionales y de otros
artística. Facilita que los niños y niñas aprendan a interpretar pueblos, desarrollando sensibilidad hacia la diversidad
su entorno y comunicar sus ideas y sentimientos de manera cultural. Además, fortalece los vínculos con el patrimonio
creativa. cultural y artístico favoreciendo la construcción de la
identidad cultural.
Requiere de una planificación previa y revisión de cada
etapa del proceso de creación, creatividad e iniciativa para Bloques de contenido
encontrar soluciones diversas a los problemas y esfuerzo
constante por alcanzar resultados originales con calidad. La naturaleza de los contenidos de esta asignatura
Valora la importancia de la flexibilidad y el respeto en los comprende básicamente tres formas artísticas: la música,
procesos colectivos de creación. las artes plásticas y las artes escénicas. Estas áreas y
Interpretación de la cultura y el mundo natural el componente sociocultural constituyen los bloques de
contenidos que estructuran la propuesta curricular de la
Contribuye al enriquecimiento de los marcos de referencia, Educación Artística.
a partir de la interpretación de manifestaciones del arte y
1. Educación musical
la cultura local o de otros pueblos. Dota a los alumnos de
instrumentos para hacer valoraciones y construir criterios Comprende la percepción, ejecución y apreciación de
válidos de apreciación del patrimonio artístico y cultural. la músca y los sonidos en el entorno urbano, natural,

180
Programa de estudio de quinto grado
doméstico, artístico y cultural; así como en la audición y sentimientos. Se promueve que los estudiantes realicen
musical de distintos géneros, épocas y estilos. Facilita sus propias creaciones de tal forma que se traduzcan en
herramientas para el desarrollo de la inteligencia auditiva, la objetos artísticos visuales en donde se expresan en su
coordinación motora y la proyección de la voz para el canto, propio lenguaje. El área también considera conceptos
activando por otra parte, el pensamiento abstracto con la para comprender la funcionalidad e iconicidad de las artes
subdivisión rítmica y el concepto morfológico de la música, visuales en la sociedad, lo cual contribuye a construir criterios
lo cual incide en los aprendizajes de la matemáticas y otras válidos para la apropiación y valoración crítica de los objetos
ciencias. Finalmente, el trabajo colectivo en los conjuntos visuales a los que están expuestos en la vida cotidiana;
musicales promueve la cooperación, la organización de con la resolución de la configuración bidimensional y
roles y el respeto de jerarquías, aspectos fundamentales en tridimensional por medio de las fases del proceso de diseño
el desarrollo de los niños y las niñas. se promueven la innovación y el pensamiento abstracto
“Respecto a la expresión, producción o elaboración musical, vinculándose con la Matemática. También se enfatiza en
la enseñanza y el aprendizaje se realizan a través de tres el análisis, la observación y la expresión, relacionándose
medios diferentes: la voz y el canto, los instrumentos y el con las asignaturas de Ciencia, Salud y Medio Ambiente,
movimiento y la danza. La voz es el instrumento comunicativo Estudios sociales y Lenguaje.
y expresivo por excelencia… Las canciones son un elemento 3. Educación escénica
básico del comportamiento musical… Los alumnos y las
alumnas de primaria han de conocer muchas canciones Se centra en la educación integral del alumno, ya que
que les aporten variedad expresiva, que tenga interés y articula diferentes recursos expresivos. Se trabaja con un
significado para ellos, a fin de dar cauce a sus sentimientos proceso convencional en el cual las personas, los objetos y
y enriquecer la representación del mundo.”2 los hechos dejan de ser lo que realmente son y se convierten
en otros que los representarán. Para esto se combinan, en
2. Educación plástica forma progresiva, elementos de: la expresión corporal como
Las artes plásticas se caracterizan por la construcción de el gesto, el movimiento, el espacio y el tiempo; la expresión
conceptos que se expresan de forma visual, por ello el área oral en la que se trabaja la respiración, la vocalización,
incluye el conocimiento e interpretación de imágenes, la el volumen. También se promueven experiencias para
observación activa del mundo visual, el conocimiento de los estimular y potenciar sus sentidos. Además, se experimenta
elementos visuales básicos que lo constituyen como la línea con el uso de otras técnicas dramáticas que incluye la
el color, la forma el volumen, las texturas de los materiales elaboración de títeres, las sombras chinas , la coreografía
y las técnicas para expresarse de manera creativa con y las bases para la elaboración de un guión dramático, y
autonomía. Para esto se promueve la observación activa con estas técnicas logre comunicar sus ideas , sentimientos
del entorno, y el analísis de las formas en que los artistas y experiencias en forma variada y atractiva frente a una
construyen sus discursos visuales para expresar sus ideas audiencia.

2 España. Ministerio de Educación y Ciencia. Área de Educación Artística. Primaria.


181
Programa de estudio de quinto grado
4. Arte y cultura Énfasis en la conexión de la expresión artística que
realizan los niños y las niñas con sus vivencias y
Comprende contenidos que permiten la valoración y
actividades en el centro escolar, y con su cultura para
apropiación de las diversas expresiones artísticas y
otorgarle mayor sentido al aprendizaje. Por ejemplo, en
culturales locales y nacionales. Al contextualizar las
el programa de Educación Artística Unidad 3, indica que
producciones musicales, plásticas o de artes escénicas
niños y niñas realizarán investigaciones de artesanías
como parte del patrimonio cultural, se accede a los valores
locales, de bailes tradicionales y de grupos musicales
y significados artísticos de país y de otras naciones.
populares.
Relación entre los bloques de contenido Los cambios de nombre se presentan de manera comparativa
y las unidades didácticas en el siguiente cuadro:
Unidades del Unidades del
Los bloques de contenido se organizan en tres unidades
de aprendizaje, de manera integrada y complementaria. programa anterior programa actual
El nombre de las unidades, sus contenidos y organización 1. Desarrollemos nuestro
1 1. La expresión artística en
presentan algunas modificaciones con relación al sentimiento artístico nuestro entorno
programa de estudio anterior. A continuación, se detallan
las adecuaciones más significativas: 2. Compartamos 2. El arte en el tiempo
Se han programado algunos contenidos de manera experiencias artísticas
que coincidan con las otras asignaturas en los mismos
trimestres y sea más fácil integrar o correlacionarlos. 3. Trabajemos con 3. Culturas y tecnologías
Por ejemplo, el programa de quinto grado de Estudios el arte en el arte
Sociales (Unidad 5) y el de Educación Artística (Unidad 2) Con respecto
C t a los
l programas anteriores,
t i se han
h cambiado
bi d
coinciden al abordar contenidos referentes al patrimonio los nombres de las unidades en tanto el enfoque de los
cultural que en el caso de artística atañe al baile de presentes programas de segundo ciclo apunta a la relación
Historiantes e instrumentos musicales antiguos. constructivista de la expresión artística de niños y niñas en
Mayor integración de los contenidos de plástica, música su relación con el entorno tanto en la dimensión cultural
y artes escénicas; de manera que tengan presencia como temporal.
en todas las unidades para fortalecer la comunicación Por ello, el cambio de nombre de la primera unidad
artística en los niños y las niñas. Por ejemplo, en la “La expresión artística y nuestro entorno” se debe a la
Unidad 1 artes escénicas promueve la ejecución de intención de valorar los elementos visuales, sonoros y de
sonidos con el cuerpo y con la voz abonando con ello movimiento que los niños y niñas encuentran en su entorno
a los contenidos de música; a su vez, en la Unidad 2, el y en sus vivencias personales como inspiración para su
área de plástica apoya los contenidos de música con la comunicación. Mientras, el cambio en la segunda mitad “El
elaboración de máscaras para una danza tradicional. arte en el tiempo” se justifica por la necesidad de relacionar

182
Programa de estudio de quinto grado
la cultura y el arte de épocas pasadas y del presente con
Unidades Bloques de contenido
el fin de facilitar referentes para enriquecer la expresión
y la valoración del patrimonio cultural y artístico y revisar 3. Culturas y Se potencian los bloques de contenido de
las relaciones entre las manifestaciones del pasado y de plásticas, música y escénicas que exponen
tecnologías nuevos y más complejos elementos
la actualidad. Finalmente, la tercera unidad “Culturas y en el arte de la rítmica musical, del diseño y del
tecnologías en el arte” enfatiza el impacto de las nuevas discurso escénico para su aplicación
tecnologías en las manifestaciones artísticas, lo cual se en la manifestación creativa de niños y
niñas. Se abordan nuevas tecnologías y
manifiesta en su concepto, en los soportes y formas actuales su impacto en la producción musical y la
de difusión de las artes. creación plástica.
El aprendizaje y la apropiación de las competencias
de Educación Artística requieren de un tratamiento
Objetivos de quinto grado
interrelacionado de los bloques de contenido. Esta versión 1. Interpretar con autonomía y entusiasmo, manifestaciones
presenta los contenidos de los diferentes bloques en tres artísticas que fortalecen su identidad y pensamiento
dimensiones: conocimientos, procedimientos y actitudes, lo crítico para fortalecer la comprensión del entorno cultural
que facilita aún más la integralidad de los aprendizajes. y social del pasado y del presente y las relaciones
humanas.
Unidades Bloques de contenido
2. Comunicar con agrado y creatividad sus ideas,
1. La expresión Los bloques de contenido de plásticas, experiencias e imaginación por medio de lenguajes
música y escénicas tienen mayor énfasis artísticos para fortalecer sus relaciones en el contexto
artística y nuestro que Arte y cultura. En esta unidad se
entorno introducen elementos y técnicas para educativo, familiar, social y cultural.
profundizar en el conocimiento de los 3. Identificar y valorar obras y autores representativos
lenguajes artísticos y así facilitar la
expresión por medio de la improvisación del arte nacional e internacional para enriquecer su
dramática, la ejecución rítmica de figuras capacidad de apreciar el arte y promover su difusión en
compuestas, la representación gráfica de la el contexto cercano.
música o la exploración de la bidimensión
y tridimensión.
Lineamientos metodológicos
2. El arte en el En esta unidad se evidencia una mayor
orientación hacia Arte y Cultura. Se El desarrollo curricular de Educación Artística privilegia
tiempo desarrollan contenidos relativos a danzas experiencias que permiten un desempeño activo del
folclóricas, bailes populares, máscaras alumnado, con oportunidades para la manipulación y la
y otras manifestaciones del patrimonio
inmaterial salvadoreño. acción externa: dibujo, canto, baile, etc.; así como para
acciones internas: plantearse interrogantes, relacionar lo
que se sabe con los nuevos contenidos, buscar soluciones,
entre otros.

183
Programa de estudio de quinto grado
Por lo tanto, las y los docentes deben planificar sus clases artística debe permitir que opinen con libertad desde
para generar situaciones que permitan que los niños y las su experiencia, que se hagan preguntas y generen sus
niñas aporten desde su propia experiencia, de manera propias conjeturas o hipótesis. La manipulación de
que sientan seguridad de opinar a partir de lo conocido instrumentos para la expresión plástica, la ejecución de
y de sus propias reflexiones. A partir de su experiencia instrumentos musicales o la experimentación con la voz
personal, las y los estudiantes aplicarán en forma y el cuerpo deben llevar al niño o a la niña a descubrir
progresiva los conocimientos y procedimientos que les sus posibilidades expresivas. Como consecuencia de
ofrece la asignatura. esta experiencia sensorial, los niños y las niñas pueden
Conviene alternar el trabajo individual y en equipo, tomar conciencia y expresar su propia apreciación
ya que refuerzan aspectos diferentes. Por ejemplo, el artística. Así, deberán abrir espacios para explicar los
trabajo individual favorece la autonomía; y al trabajar con detalles que les llamaron la atención en un texto literario,
compañeros y compañeras, se permite el intercambio y lo que más les gustó de una canción, las emociones
apoyo entre iguales, lo que favorece la convivencia. que experimentaron al bailar, lo que comprendieron al
escuchar o ver una representación, etc. Las actividades
Con el propósito de orientar la metodología, se presenta deberán combinar organización grupal e individual y
una secuencia de pasos o procedimientos generales para en el caso de la educación musical, la banda rítmica y
el desarrollo de los contenidos. Las y los docentes deberán el coro del aula son recurso obligado para aplicar los
precisar y adecuar las actividades según las necesidades de conocimientos aprendidos en clase.
sus estudiantes y las particularidades de los contenidos.
El uso del musicograma resulta atractivo para los niños
1. Fase de motivación porque brinda la ilusión de aprehender la música
Aunque las actividades expresivas de esta asignatura dibujándola en un papel, además de captar su atención
son por sí mismas atractivas, se debe insistir en iniciar durante una audición. Optimiza resultados en las
los contenidos a partir de su experiencia personal audiciones comprensivas ya que en un musicograma
(vivencias) o de su percepción (observación, escucha se puede “plasmar” la forma de una pieza musical (por
o manipulación). Un ambiente de confianza propiciará ejemplo, representando con cuadros de colores cada una
que el alumnado se exprese, explore y comparta desde de sus partes); también se pueden dibujar los instrumentos
el inicio. Previamente al desarrollo de contenidos que que se escuchan o los personajes a que alude el texto
impliquen expresión oral, así como canto, el docente de una canción. Es un recurso de gran versatilidad y se
orientará a niños y niñas en la respiración diafragmática implementa con materiales de uso común en el aula.
con el fin de facilitar la proyección de la voz sin perjuicio La aproximación a las producciones plásticas se
de sus cuerdas vocales. puede realizar a partir de la lectura de un texto literario
2. Actividades de desarrollo relacionado con el contenido de la obra, propiciando el
La comprensión del hecho artístico inicia con la diálogo sobre estas relaciones y otras que atañen a los
exploración y la manipulación de recursos y técnicas. diferentes contextos incluyendo los personales. También
El contacto de las y los alumnos con la producción se puede partir de la “lectura” de la propia obra plástica,
sobre todo en aquellas de carácter figurativo en donde

184
Programa de estudio de quinto grado
la narrativa de la obra es clara. En cuanto a las obras 3. Actividades de culminación
abstractas su lectura se basa en la observación del En este momento, se deberá reforzar las técnicas
gesto, las gamas cromáticas, el lenguaje expresivo de empleadas por medio de conclusiones, confirmación
los elementos visuales (trazo, mancha, textura, etc.) y lo de conceptos y procedimientos, y la organización de
que sugieren junto al título de la obra de manera más exposiciones para que los y las estudiantes compartan
abierta a la interpretación personal. Otras actividades los resultados y conozcan la opinión e interpretación
relacionadas pueden ser: de los demás. Siempre y cuando sea posible, se debe
Carteles vivos y textos ambientales ilustrados en contar con la participación de la familia y la comunidad
equipos usando elementos visuales para que refuercen educativa. Al final de aquellas actividades artísticas que
su manejo de los mismos y el sentido de la imagen como resulten en la alteración del orden habitual y aseo del aula
medio expresivo. o de la escuela, el docente promoverá la participación de
niños y niñas en la limpieza y organización del espacio
Círculo de valoración de las obras artísticas con relación escolar, así como en el mantenimiento de sus
a los contextos culturales, históricos, geográficos, etc. instrumentos de trabajo.
en los cuales se inserta la temática tratada y el tipo de
imagen que se discute de acuerdo a su funcionalidad Lineamientos de evaluación
en contexto. Esto es particularmente propicio para la
interpretación de las imágenes que ilustran un cuento La evaluación inicial o diagnóstica
abordando el manejo de los elementos visuales, así como
el significado de las ilustraciones con relación al texto. Los Fundamentos Curriculares de la Educación Básica
Las ilustraciones producidas en este tipo de sesiones recomiendan realizar un diagnóstico previo que permita
pueden ser secuencias complementarias al cuento que “determinar las condiciones psicopedagógicas de los
se ha leído en clase ó variaciones del desenlace de la educandos en relación con sus necesidades e intereses;
misma historia. además se podrá descubrir el potencial de recursos que
Visitas a salas de muestra de artes visuales como el el medio natural, social y cultural ofrece para determinar el
Museo Nacional de Antropología David J. Guzmán; la nivel real de conocimiento y desarrollo de habilidades…”
Sala Nacional de exposiciones del Parque Cuscatlán; el (pág. 61).
Museo de Arte de El Salvador, MARTE. También a talleres Algunos niños y niñas presentarán mayor espontaneidad
artesanales y estudios de artistas locales. para cantar, bailar o recitar; otros y otras estudiantes
Demostración de las diferentes técnicas de parte tendrán mayor disposición a las artes plásticas como el
del docente. dibujo, el modelado, etc. Es importante conocer las aptitudes
Cada actividad tendrá sus particularidades en el uso del de los niños y las niñas para potenciarlas adecuadamente,
espacio, el manejo del tiempo o los recursos, de acuerdo respetando las diferencias individuales.
con el área en que se enfatice: música, plástica o artes
escénicas. Sin embargo, se propone plantear actividades Con la información oportuna se podrá tomar decisiones
que las integren. pertinentes para brindar óptimas condiciones de

185
Programa de estudio de quinto grado
aprendizajes a los niños y a las niñas, atendiendo sus Criterios Dominio bajo Dominio medio Dominio alto
particularidades. Identificación de Observa pero Comenta al Comenta
características no comenta menos una diferentes
La evaluación del proceso o formativa de esculturas las diferentes característica características
contemporáneas esculturas. de alguna de de las esculturas
La observación del trabajo de las y los alumnos es muy (10%). las esculturas observadas.
importante en todos los tipos de evaluación. No es suficiente observadas.
observar los productos finalizados, porque pueden haber
sido elaborados por familiares de los niños y las niñas, Solución a Las piezas de La escultura se La escultura se
lo que afecta la valoración del trabajo y la intención problemas de la escultura sostiene sola sostiene sola
de la evaluación. Al observar cómo trabajan los y las ensamblaje se caen con pero no se y se puede
(10%). facilidad y no se puede apreciar apreciar desde
estudiantes se puede detectar sus errores o las omisiones sostiene sola. desde todos los diferentes
y reforzar oportunamente los procedimientos que se están ángulos. ángulos.
aprendiendo.
Uso de La mayoría de La mayoría Todos los
La evaluación final o sumativa materiales (5%). materiales no de materiales materiales
son reciclados. utilizados son utilizados son
Para asignar calificaciones, el o la maestra debe tener claro reciclados. reciclados.
los criterios con los que juzgará o valorará los desempeños
descritos en los indicadores de logro y con qué actividades
de evaluación los pondrán en evidencia. Autoevaluación Busqué los materiales para mi escultura entre los reciclados. Sí No (3%)
(10%). Me interesa reutilizar los materiales para no generar desechos. Sí No (3%)
Para ello, el o la docente deberá elaborar una lista de cotejo Utilicé ideas nuevas o modifiqué algunas de las esculturas observadas. Sí No (4%)
o escala de valoración, de acuerdo con la técnica o la
actividad que se realice. Por ejemplo, al evaluar e diseño de
una escultura con objetos reciclados se deben considerar Instrumentos como este se emplean para evaluar diferentes
aspectos básicos del desempeño y ciertas actitudes procedimientos como la participación en una obra escénica,
esperadas por parte del alumnado. el canto, el baile, etc. Asimismo, orientan la autoevaluación
Rúbrica para evaluar la escultura con objetos reciclados y co-evaluación, de manera que los niños y las niñas tomen
Diseño (35%) conciencia de sus avances y adquieran mayor autonomía y
responsabilidad.
Para estructurarlos, el o la docente puede orientarse a partir
de los indicadores de logro del programa de estudio.
Los criterios de evaluación deben responder al enfoque de
la asignatura y a sus competencias. Pueden ser variados,

186
Programa de estudio de quinto grado
de acuerdo con la naturaleza de cada actividad y al bloque Orden y aseo del lugar donde trabaja.
de contenido que prevalezca, por ejemplo: Iniciativa y autonomía al improvisar en una actuación o
Escucha atenta de la canción (para el caso de la seleccionar una técnica.
música). Colaboración y respeto por el trabajo de otros y otras
Seguimiento del procedimiento (para el caso de la compañeras.
plástica). Espontaneidad al cantar o bailar.
Creatividad en el uso de colores, materiales o formas Respeto por el patrimonio cultural.
(dependerá de la actividad).
Es importante dar a conocer al alumnado, de forma clara
Esmero en finalizar su tarea. y sencilla, los criterios de evaluación y los desempeños
Responsabilidad y precaución con el uso de ciertos esperados en los indicadores de logro. Así podrán
materiales. autoevaluarse de manera responsable.

187
Programa de estudio de quinto grado
Objetivos UNIDAD 1
¸ Expresarse musicalmente con el uso de figuras rítmicas compuestas y con la
representación en musicogramas de piezas salvadoreñas y de otras culturas tanto del
pasado, como del presente, para valorar y apreciar la relación de sonido y música con el
entorno cotidiano y cultural.
¸ Expresar sus ideas y experiencias con creatividad e iniciativa utilizando colores y otros LA EXPRESIÓN ARTÍSTICA
recursos plásticos en bidimensión y tridimensión para fortalecer su razonamiento,
comprensión de la dinámica de los elementos visuales; su creatividad y capacidad
interpretativa.
Y NUESTRO ENTORNO
¸ Expresarse oral y corporalmente con entusiasmo y espontaneidad, al practicar la
respiración diafragmática, el ensamble de ritmos y sonidos en grupo, así como la
práctica con las bases de la improvisación dramática con el objeto de representar con
espontaneidad una idea que exprese sentimientos y vivencias en situaciones de juego.

Tiempo probable: 40 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Características particulares Experimentación con los Creatividad al 1.1 Realiza con creatividad un
de los materiales y técnicas materiales y técnicas de experimentar con los muestrario de materiales
de dibujo y pintura. dibujo y pintura para diferentes materiales y y técnicas para dibujar y
caracterizarlos. realizar un muestrario que pintar, anotando comentarios
registre variaciones de personales sobre sus
cada uno de ellos. características.

Selección y planificación Interés y disfrute al ejecutar 1.2 Ejecuta con responsabilidad


de temas, técnicas y su planificación trimestral su planificación de temas a
materiales a utilizar en el de dibujo y pintura. pintar, utilizando los materiales y
trimestre. técnicas seleccionadas.

188
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Uso de la respiración Aumento de la capacidad Valoración de la práctica 1.3 Realiza la inspiración
diafragmática al hablar. de aire ingresado con disciplinada para el utilizando el diafragma y sin
la ayuda del diafragma aumento de su capacidad producir tensiones corporales
cuidando de no levantar de respiración y emisión innecesarias.
hombros, contraer del sonido.
músculos o producir
sonido con la nariz.
Expresión de sonidos y 1.4 Se expresa oralmente sin
frases largas de manera interrupciones continuas
continua y natural. para tomar aire valorando
la inspiración adecuada al
hablar.

Estructura del compás de Escritura de figuras Seguridad al escribir 1.5 Escribe con seguridad
3/4 en el vals. rítmicas con valores figuras rítmicas. figuras rítmicas con valores
correspondientes al correspondientes al compás 3/4.
compás 3/4.
Audición comprensiva de Concentración en la 1.6 Escucha y reconoce con
valses de Johan Strauss y audición comprensiva atención y acierto la aplicación
de autores salvadoreños para reconocer la del compás de 3/4 en valses
para reconocer la aplicación del compás de Johan Strauss y autores
aplicación del compás 3/4 3/4 y representarlo en un salvadoreños representándolo
y representación en un musicograma. en un musicograma.
musicograma.
Ejecución de Diligencia en el 1.7 Ejecuta con exactitud el
acompañamiento con acompañamiento de acompañamiento con acento en
banda rítmica de música música clásica y popular el primer tiempo del compás 3/4
clásica y popular escrita en con la banda rítmica. con la banda rítmica.
compás 3/4 marcando el
primer tiempo.

189
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Sonidos y ritmos creados Creación colectiva Cooperación en la 1.8 Crea de manera colectiva
con el cuerpo y con la voz. de sonidos y ritmos al integración de los ritmos y variedad de ritmos por medio
experimentar formas de sonidos producidos por de la exploración con su
disponer el cuerpo y los miembros del grupo. cuerpo y voz, integrándose
la voz. adecuadamente al equipo.

Elementos visuales de una Observación y comentario Iniciativa al comentar lo 1.9 Comenta con iniciativa lo que le
pintura o dibujo. de cuadros que expresen que le sugieren las obras. sugieren los diferentes cuadros
diferentes temas a observados a partir del análisis
partir del análisis de los de los elementos visuales y su
elementos visuales y su dinámica en la obra.
dinámica en la obra.
Realización de una pintura Creatividad al pintar un 1.10 Expresa con creatividad
inspirada en el texto cuadro inspirado en el sus ideas, fantasías o
descriptivo. texto descriptivo sobre su experiencias por medio de un
fantasía, sentimiento o dibujo o pintura y comenta
experiencia. el significado de lo que
comunica visualmente.

Figura compuesta por Escritura de figura Esmero en la escritura 1.11 Escribe con esmero y limpieza
corchea y semicorcheas. rítmica compuesta por musical de figura la figura compuesta por una
una corchea y dos compuesta por corchea y dos semicorcheas en
semicorcheas en sus dos una corchea y dos sus dos variantes.
variantes, con la corchea semicorcheas en sus dos
al inicio y al final. variantes.
Ejecución de las figuras Aplicación en la ejecución 1.12 Se expresa ejecutando con
en secuencias con el de las figuras rítmicas exactitud figuras compuestas
cuerpo y con percusiones. con el cuerpo y con de 1 corchea y 2 semicorcheas
percusiones. con el cuerpo y con
percusiones.

190
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ejecución de figuras Esmero en la ejecución de 1.13 Ejecuta con exactitud
compuestas de 1 corchea figuras compuestas de 1 figuras compuestas de
y 2 semicorcheas con corchea y 2 semicorcheas 1 corchea y 2 semicorcheas
banda rítmica para en el acompañamiento el acompañamiento con la
acompañar música clásica con la banda rítmica. banda rítmica.
y temas de película.

Sonidos y ritmos Clasificación de sonidos Responsabilidad en el 1.14 Clasifica con responsabilidad


producidos por aparatos de aparatos de uso ejercicio de exploración de los sonidos que producen los
de uso doméstico. doméstico de acuerdo a equipos domésticos. equipos domésticos de acuerdo
intensidad, altura, timbre y a su intensidad, altura, timbre y
duración. duración.
Escritura aproximada de Aplicación e iniciativa en 1.15 Escribe con acuciosidad los
los ritmos de los aparatos la escritura de los ritmos y ritmos de los aparatos de uso
de uso domésticos usando la aplicación de compases doméstico con las figuras y
compases y figuras y figuras conocidas. compases conocidos.
conocidas.
Realización de círculo Asertividad al opinar sobre 1.16 Opina con iniciativa sobre las
de opinión sobre las las diferencias entre los diferencias entre los ruidos de los
diferencias entre los ruidos ruidos de las máquinas y aparatos de uso doméstico y los
de las máquinas y los los ritmos musicales. ritmos musicales.
ritmos musicales.
Reproducción individual Empeño y entusiasmo en 1.17 Reproduce los sonidos con su
y colectiva de los sonidos la reproducción de los voz y con banda rítmica y hace
con la voz, con banda sonidos con su voz y con movimientos corporales con
rítmica complementados banda rítmica, así como empeño y entusiasmo.
con movimientos con los movimientos
corporales que imiten corporales que imitan
máquinas. máquinas.

191
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Circunstancias básicas Planeación y creación Promoción de una 1.18 Planifica y realiza, con
en la improvisación de situaciones interacción respetuosa iniciativa y espontaneidad,
dramática: personaje, dramáticas de dos o tres entre los miembros improvisaciones dramáticas
lugar y conflicto. personajes utilizando del grupo. determinando personaje,
las circunstancias lugar y conflicto.
básicas dadas del Quién
(personaje), el Dónde
(lugar) y el Qué (conflicto).
Seguimiento de Disposición para 1.19 Aplica propuestas de
indicaciones para realizar probar propuestas de improvisaciones dramáticas
una improvisación circunstancias dadas de otras personas con
dramática. por otros. disposición creativa y respeto
hacia los demás.

Dimensiones del color: Preparación e igualación Cuidado e interés en 1.20 Prepara cuidadosamente
tinte, saturación y valor en del tinte, saturación y igualar los colores para los colores para igualar los
la igualación de matices. valor de los colores para completar una imagen matices presentes en una
completar las figuras de impresa. imagen dada para completar
una imagen impresa.
las figuras en ella.
Denominación y registro Interés por denominar y 1.21 Denomina y registra con
escrito del tinte, saturación registrar las cualidades de interés las cualidades de los
y valor de los colores tinte, saturación y valor de colores preparados utilizando el
obtenidos y las mezclas los colores obtenidos al procedimiento para la igualación
para obtenerlos. igualarlos con los matices de colores.
presentes en una imagen
dada.

Diferencias entre intervalos Audición de un Interés en la audición y 1.22 Compara con interés los
y tríadas. instrumento armónico en la comparación de intervalos y las tríadas al
para escuchar y comparar intervalos y tríadas. escuchar un instrumento
intervalos y tríadas. armónico.
Copia dictados de Empeño en la audición 1.23 Identifica y copia con exactitud
intervalos y tríadas para e identificación de intervalos y acordes en el
identificarlos en un intervalos y acordes en un musicograma.
musicograma. musicograma.

192
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Ilustración de textos Ilustración de textos Disfrute y creatividad al 1.24 Ilustra un texto literario que
literarios. literarios escuchados o ilustrar un texto literario. escucha o lee manifestando
leídos. disfrute y creatividad.

Relación de materiales y 1.25 Explica la relación de la selección


técnicas empleadas en el de los materiales y técnicas de su
dibujo con su contenido. ilustración y con el contenido de
la ilustración.

Relaciones temáticas entre Audición comprensiva Valoración de la relación 1.26 Escucha con aplicación música
música y naturaleza. de la 4ta parte (“La con la naturaleza de la clásica relativa a la naturaleza
tormenta”) de la sinfonía obra escuchada. para su representación en un
No. 6 “Pastoral” de L. van musicograma.
Beethoven para identificar Esmero y autonomía
la imitación musical de para representar la
fenómenos naturales música escuchada en un
y representarla en un musicograma.
musicograma.
Comentario sobre los Asertividad al opinar 1.27 Opina con asertividad sobre
instrumentos musicales sobre los instrumentos los instrumentos musicales que
que imitan la naturaleza musicales que imitan la imitan la naturaleza en la
en la sinfonía de naturaleza en la sinfonía sinfonía de Beethoven y sobre
Beethoven y sobre los de Beethoven y sobre los los sonidos de aves que son
sonidos de aves que son sonidos de aves que son semejantes a la música.
semejantes a la música. semejantes a la música.

193
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La bidimensión y Observación y comentario Interés al comentar los 1.28 Identifica y describe los
tridimensión para de las características ejemplos de la artesanía aspectos bidimensionales y
expresar ideas. de las miniaturas de de la miniatura y tridimensionales en los ejemplos
Ilobasco y de un diorama el diorama. de la miniatura de Ilobasco
para identificar las apreciando el valor cultural de la
Valoración de la artesanía de la miniatura de
formas bidimensionales y artesanía de la miniatura
tridimensionales en ellos. El Salvador.
de El Salvador.
Elaboración de un Creatividad y cuidado en 1.29 Realiza un diorama para
diorama en una caja de el detalle al realizar un representar un tema libre
zapatos utilizando formas diorama con formas bi y utilizando formas bi y
bi y tridimensionales para tridimensionales.
representar un tema libre tridimensionales, incluyendo
que incluya una pequeña una pequeña escultura de sí
escultura de sí mismo. mismo.

El puntillo de negra y de Ejercicio de escritura de Diligencia en la escritura 1.30 Escribe con diligencia el puntillo
blanca. puntillo aplicado a figuras del puntillo aplicado a las aplicado a negras y blancas y lo
de negra y blanca. negras y blancas y en su ejecuta con precisión.
ejecución con percusiones.
Ejecución con percusiones
de los ejercicios en
secuencias combinadas
con figuras sin puntillo.

Formas casuales, Observación y comentario Interés en identificar 1.31 Reconoce con interés las
geométricas y descriptivas sobre obras pictóricas formas geométricas, características de las formas
en el arte popular y obras y de arte popular para casuales y descriptivas casuales, geométricas y
pictóricas. identificar formas casuales, en obras de arte popular descriptivas en pinturas de
geométricas y descriptivas. y pinturas de artistas artistas reconocidos y obras de
reconocidos. arte popular.

194
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Creación y comentario Iniciativa al comentar y 1.32 Realiza con creatividad
de formas casuales, creatividad al realizar composiciones pictóricas
geométricas y descriptivas composiciones con formas utilizando formas, casuales,
en las artes plásticas. casuales, geométricas y geométricas y descriptivas.
descriptivas.

Técnicas para crear Experimentación con las Creatividad al 1.33 Observa y comenta las
formas casuales. diferentes técnicas para experimentar con los demostraciones para crear
crear formas casuales con procedimientos para formas casuales.
materiales pictóricos. crear formas casuales con
materiales pictóricos.
1.34 Utiliza con creatividad técnicas
diversas para realizar formas
casuales.

Principio de repetición Audición comprensiva del Interés en la audición y 1.35 Identifica con empeño el
rítmica en la música. Bolero de Mauricio Ravel empeño para identificar principio de repetición en el
para reconocer el principio el principio de repetición tema y los instrumentos que
de repetición en el tema, en el tema, del ritmo e repiten las fórmulas rítmicas
del ritmo e identificar los identificar los instrumentos al escuchar música.
instrumentos musicales. musicales.
Creación de un patrón Autonomía y entusiasmo 1.36 Crea con autonomía y
rítmico de 4 figuras en para crear un patrón entusiasmo un patrón rítmico
compás 3/4 usando rítmico usando figuras en compás 3/4 usando figuras
figuras conocidas. conocidas. conocidas.

Ejecución con banda Aplicación para ejecutar 1.37 Ejecuta con exactitud los patrones
rítmica de los patrones los patrones combinados combinados en secuencias.
combinados en en secuencia.
secuencias.

195
Programa de estudio de quinto grado
Objetivos UNIDAD 2
¸ Adquirir destrezas en la ejecución de ritmos de bailes populares y danzas tradicionales,
identificando instrumentos musicales populares para valorar y preservar su difusión al
establecer su correspondencia con la identidad cultural salvadoreña.
¸ Representar personajes, situaciones y escenas de narraciones y obras de teatro por medio de
la producción y utilización creativa de títeres de varilla, máscaras, del teatro de sombras, para
comunicar valores culturales y sociales, incrementando sus habilidades para contar historias de
EL ARTE EN EL TIEMPO
forma amena y divertida.
¸ Reconocer y valorar las tradiciones pictóricas de diferentes culturas y épocas y de las artes
populares tradicionales de El Salvador, por medio de la exploración de la figura humana,
el color y la representación del espacio, para recrearlas, enriquecer su repertorio técnico y
construir las habilidades para el análisis histórico de las artes.
Tiempo probable: 42 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Propiedades de Audición y reconocimiento Interés y atención en 2.1 Reconoce el sonido de los
instrumentos antiguos de de instrumentos la audición musical de instrumentos antiguos de El
El Salvador: teponahuaste, antiguos de El Salvador: instrumentos antiguos. Salvador y los clasifica con
ayacaxtli, ocarina, palo teponahuaste, ayacaxtli, esmero, de acuerdo a sus
lluvia, pito de carrizo, ocarina, palo lluvia, pito propiedades, al escucharlos.
caramba, tamborcillo y de carrizo, caramba,
maracas. tamborcillo y maracas.

Elaboración de cuadro de Esmero en la clasificación


clasificación de acuerdo de las propiedades de
a sus propiedades: instrumentos antiguos.
producción de sonido,
morfología, característica
de timbre y material.

196
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Investigación de Valoración de 2.2 Representa un informe ilustrado
tradiciones salvadoreñas manifestaciones culturales sobre el significado de las
donde se usan salvadoreñas. tradiciones de música y danza
instrumentos tradicionales. donde se emplean instrumentos
musicales tradicionales
manifestando interés en la
cultura salvadoreña.

Representación del Observación y comentario Interés en analizar los 2.3 Analiza y comenta con interés
espacio en diferentes de ejemplos de pinturas recursos utilizados en recursos utilizados en la pintura
tradiciones pictóricas. de épocas y culturas la pintura de diferentes de diferentes culturas para
diferentes y de los recursos culturas para simular la simular la profundidad en el
utilizados para simular profundidad en el espacio espacio.
profundidad en la pintura. bidimensional.

Realización de un teatrino, Aprecia y respeta las 2.4 Utiliza ejemplos de la pintura


seleccionando y aplicando culturas de otros países. de otras épocas como material
uno de los recursos de referencia para realizar
visuales para simular un teatrino aplicando un
profundidad en la pintura recurso visual para simular
de otras épocas y culturas. profundidad, con creatividad y
Agrado y creatividad en la agrado.
realización de un teatrino
en donde aplica un
recurso visual para simular
profundidad.

197
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Figuras rítmicas Escritura de figura rítmica Esmero en la escritura de 2.5 Escribe y ejecuta con precisión
compuestas por compuesta por una figura rítmica compuesta las figuras rítmicas en sus dos
corchea con puntillo y corchea con puntillo y una por una corchea con variantes, con la corchea al
semicorchea. semicorchea en sus dos puntillo y una semicorchea inicio y al final.
variantes, con la corchea en sus dos variantes y en
al inicio y al final. su ejecución.
Ejecución con percusiones
de la figura en sus dos
variantes.
Creación de una Autonomía en la creación
secuencia rítmica usando de secuencia rítmica 2.6 Crea una secuencia rítmica
estas y otras figuras usando estas y otras con autonomía utilizando
estudiadas en un compás figuras estudiadas. figuras rítmicas compuestas por
conocido. una corchea y la ejecuta con
aplicación con la banda rítmica.
Ejecución con la banda Aplicación en la ejecución
rítmica de los ritmos con banda rítmica de los
creados. ritmos creados.

Títeres de varilla. Observación y comentario Espontaneidad 2.7 Identifica y comenta las


de ejemplos de títeres para comentar las características de los títeres de
de varilla de diferentes características de los títeres varilla de diferentes culturas y su
culturas. de varilla de diferentes funcionalidad.
culturas.
Realización de los títeres Creatividad y gozo al 2.8 Aplica creativamente las fases
de varilla y representación realizar títeres de varilla. del proceso de diseño en
de personajes. la elaboración de un títere
de varilla que utiliza para
representar personajes.

198
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Principio de variación y Audición comprensiva Interés y aplicación en la 2.9 Identifica con interés y acierto
repetición melódica en la de canciones cuyo audición e identificación los principios de variación y
música. principio de repetición del principio de variación y repetición melódica en obras
y/o variación melódica repetición melódica. musicales escuchadas.
sea evidente para su
identificación, como
“Adentro Cojutepeque”
de P. Palaviccini,
“Clocks” de Coldplay
y otras del acervo
musical salvadoreño e
internacional.
Iniciativa y responsabilidad 2.10 Opina con iniciativa y
Realización de círculo al opinar acerca de responsabilidad sobre las
de opinión sobre las particularidades en particularidades en la aplicación
particularidades en la la aplicación de estos de los principios de variación
aplicación del principio principios en obras y repetición melódica en obras
de repetición y variación escuchadas. escuchadas.
en otras artes, como la
pintura y la arquitectura.

Patrones coreográficos Seguimiento coordinado Atención y esmero para 2.11 Baila con ritmo y coordinación
en la invención de una de patrones coreográficos seguir patrones de siguiendo el orden y
coreografía simple para un tales como: formación de desplazamiento en grupo. la dirección del patrón
baile folclórico. círculos, adelante y atrás, coreográfico.
hacia los lados, abrir y Constancia, disciplina
cerrar, y otros, al compás y optimismo durante la
de canciones o melodías práctica del baile.
folclóricas.
Investigación y aprendizaje Disposición durante la 2.12 Manifiesta conocimiento de la
de diversos pasos de bailes realización de las prácticas historia del baile folclórico y el
folclóricos. para dominar los pasos porqué de los pasos incluidos.
enseñados.

199
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Cánones de la figura Comparación de la Interés por comparar las 2.13 Compara las características
humana en el arte representación de la formas de representación de los diferentes cánones de
nacional y diferentes figura humana en de la figura humana en la figura humana en la pintura
tradiciones pictóricas. diferentes tradiciones la pintura de diferentes de diferentes culturas y épocas
pictóricas incluyendo en épocas y culturas. incluyendo el arte nacional.
el arte nacional.
Realización de una pintura Cuidado e interés 2.14 Realiza una pintura o dibujo
en donde utiliza un canon por representar las seleccionando los rasgos
de la figura humana de los proporciones de la figura más característicos de la
observados. humana de acuerdo al representación de la figura
canon de la pintura de humana en la pintura de
otra época o cultura. una época ó cultura pasada
incluyendo el arte nacional.

El círculo cromático: Elaboración del círculo Exactitud e interés al 2.15 Elabora con exactitud e interés
los colores primarios, cromático con los colores elaborar el círculo el círculo cromático con los
secundarios y terciarios. primarios, secundarios y cromático. colores primarios, secundarios y
terciarios e identificación terciarios e identifica las gamas
de las gamas armónicas armónicas formadas por colores
formadas por los colores cálidos y fríos.
fríos y cálidos.
Participación en la
identificación de las gamas
armónicas en el círculo
cromático.
Identificación en diferentes Iniciativa al identificar las 2.16 Identifica las gamas de
imágenes y productos gamas de los colores fríos los colores fríos y cálidos
industriales de las gamas y cálidos en imágenes y en imágenes y productos
de los colores fríos y productos industriales. industriales.
cálidos.

200
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Estructura del compás de Escritura de figuras Esmero en la escritura 2.17 Escribe con esmero figuras
6/8. rítmicas con valores de figuras rítmicas con rítmicas con valores
correspondientes al valores correspondientes correspondientes al compás 6/8.
compás 6/8. al compás 6/8.

Ejecución de ejercicio Diligencia y exactitud 2.18 Ejecuta con exactitud


rítmico con banda rítmica en la ejecución del el ejercicio rítmico y el
acompañamiento con acento
y acompañamiento de ejercicio rítmico y en el en el primer tiempo del
música clásica y popular acompañamiento de compás 6/8 con la banda
con acento en el primer música clásica y popular rítmica.
tiempo de compás 6/8. con la banda rítmica.
Audición comprensiva Aplicación en la audición 2.19 Escucha y reconoce con acierto
de “Carnaval de San comprensiva para la aplicación del compás de 6/8
en canciones como el “Carnaval
Miguel” de F. Palaviccini reconocer la aplicación de San Miguel” y “La Suaca” de
y “La Suaca” de C. del compás 6/8 en las C. Flamenco.
Flamenco para reconocer canciones “Carnaval de
la aplicación del compás San Miguel” y “La Suaca”
6/8. de C. Flamenco.

Características generales Investigación y elaboración Acuciosidad en la 2.20 Investiga y elabora una reseña
y herencia cultural de la de reseña ilustrada investigación y la consulta ilustrada, con acuciosidad,
danza de Historiantes. sobre las danzas de bibliográfica sobre las sobre las danzas de
Historiantes en El Salvador danzas de Historiantes en Historiantes en El Salvador y
y su relación con danzas El Salvador y su relación explica su relación con danzas
similares en España. con danzas similares en similares en España.
España.
Observación en vivo o en Atención en la observación 2.21 Observa con atención una
video de una danza de de una danza de danza de Historiantes para
Historiantes de cualquier Historiantes para reconocer pasos de baile,
parte del país para reconocer pasos de baile, identificar instrumentos musicales
reconocer pasos de baile, identificar instrumentos y vestuario.
identificar instrumentos musicales y vestuario.
musicales y vestuario.
201
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Gamas cromáticas del Identificación de las gamas Valoración e interés en las 2.22 Identifica las gamas cromáticas
vestuario y máscaras de cromáticas en el vestuario danzas tradicionales y su utilizadas en las máscaras
danzas tradicionales en y máscaras utilizados en significado. y el vestuario de las danzas
El Salvador. danzas tradicionales de tradicionales de El Salvador y
El Salvador. valora su significado cultural.

Elaboración de una Gozo en la realización de 2.23 Elabora y decora, con


máscara con la técnica de una máscara inspirada en entusiasmo, una máscara en
papel maché y decoración las danzas tradicionales. papel macerado inspirándose
con gamas cromáticas. en los motivos decorativos de
las máscaras y vestuario de
danzas tradicionales.

Bailes folclóricos. Montaje y representación Constancia y disciplina 2.24 Demuestra disciplina y trabajo en
de un baile folclórico. durante la práctica del equipo durante los ensayos y la
baile. presentación del baile, siguiendo
los pasos coordinamente y con
soltura.
Agrado al participar en el
baile.

202
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Características descriptivas Audición comprensiva Asertividad al opinar sobre 2.25 Opina con asertividad y acierto
de la música. de música como “Peer los elementos de la música sobre los elementos de la música
Gynt” de Grieg, “Pedrito que caracterizan animales, que caracterizan animales,
y el Lobo” de Prokofiev personajes y situaciones. personajes y situaciones al
o el “Carnaval de los escuchar muestras musicales.
animales” de Saint-
Saens para reconocer
características musicales
con que se describen
animales, personajes o
situaciones.

La técnica del Teatro de Utilización de un lienzo Agrado y entusiasmo 2.26 Coloca correctamente los
Sombras. de tela blanca y una luz para experimentar con materiales para la proyección de
proyectada desde atrás de la técnica del Teatro la escena a través de la técnica
la tela para representar el de Sombras y para la del Teatro de Sombras.
Teatro de Sombras. representación de la
historia.
Representación de escenas Cooperación con sus 2.27 Representa escenas cortas
cortas de uno o varios compañeros para el con la técnica del Teatro
personajes, por medio manejo de los materiales y de Sombras, manifestando
de la técnica del Teatro las imágenes proyectadas. agrado, entusiasmo y
de Sombras o Sombras cooperación en el equipo.
Chinas.

Utilización de cartón 2.28 Construye y manipula los


negro y varillas para personajes que proyecta,
la construcción de los siguiendo las indicaciones sobre
personajes de la historia a
representar. los materiales y la manipulación
para la técnica del Teatro de
sombras.

203
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El bodegón en la Historia Observación de las líneas Interés en el detalle de los 2.29 Comenta con interés las líneas
del Arte. de composición en la bodegones. de composición utilizadas en la
pintura de bodegones. pintura de bodegones.

Realización de un bodegón Creatividad y esmero al 2.30 Realiza un bodegón


con los mismos elementos realizar el bodegón. cambiando las líneas de
de una obra famosa, pero composición de una pintura
cambiando las líneas de famosa con creatividad y
composición. esmero.

Creación corporal Representación de una Cooperación y valoración 2.31 Representa una idea o
colectiva y la imagen o ambiente por del trabajo de equipo. ambiente al integrarse en
representación del medio medio de la creación una composición corporal
ambiente. corporal colectiva. colectiva, manifestando
cooperación y respeto.

El gesto y el movimiento Representación de Atención a las propuestas 2.32 Realiza gestos y movimientos con
en la creación de objetos acciones cotidianas en de sus compañeros. precisión para crear los objetos y
y espacios imaginarios. espacios determinados espacios imaginarios.
con utilización de objetos
imaginarios a través del
gesto y el movimiento.
Comentarios constructivos 2.33 Mantiene el tamaño y la forma
acerca de los ejercicios original del objeto imaginado
observados. durante el ejercicio.
2.34 Se desplaza respetando la
ubicación y orientación de los
objetos imaginados.

204
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Característica de los Investigación sobre Responsabilidad en 2.35 Investiga con diligencia las
grupos musicales llamados características del la investigación sobre características del contrabajo y
“chanchona” contrabajo y del guitarrón características del del guitarrón bajo “chanchona” y
bajo (chanchona) y su contrabajo y del guitarrón su papel en los grupos llamados
papel en los grupos bajo “chanchona” y
llamados “chanchona”; su papel en los grupos “chanchona”; así como los
así como sobre los llamados “chanchona”, instrumentos que conforman un
instrumentos que así como sobre los grupo de este tipo en el ámbito
conforman un grupo de instrumentos que local.
este tipo en el ámbito conforman un grupo de
local. este tipo en el ámbito
local.

Audición de música de Valoración de la 2.36 Valora la popularidad y reconoce


grupos de “chanchona” popularidad de los grupos con empeño los instrumentos
para reconocer los de “chanchona”. que forman los grupos de
instrumentos que las “chanchona” al escuchar piezas
conforman.
musicales.

205
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La cerámica tradicional Identificación de las Interés en las 2.37 Identifica las características
de El Salvador y su características de los características de la de los diferentes tipos de
importancia turística en diferentes tipos de cerámica tradicional de cerámica tradicional de El
el país. cerámica tradicional de El El Salvador. Salvador, su origen y ubica
Salvador y su origen. los principales centros de
producción cerámica en el
mapa del país.

Ubicación en el mapa del Valoración de la cerámica 2.38 Valora y vincula la cerámica


país de los principales tradicional de El Salvador tradicional salvadoreña con el
centros de producción de como atractivo turístico. atractivo turístico del país.
cerámica tradicional.

206
Programa de estudio de quinto grado
Objetivo UNIDAD 3
¸ Reconocer los parámetros de estructuras musicales como fórmulas rítmicas, melodía,
forma ternaria, y formaciones vocales e instrumentales para lograr un acercamiento
reflexivo al lenguaje musical, a su capacidad descriptiva y a la manipulación sonora en las
producciones musicales de estudio. CULTURAS Y
¸ Desarrollar el pensamiento lateral mediante la aplicación del diseño en la creación de
objetos gráficos y objetos sencillos, el dibujo y la fotografía como registro documental
TECNOLOGÍAS EN
en contexto, al igual que la utilización de recursos artísticos contemporáneos como los
programas de dibujo digital y objetos reciclados para la comunicación gráfica, expresarse
EL ARTE
y comentar sobre temas personales y sociales.
¸ Utilizar con creatividad sus recursos expresivos para manifestar gestos y sentimientos,
contar historias sin palabras, escribir guiones y ponerlos en escena, crear una
representación bailada de una canción tradicional, por medio de la exploración de técnicas
nuevas que le permitan interpretar y comunicar su mundo interno y su entorno cultural con
alegría y satisfacción. Tiempo probable: 38 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Los colores Aplicación de colores Disposición para 3.1 Crea con entusiasmo e
complementarios. complementarios y las colaborar en las tareas interés un sistema de
fases del proceso de grupales para el diseño y señalización para el centro
diseño para crear un ubicación de las señales escolar aplicando las fases
sistema de señalización en en el centro escolar. del proceso de diseño, las
el centro escolar. herramientas de dibujo digital
y los colores complementarios.
Dibujo digital. Utilización de un Motivación para utilizar
programa de dibujo digital las herramientas de un
para diseñar un sistema de programa de dibujo digital
señalización para el centro para crear un sistema de
escolar. señalización en el centro
escolar.

207
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La comunicación sin Creación y representación Interés por la búsqueda de 3.2 Representa, con interés
palabras: la pantomima. de acciones, personajes y nuevas posibilidades para por medio de gestos y
situaciones con el lenguaje expresarse con su cuerpo, movimientos, personajes,
corporal. sin el uso del lenguaje objetos y secuencias de
verbal. acciones que cuentan una
historia o comunican
una idea.

Característica del acento Audición de canciones Interés y aplicación en la 3.3 Identifica con aplicación e
en tiempo débil en la de rocanrol para audición e identificación interés los acentos de la
fórmula del rocanrol. identificar los acentos en de acentos de la fórmula fórmula rítmica del rocanrol
segundo y cuarto tiempo rítmica del rocanrrol en en canciones escuchadas.
que caracterizan su las canciones escuchadas.
fórmula rítmica.

Escritura de fórmula Esmero e ingenio en la 3.4 Escribe y ejecuta con esmero e


rítmica del rocanrol escritura de la fórmula ingenio la fórmula rítmica del
en polirritmia con otras rítmica del rocanrol en rocanrol en polirritmia con otras
figuras conocidas y polirritmia con otras figuras conocidas.
su ejecución con figuras conocidas y su
percusiones. ejecución con percusiones.
Acompañamiento de Compromiso en el 3.5 Ejecuta con responsabilidad el
canciones de rocanrol con acompañamiento de acompañamiento de canciones
banda rítmica. canciones de rocanrol con de rocanrol con la banda rítmica.
la banda rítmica.

El sentimiento y su Realización de una Desinhibición y 3.6 Utiliza los recursos expresivos del
expresión corporal. variedad de gestos que espontaneidad al realizar cuerpo, con espontaneidad para
reflejen diferentes estados gestos y movimientos para mostrar sentimientos y estado de
de ánimo, con apoyo de expresar sentimientos. ánimo.
manos, brazos y el resto
del cuerpo.

208
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La bases del guión teatral Invención y escritura de Constancia y orden en 3.7 Elabora un esquema previo a la
para títeres o actores. guiones cortos en forma sus anotaciones hasta escritura del guión utilizando los
dramática o en forma de terminar su guión en forma elementos básicos que definen la
diálogo que contengan dramática. historia, demostrando constancia
los siguientes elementos y orden.
básicos: tema, personajes,
conflicto, lugar y un final
de la historia, para ser
representados con títeres o
actores.
Valoración de historias 3.8 Finaliza el guión en forma
que ayuden a reflexionar y de diálogo, desarrollando
fortalecer valores sociales, mensajes que fortalezcan
cívicos, éticos, culturales, valores, en el que desarrolla
espirituales y de aprecio a cada uno de los elementos
la vida. básicos.

Recursos artísticos de la Recopilación de artesanías Creatividad al presentar la 3.9 Presenta creativamente una
localidad: el dibujo y la salvadoreñas por medio recopilación de artesanías. recopilación de artesanías
fotografía como medio de de anotaciones, dibujos o salvadoreñas apoyándose en
registro en contexto. fotografías y relación con anotaciones, ilustraciones o
el contexto cultural. fotografías y las relaciona con el
contexto cultural.
Exposición sobre una Iniciativa, creatividad 3.10 Monta una exposición sobre una
artesanía tradicional e interés al realizar artesanía tradicional salvadoreña
salvadoreña y su contexto, una exposición en el manifestando valoración por el
utilizando las anotaciones, artesano y por la artesanía como
fotografías y dibujos espacio escolar sobre patrimonio cultural.
realizados. una artesanía tradicional
salvadoreña.
Valoración del trabajo del
artesano y de la artesanía
como patrimonio cultural.

209
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Componentes de la Análisis de melodías Acuciosidad en el 3.11 Observa con atención varias
melodía: motivo, frase, escritas en pentagrama análisis de melodías para melodías y reconoce el compás
ritmo y movimiento. para reconocer compás, reconocer el compás en que están escritas, la
figuras rítmicas que la en que están escritas, la uniformidad o variedad rítmica,
conforman, fluctuaciones uniformidad o variedad el movimiento o estatismo.
de movimiento ascendente rítmica, el movimiento o
y descendente o su estatismo.
estatismo.
Ejercicio creativo para Ingenio y autonomía para 3.12 Crea con ingenio y autonomía
composición de una la creación de motivos, motivos, frases y melodía
melodía en Do mayor frases y de una melodía en Do mayor de dos frases
usando compás 4/4 y en Do mayor de dos frases divididas por silencio con
figuras rítmicas conocidas divididas por silencio con movimiento ascendente la
con estructura dos frases movimiento ascendente la primera y descendente, la
divididas por silencio con primera y descendente, la segunda.
movimiento ascendente la segunda.
primera y descendente, la
segunda.

Ejecución de la melodía Esmero en la ejecución de 3.13 Ejecuta con esmero y exactitud la


en Do mayor en flauta la melodía en Do mayor melodía en Do mayor en flauta
dulce. en flauta dulce. dulce.

Elaboración de cuadro Empeño en la elaboración 3.14 Elabora cuadro comparativo


comparativo entre el de cuadro comparativo con empeño para reconocer
lenguaje hablado y el para reconocer similitudes similitudes en el lenguaje
musical a partir de los en el lenguaje hablado y hablado y el lenguaje musical a
conceptos de sonido-nota; el lenguaje musical a partir partir de conceptos como sonido-
palabra-motivo; oración- de la comparación de nota; palabra-motivo; oración-
frase para reconocer conceptos como sonido- frase.
similitudes en ambas nota; palabra-motivo;
formas de expresión oración-frase.
humana.

210
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El guiñol. Diseño, construcción y Entusiasmo y constancia 3.15 Planea con entusiasmo el
manipulación de un guiñol durante la elaboración del personaje para su guiñol y
o títere a partir de un guiñol hasta terminarlo. elabora un diseño de este al
personaje escogido, en inicio del proyecto.
el que se use tela para el
cuerpo, cartón o papel
maché para la cabeza
y las manos, que serán
independientes.
Demostración de orden 3.16 Completa creativamente su
y aseo en el lugar de guiñol de acuerdo a lo planeado
trabajo. con los recursos disponibles
y deja ordenado su lugar de
trabajo.

Estructura de forma Audición comprensiva Interés y atención en la 3.17 Escucha con atención e identifica
ternaria A B A. de marchas y de piezas audición musical para con acierto las secciones de la
populares con forma identificar las secciones de forma ABA en las marchas y
ABA para identificar sus la forma ABA. piezas musicales que escuche.
secciones.
Representación de las Acuciosidad en la 3.18 Representa con autonomía
secciones de una pieza representación de las las secciones de una pieza
con forma ternaria en un secciones de una pieza con forma ternaria en un
musicograma. con forma ternaria en un musicograma.
musicograma.

Acompañamiento de Esmero en la ejecución 3.19 Ejecuta acompañamiento con


audiciones con forma de acompañamiento esmero en la banda rítmica
ternaria con banda de banda rítmica y en diferenciando las secciones ABA
la diferenciación de con distintas percusiones.
rítmica usando distintas las secciones ABA con
percusiones para las distintas percusiones.
secciones ABA.

211
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La escultura con objetos Observación y comentario Interés en superar la 3.20 Identifica las características de
reciclados. sobre esculturas problemática de desechos. esculturas contemporáneas
contemporáneas en hechas con objetos reciclados
donde se utilicen objetos y valora su importancia para
reciclados para identificar superar la problemática de los
sus características. desechos.

Realización de una Creatividad al relacionar 3.21 Soluciona creativamente


pequeña escultura a partir objetos diferentes problemas de ensamblaje
de objetos reciclados y para crear una nueva para conformar una escultura
de lo que les sugieren los configuración. que se sostiene sola o se
diferentes objetos. cuelga y se puede apreciar
desde diferentes ángulos
utilizando objetos reciclado.

Etapas de la Organización y desarrollo Responsabilidad y esmero 3.22 Organiza y realiza colectivamente


representación del guión de las etapas básicas para en las actividades. la presentación de un guión
teatral. la representación de un teatral siguiendo con constancia
- Definición de personajes. guión teatral. y disciplina las etapas necesarias.
- Definir personalidad de los
personajes.
- Definir escenografía.
- Estudio y memorización
del parlamento (texto) Constancia, cooperación
y disciplina con el grupo
- Ensayos. durante los ensayos y la
- Presentación. presentación.

212
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Característica sonora de Audición comprensiva de Aplicación y empeño para 3.23 Diferencia en la audición la
los coros según sus voces: música diversa cantada diferenciar la sonoridad de sonoridad de los coros de
coros de voces blancas, por coros femeninos, los coros de acuerdo a sus acuerdo a sus voces.
masculinos, femeninos y masculinos, mixtos e voces.
mixtos. infantiles para diferenciar
la sonoridad de acuerdo
a sus voces.
Canto de cánones y otras Entusiasmo y esmero en el 3.24 Canta con entusiasmo y esmero
piezas con el coro del canto de cánones y otras cánones y otras piezas con el
aula. piezas con el coro del coro del aula.
aula.

213
Programa de estudio de quinto grado
GLOSARIO
Compás de 4/4: es el compás cuya unidad de tiempo es la figura
de negra (cuarto) y se completa con el valor de cuatro negras o
su equivalente en cada compás.
Compás de 6/8: es el compás cuya unidad de tiempo es la figura
de corchea (octavo) y se completa con el valor de seis corcheas
o su equivalente en cada compás. En este compás están escritas
canciones tradicionales salvadoreñas, como “San Miguel en
Banda rítmica: tipo de agrupación integrada por instrumentos Carnaval”, “Adentro Cojutepeque” y del folclore como “Torito
de percusión de diferente tipo que se implementa en el ámbito pinto”.
escolar para la práctica rítmica.
Composición: en artes visuales es la forma en que se organizan
Bidimensión (espacio bidimensional): Espacio limitado por dos los elementos visuales en una unidad orgánica (variedad dentro
dimensiones para la representación de la imagen sobre el plano de la unidad), la cual es consistente con la manera de ver el
y la ilusión de profundidad en dicha superficie. mundo de quien crea la obra. La composición en las artes visuales
Cartabón: Es un Instrumento de dibujo en forma de triángulo se sostiene y expresa de manera material, por la estructura que
escaleno, se caracteriza por tener tres ángulos diferentes: a su vez esta constituida por las relaciones entre los elementos
de 90°, 30° y 60°. El cartabón y la escuadra en dibujo lineal se visuales y conceptuales (contenido) de la obra. Componer es
pueden utilizar en conjunto para facilitar el trazo de líneas distribuir los elementos visuales para crear una forma global.
perpendiculares y paralelas. Contorno ciego: esta técnica se conoce también como la
Circunstancias dadas: información necesaria que guía al técnica de contornos puros. Consiste en dibujar los contornos
personaje o al actor antes de improvisar una escena. Estas son: de una modelo sin mirar el dibujo hasta que se termina, por lo
Quién, el personaje que participa en la historia. Dónde, el lugar tanto requiere de atenta observación, desarrolla la percepción,
en que se desarrolla la historia. Qué, lo que sucede o el problema una apreciación del espacio, de la forma, la ubicación de un
que ocurre en la historia. cuerpo en el espacio, su dirección e intención. Introducida por
el profesor Kimon Nicolaides (USA, 1892-1938) es un método de
Compás de 2/4: es el compás cuya unidad de tiempo es la figura dibujo que promueve el uso del hemisferio derecho del cerebro.
de negra (cuarto) y se completa con el valor de dos negras o su Este método lo ha retomado la Dra. Betty Edwards (USA, 1926) en
equivalente en cada compás. su libro “Aprender a dibujar: un método garantizado” El dibujo
de los contornos puros o contorno ciego forma parte de una
Compás de 3/4: es el compás cuya unidad de tiempo es la figura serie de técnicas para aprender a dibujar desde el hemisferio
de negra (cuarto) y se completa con el valor de tres negras o su derecho, para evitar los bloqueos que genera el enfoque que
equivalente en cada compás. hace del dibujo el hemisferio izquierdo del cerebro. Este método
La figura compuesta de
corchea y 2 semicorcheas es aplicado en la enseñanza de niños, jóvenes y adultos.
aparece remarcada 2 veces
en este ejemplo en el primer Coreografía: secuencia de pasos, figuras y evoluciones
y tercer tiempos del compás
(de izq. a derecha) ordenadas para expresar una danza o expresión con el cuerpo.

214
Programa de estudio de quinto grado
Do mayor: tonalidad musical que se construye sobre la escala
con base en la nota Do, la cual tiene la tercera mayor.
Estructura de la forma binaria A-B: forma musical simple que
consta de dos secciones con material musical contrastante o
diferente y cuya duración es igual o similar.
Estructura de la forma binaria A-B: forma musical simple que
consta de dos secciones con material musical diferente. Cuando
se trata de canciones con estribillo como “El Carbonero” de
Pancho Lara, tienen dos estrofas (AA) con igual música y un
estribillo (B) como se ve en el ejemplo:
A Ejemplo de musicograma con esquema que
representa la forma ternaria A-B-A de la canción
“Brilla, brilla estrellita”
Soy Carbonero que vengo
De las cumbres, sí, señor,
Con mi carboncito negro
Que vierte lumbre de amor
A
De las cumbres del Rosario
De otros pueblos y el volcán, Ejemplo de musicograma con dibujo que representa
tanto la forma ternaria A-B-A- como el contenido de la
Bajo siempre solitario canción “Brilla, brilla estrellita”

A venderles mi carbón. Fases del proceso de diseño: Hay coincidencias entre muchos
B autores contemporáneos en que el proceso de diseño en general
consiste en:
Sí mi señor, es buen carbón,
Etapa 0: Investigación preliminar: problema (Brief)
cómprelo usted de nacascol,
Etapa 1. Investigación y análisis: concepto
y de chaperno y de copinol,
Etapa 2. Generación de alternativas: ideas, bocetos,
todo señor, es buen carbón. modelos a pequeña escala
Estructura de la forma ternaria A-B-A: forma musical simple que Etapa 3. Síºntesis: prototipo: dibujo técnico, Modelo Funcional en
consta de tres secciones con material musical contrastante en la 3D
sección central. Cuando se trata de canciones, el texto central
siempre es distinto, mientras que la letra de la sección A puede Etapa 4. Realización: pruebas
repetirse o variarse.

215
Programa de estudio de quinto grado
Etapa 5. Evaluación: producción Folclore: del inglés folk=pueblo y lore=conocimiento, es la
expresión (musical, de danza, culinaria, artesanal, etc.) de un
Figura: una unidad delimitada por un contorno, es decir un pueblo que se afinca en el tiempo convirtiéndose en tradición y
espacio delimitado por líneas o planos que se percibe con patrimonio del mismo. Forma: es la configuración de un objeto
relación a un fondo. didimensional o tridimensional, la interrelación de sus parts de
Figura de corchea y dos semicorcheas: es una figura rítmica una obra. También significa el aspecto exterior de las cosas, se
compuesta que une dos figuras distintas, una corchea y dos delimita por líneas (contornos) y superficies. Las formas pueden
semicorcheas. expresar infinidad de ideas y conceptos: movimientos, grandeza,
En el ejemplo aparece remarcada la
pesadez, calma, armonía, etc.
figura compuesta de corchea con puntillo
y semicorchea. Es muy usada en los Frase musical: como el lenguaje escrito y hablado, la música
géneros musicales bailables y en la también se estructura en frases que en grupos de dos o más
música infantil por su carácter saltarín.
constituyen un tema o melodía. Por ejemplo: en el Himno
Figura reversible: un efecto de percepción visual en donde Nacional de El Salvador la primera frase musical abarca el verso
se percibe de manera ambigua la figura y el fondo en una “Saludemos, la patria orgullosos” a la que sigue una segunda:
composición bi o tridimensional. Esta ambigüedad causada “de hijos suyos podernos llamar”.
por ciertos patrones estructurales, se caracteriza. Por que las Intervalos: distancia que separa a dos sonidos, la más corta
figuras están dispuestas de tal manera con relación al fondo que de las cuales es un semitono (en algunos tipos de música se
intercambian sus atributos respectivos en la composición. consideran distancias menores). La escala de Do mayor por
ejemplo, consta de 12 semitonos.
Línea (como trazo): La línea es la representación gráfica de
Ejemplo de figura la trayectoria de un punto y por ello surge del trazo que deja
reversible en
una composición un punto en movimiento. Es uno de los elementos básicos del
bidimensional. lenguaje visual. La línea plástica es expresiva, presenta variedad
No es estable la
percepción de la de formas, colores y texturas. Las características de la línea
figura y el fondo. como trazo son intensidad, color, grosor. La línea puede trazarse
con diferentes instrumentos, puede expresar ideas emociones
y sentimientos, el trazo muestra la singularidad de quien traza,
como en la caligrafía. Los tres principales tipos de línea por su
Figuras rítmicas: blanca, negra, grupos de dos corcheas y cuatro trayectoria son: curvas, oblicuas y rectas.
semicorcheas: son las figuras mas utilizadas en la práctica rítmica
de la escuela y guardan una relación de valor de acuerdo a su Líneas de fuga: En el dibujo de perspectiva se compone de los
duración en el tiempo. Forma: es la configuración de un objeto siguientes elementos: punto de vista, línea de horizonte, punto de
bidimensional ó tridimensional, la interrelación de sus partes de fuga y líneas de fuga. Las líneas de fuga son líneas que desde el
una obra. También significa el aspecto exterior de la cosas, se punto de vista (punto del observador) se dirigen hacia el punto
delimita por líneas (contornos) y superficies. Las formas pueden de fuga generando en el dibujo la sensación de lejanía.
expresar infinidad de ideas y conceptos: movimiento, grandeza,
pesadez, calma, armonía, etc. Movimiento melódico: las melodías tienen movimiento de acuerdo
a la secuencia de notas que la componen. Ejemplo: cuando en
una melodía se repite la misma nota durante largo tiempo se
considera estática.

216
Programa de estudio de quinto grado
Música de proyección folclórica: es la música de una región que Papiroflexia: es el nombre con el que se le denominó en España
es “proyectada” en otra de distinta idiosincracia sin un proceso al arte que utilizando técnicas de plegado en papel permite
de transculturación. Por ejemplo, los grupos de música andina obtener formas y figuras decorativas. El país que más ha cultivado
que existen en El Salvador. ampliamente este arte es el Japón en donde se le denomina
Origami.
Musicograma: consiste en la representación gráfica y libre de las
partes y/o contenidos de una pieza musical. La representación Patrimonio inmaterial: es aquel tipo de patrimonio cuya naturaleza
puede ser desde un simple esquema que simboliza las partes de es intangible (sonora, de ideas, de movimientos) el cual se
una canción, hasta dibujos más elaborados de acuerdo a lo que transmite oralmente y constituye una parte valiosa de la cultura
cada persona interpreta de la música escuchada. de un pueblo, de un país o del mundo, como sucede con el sitio
arqueológico Joya de Cerén declarado como patrimonio de la
humanidad por UNESCO.
Plano: Es una configuración que se caracteriza por tener dos
dimensiones: ancho y alto.
Puntillo: el puntillo o punto se escribe a la derecha de las figuras
rítmicas para aumentar la mitad de su valor original.Voces
blancas: se dice de las voces infantiles.

Ejemplo de musicograma con dibujo que En el ejemplo aparece


representa la canción “El carbonero” de Pancho remarcada la figura de
Lara (fragmento sobre la primera estrofa y el negra con puntillo.
estribillo de la canción)

Papel picado: Es una técnica que consiste en decorar secciones


de papel (generalmente papel de china) con el calado, forma Registro: término con que
parte del patrimonio indígena de Izalco, departamento de popularmente se denomina el rango o diapasón de notas
Sonsonate. Su origen se remonta a la cultura china. Forma parte musicales que alcanza la voz de cada persona y que se define
del patrimonio cultural de El Salvador, ya que tradicionalmente se por las notas extremas graves y agudas que puede emitir.
han utilizado banderitas y gallardetes para las fiestas tradicionales
y festividades de los pueblos. Actualmente, Don Manuel Pasasin Relación figura fondo: toda superficie rodeada tiende a percibirse
es el artista más destacado en esta técnica, quien es miembro de como figura, mientras que el área que la rodea como fondo. El
la comunidad indígena de Izalco, departamento de Sonsonate. fondo da la impresión de pasar atrás de la figura, la figura tiende
Para su elaboración se utilizan tijeras para cortar figuras en a ser de menor tamaño, de color más denso y presenta mayor
el papel plegado de china, bond y crespón, de manera que al claridad y definición que el fondo.
desdoblar los pliegues los cortes generen calados que forman Respiración diafragmática: se auxilia del movimiento del músculo
figuras a lo largo del papel semejando encaje. Las secciones de del diafragma para generar una mayor capacidad de inspiración
papel caladas se pegan a secciones de cordel para hacer tiras y control de la expulsión del aire utilizando plenamente la
de gallardetes ó en palos para hacer banderitas que decoran capacidad respiratoria para el habla y para el canto.
las ofrendas para la cofradía en las fiestas patronales de las
ciudades y pueblos. Silencio de blanca y de negra: a cada figura rítmica le
corresponde un silencio con el mismo valor en el tiempo que se
escribe también sobre le pentagrama.

217
Programa de estudio de quinto grado
Textura: es la cualidad que caracteriza la superficie de los Tridimensión: espacio en donde se experimenta el volumen el
objetos, hay dos tipos de texturas: las reales y las visuales. Las cuál se percibe en tres dimensiones: grosor, ancho y alto.
texturas reales son sensibles al tacto y en las texturas visuales la
sensación táctil que caracteriza a las texturas reales nada más Tiempo musical: el tiempo en música es una abstracción que
es aparente, se trata de un efecto óptico logrado por patrones de se realiza subdividiendo el tiempo real a partir de parámetros
repetición de formas, color ó la manera en que refleja la luz la rítmicos como compás, valor de las figuras rítmicas, indicaciones
superficie del objeto. de tiempo rápido o lento y otros.
Tríada: acorde de tres sonidos que se basan en uno fundamental Volumen: Es el espacio que ocupa un cuerpo. El volumen es el
que le da su nombre. A partir del sonido fundamental se construye resultado de la configuración de un objeto en tres dimensiones:
un intervalo de tercera y uno de quinta para formar una tríada. ancho, alto y profundidad.
Ejemplo: la tríada mayor de Do esta formada por la fundamental
Do, su tercera, Mi y su quinta, Sol.

218
Programa de estudio de quinto grado
EDUCACIÓN
FÍSICA
Presentación de la asignatura persona, que se conjugan en cualquier actuación motora.
Se abordan los valores y su incidencia en las relaciones
La Educación Física brinda la oportunidad al niño y a la interpersonales y formación de la personalidad, hasta la
niña de aprender, desarrollar y potenciar su cuerpo-mente y práctica de estos de forma dirigida y regulada en la vivencia
emociones, entendiéndolos como parte de un ser integral en de la actividad física.
desarrollo, a lo largo de sus etapas evolutivas comprendidas
en los niveles de Educación Básica. Las vivencias educativas Movimiento y salud
de esta asignatura se centran en la toma de conciencia
del cuerpo, sus adaptaciones morfológicas y funcionales, Promueve el desarrollo de la orientación en el tiempo y el
los movimientos orientados, el aprendizaje de habilidades, espacio al realizar diversas actividades e interactuar en el
conductas y hábitos positivos, en ámbitos de la salud y entorno, permitiendo el aprendizaje de otras habilidades más
convivencia. Además propicia aprendizajes que inciden en complejas. Se enfatiza el desarrollo equilibrado, la atención
la calidad de la vida de las personas como hábitos de vida de la base sensorial y perceptiva, así como los hábitos que
saludables, las propiedades y cualidades físico-funcionales, promuevan la salud preventiva para la edificación de una
la construcción de una cultura de paz y de una vida con motricidad consciente en los educandos.
perspectivas, satisfacciones y responsabilidades. Aptitud física y deportiva
Enfoque de la asignatura: Matriz de Se manifiesta en el desarrollo de las propiedades y
características anatómicas y fisiológicas innatas en cada
Integración Dinámica individuo, de tal forma que se potencien para su desempeño
Este enfoque concibe el movimiento como parte de la óptimo en el contexto sociocultural. Esta competencia
experiencia vital de las personas indispensable para la requiere el respeto y la atención a la diversidad existente
salud y la interacción con el entorno. Orienta los contenidos entre los educandos. Con este planteamiento se promociona
no solo para desarrollar hábitos, destrezas y habilidades el desarrollo de habilidades y destrezas técnicas que
motoras, sino también para promover experiencias y para facilitan la práctica de algunas modalidades deportivas,
enfrentar los retos que ofrece la dinámica diaria, desarrollar grupales e individuales.
valores y normas de convivencia, generar aceptación
personal y satisfacción, promoviendo así en los educandos Bloques de contenido
su desarrollo biológico, psicológico y social.
La naturaleza de los contenidos de esta asignatura y de
Competencias a desarrollar sus procedimientos didáctico-metodológicos facilita la
interacción activa de los niños y las niñas en los diversos
Comunicación corporal entornos en los que se desenvuelven, coadyuvando así a su
desarrollo físico, psíquico, intelectual y espiritual.
Supone el conocimiento y la valoración del cuerpo y sus
funciones desde una percepción global que integra lo Los bloques de contenido que estructuran la propuesta
físico, psicológico y social de la persona. Esta competencia curricular de la Educación Física son los siguientes:
moviliza las posibilidades expresivas del cuerpo por medio 1. Habilidades perceptivo-motoras:
de los movimientos, gestos y otras posibilidades. Con ello
se supera la división tradicional entre mente, sentimientos y Comprende aspectos relativos a la percepción sensorial
cuerpo, asumiendo que son componentes indivisibles de la y motora: lateralidad, equilibrio, ritmo; y la orientación
220
Programa de estudio de quinto grado
del movimiento en el tiempo y espacio, entre otros. Este Relación entre bloques de contenido y las
bloque de contenidos es básico para el aprendizaje de unidades didácticas
otras habilidades más complejas. El desarrollo equilibrado
requiere atención de la base sensorial y perceptiva para la Los bloques de contenido se han organizado en tres unidades
edificación de una motricidad inteligente. de aprendizaje, a fin de integrarse y complementarse de
forma armónica, tal como se constituyen en las actividades
2. Conocimiento y expresión corporal: de la vida cotidiana. Sin embargo, cada unidad didáctica
Este bloque integra aspectos relacionados con el presenta como eje un bloque específico que se complementa
conocimiento del cuerpo y sus funciones, desde la percepción con los otros.
global (auto concepto y auto imagen) hasta la percepción de Los contenidos que integran los cuatro bloques se
las partes y sus funciones motoras como componentes de un plantean en tres dimensiones integradas de aprendizaje:
todo en la intervención psicomotora. Esto permite integrar conocimientos, procedimientos y actitudes, lo que facilita
componentes de valores, como el respeto y la convivencia, aún más la integralidad de los aprendizajes.
en el ámbito de la Educación Física. Este bloque también
incluye las posibilidades expresivas del cuerpo como una La organización de estos bloques en unidades didácticas
forma de desarrollar y ampliar la comunicación, partiendo obedece a criterios pedagógicos y psicológicos. Por lo tanto
se han estructurado, según su importancia, en el periodo
de los movimientos, gestos y otras acciones. evolutivo que presentan los educandos en los niveles
3. Aptitud física y habilidades deportivas: educativos. Por ejemplo, la primera unidad desarrolla con
mayor énfasis las habilidades perceptivo-motoras, a fin de
Agrupa las propiedades y características anatómicas y que los niños y las niñas fortalezcan la confianza y aceptación
fisiológicas innatas en cada individuo, de tal forma que de sí mismos, la autonomía motora, la orientación en el
se potencien para el desempeño óptimo en el contexto espacio, entre otros. Estos aprendizajes son prerrequisitos
sociocultural de las personas. Esto implica respetar y para desarrollar posteriormente habilidades más complejas
atender la diversidad existente entre los educandos. Con este y de mayor exigencia en cuanto a la funcionalidad del
planteamiento se promociona el desarrollo de habilidades organismo, las cuales pertenecen al tercer bloque y se
y destrezas técnicas que facilitan la práctica de algunas agrupan con mayor énfasis en la unidad dos.
modalidades deportivas, grupales e individuales. El bloque de movimiento y salud se integra en todas
4. Movimiento y salud: las unidades, organizando los contenidos de acuerdo
con la relación de otros bloques y la aplicabilidad en la
Este bloque comprende contenidos relacionados con clase y en la vida. Por ejemplo, el proceso de digestión
las posturas y formas adecuadas de movernos tanto en y su incompatibilidad con la actividad física vigorosa
condiciones cotidianas, en la ejercitación física y en las simultánea.
prácticas deportivas; además aborda conocimientos de El bloque Conocimiento y expresión corporal es el eje que
carácter fisiológico y hábitos higiénicos que permiten estructura la unidad 3. Sin embargo se complementa con
proteger al organismo al ejecutar actividad física. contenidos sobre salud (postura corporal) y el juego (aptitud
física y habilidades deportivas).
Aunque el programa de estudio actual presenta tres
unidades, igual que el programa anterior, los contenidos se
221
Programa de estudio de quinto grado
han reorganizado y enriquecido a partir de la integración Esta nueva presentación vuelve más sencillo y claro el
y estructuración de los cuatro bloques. Esta propuesta los desarrollo del programa para los maestros y las maestras. En
presenta de manera explícita. Al hacerlo así se previene la siguiente tabla se presenta tanto las áreas y contenidos del
que muchos sean interpretados como metodología al programa de estudio anterior, como las áreas y contenidos
ser aprendizajes básicos, como la expresión corporal, la del programa actual.
educación postural, la direccionalidad, entre otros.

Relación de los bloques de contenido y unidades didácticas del programa


anterior y el programa actual de segundo ciclo
PROGRAMA ANTERIOR PROGRAMA ACTUAL

Unidad 1: Mejoremos nuestras habilidades Unidad 1: Así sentimos,


sentimos nos
Bloques de contenido
físicas movemos y orientamos
Bailes en parejas. Ejercitación física y ajuste de la estructura e Habilidades perceptivo-motoras.
Equilibrio estático y dinámico. imagen corporal. Aptitud física y habilidades
Flexibilidad de las extremidades superiores. Otras posibilidades sensoriales. deportivas.
Rodada atrás. Posiciones extremas en las tareas de Conocimiento y expresión corporal.
flexibilidad. Movimiento y salud.
Bateo.
Fuerza de resistencia, tono y postura.
(Solidaridad y cooperación)
Amplitud y frecuencia de la zancada.
El cuerpo como expresión de identidad.
Proceso de digestión y actividad física.

Unidad 2: Reforcemos nuestras habilidades Unidad 2: Nuestras habilidades físico-


físicas motoras y deportivas
Pase, recepción y rebote en juegos pre deportivos. Puntos cardinales, referentes en los Habilidades perceptivo-motoras.
Resistencia aeróbica. desplazamientos. Aptitud física y habilidades
Fuerza corporal de las extremidades superiores. Componentes de la posición de equilibrio. deportivas.
Carreras de velocidad y saltos. Sistema cardiovascular y esfuerzo. Movimiento y salud.
(Sentimientos de cooperación y amistad) Utilización de objetos para golpear pelotas.
El crecimiento gradual del esfuerzo.
222
Programa de estudio de quinto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 3: Demostremos nuestras habilidades Unidad 3: Nos comunicamos corporalmente Bloques de contenido
U
físicas y protegemos nuestro organismo
Golpe bajo en pre-deportes. Los ejes corporales y sus movimientos. Habilidades perceptivas-
Velocidad gestual y de desplazamiento. Actividad física y funciones orgánicas. motoras.
Raqueteo. Factores del tiempo de reacción motriz. Aptitud física y habilidades
deportivas.
Expresión corporal creativa y comunicación.
Conocimiento y expresión
Medidas primarias de atención en torceduras y corporal.
otros daños leves.
Movimiento y salud.

Objetivos de quinto grado


1. Ejecutar acciones físicas con éxito y seguridad, orientadas manteniendo el tono muscular, posturas adecuadas y
a partir de la percepción actualizada de su estructura controlando el ritmo, el equilibrio y la zancada en las
e imagen en referencia a los ejes corporales y puntos acciones motoras, para integrarse eficientemente a
cardinales, para fortalecer la confianza en sí mismo al actividades deportivas y de sano esparcimiento.
interaccionar y comunicarse.
2. Dosificar el esfuerzo físico en correspondencia con Lineamientos metodológicos
la capacidad personal, aplicando conocimientos
sobre los síntomas del sobre esfuerzo, las variaciones Para el tratamiento de los diferentes tipos de contenido
fisiológicas del sistema cardiovascular en actividad deben elaborarse las previsiones necesarias (planificación),
física y los principios de incremento gradual del esfuerzo, así encontramos para el tratamiento de los contenidos
garantizando el desarrollo físico funcional sin causar actitudinales las siguientes técnicas de intervención:
conflicto socio-cognitivo, la persuasión y el modelaje.
daños o inadaptación del organismo.
El empleo de la primera técnica, se manifiesta al intervenir
3. Proteger su organismo en la ejercitación física aplicando racionalmente ante conductas inadecuadas de uno o varios
principios de la fisiología del sistema cardiovascular y del educandos, en el momento en que se presentan, deteniendo
incremento sistemático del esfuerzo en la actividad, para la actividad brevemente, realizando las reflexiones
preservar condiciones óptimas de salud y de adaptación apropiadas.
del organismo al trabajo físico.
La técnica del modelaje se concreta con la actuación del
4. Manipular y pedipular implementos con desplazamientos, docente al modelar los valores socialmente aceptados; así

223
Programa de estudio de quinto grado
se observa su respeto, su nivel de tolerancia a la igualdad en tarea determinada (estaciones). El trabajo frontal se emplea
el trato a todas y todos y otras actitudes y valores deseables en tareas estacionarias, para lo cual se prevé el espacio
de imitar por parte del estudiantado. personal de cada alumno y se realizan las tareas dadas por
el profesor; ejemplo: posiciones de equilibrio sobre un pie
La técnica de persuasión supone abordar contenidos en su lugar.
actitudinales, ofreciendo puntos de vista, información e
ideas que invitan a los estudiantes a actuar de acuerdo a Asociados a las técnicas anteriores se prevé el uso de los
normas y valores aceptados socialmente; la información estilos de enseñanza, los cuales se adecuan más o menos
que se brinda tiene entonces un poder de convencimiento. a cada una de ellas, En lo posible se recomienda aplicar
aquellos que fomentan en los educandos la autonomía,
Los contenidos conceptuales representan en gran medida ejemplo: el descubrimiento guiado, la resolución de
la posibilidad de hacer realidad la condición de integralidad problemas y la exploración libre.
en la Educación Física; por ello deberán ser bien ponderados
previendo su entrega en los momentos oportunos en que El primero comprende una serie de orientaciones a manera
explican o amplían las razones y maneras de la ejercitación de pistas que se ofrecen a los alumnos para que con esa
física saludable y adecuada, estas entregas pueden guía ejecuten de manera adecuada una destreza dada. La
apoyarse con escritos multicopiados o pegados en el resolución de problemas tan solo deja planteado el problema
periódico mural, su carácter de motivadores surgen de su de habilidad motriz que el alumno debe descubrir como
arraigo con los eventos prácticos. realizarla adecuadamente y por último la exploración libre
empleada frecuentemente en la manipulación o pedipulación
Los contenidos procedimentales cuentan con la virtud que el alumno realiza sobre un objeto o utensilio buscando
de estar conformados por actividad física en la mayoría familiarizarse con él o crear maneras de uso de este, así
de casos, los que podrán tratarse con las técnicas y como en algunos casos es imprescindible la aplicación de
procedimientos conocidos: recorrido, olas, estaciones, otros estilos de enseñanza: de mando directo, asignación de
circuito y trabajo frontal, lo cual está dado por el contenido tareas y uso del compañero, los cuales brindan una mínima
a desarrollar o por la existencia de material didáctico y posibilidad de autonomía o ausencia total.
equipo disponible.
En todo caso deberá procurarse que el estudiante se
El recorrido surte efecto cuando deban resolverse tareas mantenga activo la mayor cantidad de tiempo durante la
variadas, consecutivamente en desplazamiento. Las olas se clase, en tal sentido presentan la clase y contenidos de
utilizan cuando tenemos escasos implementos en proporción esta en correspondencia a la cantidad de materiales y al
al número de participantes, se forman varias columnas de espacio disponible.
alumnos frente a un material o equipo donde a la señal pasan
los primeros de cada columna a resolver una determinada En la conformación de grupos o equipos debe considerarse
tarea después de la cual se integran al final de su columna la ocasión en que los débiles o poco habilidosos elijan a
respectiva, pasando a trabajar los alumnos que continúan sus compañeros de equipo, a fin de proporcionarles la
en el orden y así sucesivamente. Las estaciones y circuitos oportunidad de ser los primeros a cambio de estar a la
se semejan, ya que en ellas se distribuyen diferentes tareas espera de ser elegidos hasta el final. En otras ocasiones
en el espacio de juego, teniendo cada lugar de trabajo una el profesor conformará los grupos de manera equilibrada,

224
Programa de estudio de quinto grado
igual para conseguir que aquellos que evitan trabajar juntos sean conceptuales o actitudinales y sobre todo preparan
lo hagan ocasionalmente, de la misma manera intercambiar el escenario de trabajo, limpiándolo de basuras, piedras y
participantes de un equipo a otro en un mismo periodo de otros que puedan ocasionar accidentes.
clase.
Fase de desarrollo
En el trabajo individual se respetará el descanso y ritmo de
trabajo que decide para sí cada niño, procurando cumplir En esta se realizan actividades afines a los contenidos de
los requerimientos de los indicadores de logro, después de la clase en particular y consecuentemente a la concreción
todo se busca la autonomía, además se debe aceptar el del objetivo, debiendo el maestro crear las condiciones
tomar agua en el transcurso de la clase, lo que trata de la pertinentes para el aprendizaje con autonomía, así como
conformación de la cultura de la hidratación. modelar las tareas, reforzar permitiendo respuestas diversas
en relación a la ejecución de las actividades o tareas por
La clase se organiza en tres fases como se propone en los parte de los educandos. Cuando las tareas a mostrar no
otros ciclos de la Educación Básica: fase inicial, fase de estén al alcance de la habilidad del profesor, este deberá
desarrollo y fase final. solicitar la ayuda de los niños hábiles o avanzados para
Fase inicial poder presentar el modelo deseado. El tiempo destinado
para esta fase es de 30 a 35 minutos.
Esta debe contar con un tiempo de entre 5 a 8 minutos,
en el que debe prepararse el educando para el óptimo Fase final
desempeño en la clase. Esta preparación debe referirse Las actividades que se desarrollan en esta fase persiguen
a tareas jugadas que le hagan entrar en contacto con los reducir la excitación y activación del organismo a fin de que
otros y otras. Además se realizan actividades para que los el estudiante se recupere de forma paulatina y esté apto
educandos tengan la disposición de atender indicaciones psicológica y físicamente para la hora de clase siguiente,
(prestar atención). es decir en el transcurso de ésta, se recomienda ejecutar
Todas las actividades deben tener implícita la lubricación la respiración consciente, movimientos de aflojamiento
de las principales articulaciones del cuerpo, elevando y estiramiento muscular y otras actividades propias de
la viscosidad de los líquidos sinoviales, disponiendo el la relajación; también pueden presentarse actividades de
movimiento eficiente así como el estiramiento muscular reflexión y evaluación sobre los contenidos desarrollados y
elevando la temperatura media y con ello se dispongan las su participación, para ello se destinarán entre 3 y 5 minutos.
fibras contráctiles para una mejor respuesta en la actividad Es deseable que los niños acostumbren llevar una toalla o
muscular, igual deberá realizarse tareas que impliquen la trapo limpio con el cual se retiren el sudor al finalizar la
activación del sistema cardiovascular procurando el aporte clase, así como un calzado cómodo y apropiados para las
sanguíneo adecuado a los grupos musculares implicados prácticas físicas. Cuando sea necesario el conteo de tiempo
en la activación física de la clase. o número de repeticiones se sugiere el trabajo en pareja, es
Otras actividades de esta fase son las de presentar los apropiado también para propiciar el tiempo de descanso
contenidos a tratar, enunciando los primeros de ellos, para cada uno.

225
Programa de estudio de quinto grado
Lineamientos de evaluación se le da realce a la retroalimentación con el debido
cuidado de considerar las posibilidades y características
Todo proceso formal de enseñanza-aprendizaje comprende de cada educando, así como su uso oportuno, lo cual
la evaluación como uno de sus componentes, la que presenta junto a los reconocimientos verbales y refuerzos operan
tres claros momentos, como son: inicio del proceso, durante el beneficiosamente.
proceso y final de este. Su objetivo es aportar la información
oportuna sobre el proceso de aprendizaje constituyéndose Evaluación final o sumatoria
por ello en una estrategia contra el fracaso escolar. Al término del tratamiento a cada contenido o cada unidad
La evaluación considera las diferentes manifestaciones del didáctica, se hace necesario establecer el nivel de logro del
educando en la comprensión y aplicación de la información estudiante para efectos de su respectiva promoción, este
en diversas situaciones y la práctica constante y permanente es el momento donde el producto del proceso enseñanza-
de normas, principios y habilidades sociales. aprendizaje cobra valor.
Evaluación inicial o diagnóstica Para asignar la calificación, el docente debe tener claros los
criterios con qué valorar los desempeños descritos en los
El propósito de esta parte de la evaluación es establecer el indicadores de logros y con qué actividades e instrumentos
nivel de habilidades, destrezas, conocimientos y actitudes los pondrá en evidencia. Los criterios de evaluación deben
que, en relación a los contenidos a tratar, presentan los responder al enfoque integrador de la asignatura reflejado
estudiantes en el inicio del proceso; de manera de planear en las competencias; los instrumentos susceptibles de
las adecuaciones necesarias. Para esta fase de evaluación aplicación son: los test o pruebas estandarizadas, baterías
se recomienda la utilización de algunos instrumentos como de pruebas, pruebas de ejecución, escalas de clasificación
el inventario de actitudes y conductas al interaccionar y listas de cotejo.
en clases, test o pruebas estandarizadas y pruebas de
A continuación se presentan algunos ejemplos de criterios de
ejercicio. evaluación:
Evaluación de proceso o formativa Prácticas de hábitos higiénicos.
Esta permite valorar continuamente el proceso del estudiante, Posturas adecuadas.
igual sus dificultades y deficiencias frente al aprendizaje,
con el propósito de la toma de decisiones acerca de la Prevención de accidentes y cuidados de la salud durante
conducción diaria del proceso, para encontrar los métodos la actividad física.
más eficaces, los utensilios y materiales más adecuados
y las actividades apropiadas al grupo de alumnos y Seguimiento de indicaciones.
contenido tratado.
Apropiación de valores (colaboración, respeto,
La observación es la técnica a emplear, la cual se consolida perseverancia, responsabilidad y otros).
en registros anecdóticos, lista de progreso, escalas de
tareas, lista de verificación y escalas de estimación, todas Conservación del orden en los desplazamientos durante
ellas de mucha utilidad en el caso de los diferentes tipos la clase.
de contenidos. En este tipo o momento de evaluación Aplicación de normas de convivencia.

226
Programa de estudio de quinto grado
Objetivos UNIDAD 1
¸ Aplicar habilidades senso-perceptivas en la actualización de su imagen corporal,
ejecutando responsablemente rutinas y prácticas de ejercitación física, para mejorar ASÍ SENTIMOS,
su imagen corporal en correspondencia con sus posibilidades y fortalecer su desarrollo
personal. NOS MOVEMOS Y
¸ Desarrollar la fuerza de resistencia y la técnica de la carrera, ejercitando las extremidades
y el tronco en forma estacionaria y con desplazamientos, manteniendo posturas adecuadas
ORIENTAMOS
para la ejecución de tareas físicas con eficiencia, previniendo lesiones.
Tiempo probable: 34 horas clase

CONTENIDOS INDICADORES DE LOGRO


CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
El proceso de digestión y Explicación sobre el aporte Responsabilidad en 1.1 Establece y respeta los períodos
su incompatibilidad con la sanguíneo en la digestión la protección de su de reposo para la digestión,
actividad física simultánea. y las consecuencias de organismo durante el antes de realizar actividades
realizar simultáneamente proceso digestivo. físicas intensas, explicando con
Mecanismo de aporte
actividades físicas interés el mecanismo de aporte
sanguíneo a sistemas y
vigorosas. de la sangre en la actividad del
procesos que generan
organismo.
mayor demanda.

Efectos de la ejercitación Explicación de los Aceptación de la 1.2 Adopta habitual y


física en el ajuste y efectos de la ejercitación ejercitación física sobre autónomamente rutinas de
actualización de la física sistemática en el otras opciones, para ejercitación física y deportiva,
estructura e imagen organismo e incidencia en actualizar la estructura argumentando su importancia en
corporal. los resultados de las tareas anatómica y fisiológica del el mantenimiento y actualización
Físicos (anatómicos). físicas cotidianas. cuerpo. de la imagen corporal.
Fisiológicos
(funcionalidad).
Psicológicos (seguridad).

227
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Papel de la senso- Manipulación de Prevención de daños 1.3 Controla y ajusta sus
percepción en el implementos y control de corporales al manipular movimientos a las
aprendizaje de habilidades acciones físicas diversas, objetos con diversa forma, características de los
manipulativas y control aplicando la experiencia textura y consistencia. objetos cumpliendo con
de acciones con diversos en la forma, textura y requerimientos específicos
implementos. consistencia: para cada acción, previniendo
daños corporales.
Rebote de pelotas y
balones.
Lanzamiento-recepción de
balones y pelotas.
Empuje de objetos y de
un implemento con otro.
Tracción de otra persona
u objetos.
Diversas empuñaduras
con implementos variados
para golpear otros objetos.

Beneficios de adoptar Descripción y ejecución de Responsabilidad de 1.4 Demuestra la postura correcta


posturas correctas en el posturas correctas en la adoptar las posturas al inicio y en la ejercitación de
trabajo de flexibilidad ejercitación de flexibilidad correctas en la ejercitación flexibilidad en extremidades,
corporal. en las extremidades, de flexibilidad corporal. cuello, hombros, espalda y
cuello, hombros, espalda y cadera.
cadera.

228
Programa de estudio de quinto grado
CONTENIDOS INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
La fuerza de resistencia Desarrollo de la fuerza Constancia en el 1.5 Manifiesta capacidad y
y sus efectos en el resistente en brazos, cumplimiento de las tareas constancia de ejecución de la
tono muscular y el piernas, abdomen y de ejercitación física. fuerza en períodos entre 1 a 3
mantenimiento de diversas espalda. minutos, con los músculos del
posturas. abdomen, espalda, brazos y
piernas.

Aspectos que influyen en Análisis comparativo de Valoración objetiva de 1.6 Establece la amplitud y frecuencia
la eficiencia de la carrera resultados en rendimiento su capacidad respecto a acorde a su capacidad y la
(amplitud y frecuencia de físico y fatiga en la carrera, las tareas físicas que se distancia a recorrer para obtener
la zancada) y sus efectos después de aplicar propone a realizar. resultados satisfactorios en la
en la fatiga. amplitud corta y larga; así carrera.
como frecuencia rápida y
lenta de la zancada.
Interés por mejorar la 1.7 Explica la incidencia de utilizar la
eficiencia en la carrera en amplitud corta y larga, así como
correspondencia con su la frecuencia rápida o lenta de
capacidad. la zancada para el rendimiento y
fatiga en la carrera.

El cuerpo como expresión Comunicación con Aceptación de su forma 1.8 Se expresa corporalmente
de identidad. los demás utilizando natural y particular de utilizando gestos y
conscientemente gestos, expresare corporalmente. movimientos, manifestando
movimientos y posturas aceptación por su manera
particulares de cada uno. particular de hacerlo.

229
Programa de estudio de quinto grado
Objetivos UNIDAD 2
¸ Fortalecer la condición física desde su nivel personal, aplicando conocimientos
relacionados con la adaptación fisiológica del organismo, elevando su capacidad de NUESTRAS HABILIDADES
respuesta ante la demanda física diaria.
¸ Desarrollar habilidades y