Академический Документы
Профессиональный Документы
Культура Документы
O L L E W I T T- a retrospectwe
W”
mm
.f4.wiLné;;§ mimvf-Q51
!Em»i@i§\ Mjilinuvimm
Hamm: *Mama
I» imlixm if ahfermj
in Wmmawys
.A
w. , M Wu: émailes ;m;»z<e'mg mer-.-m,i\¥¢ dm# ngqiaaws wig ;§~mm mam r' * 4» rw r mm
mn W: :¢;;<q=»3Mmvxji» ,\;w/me fe-rwa,»&c»fms¢¢ mem Mirza.; mm mi M f ¢.,»\~ M M1 M f
.\¢,.\=\ \
-#L-¢ -' 1` mu
_»..Ji
‘. If
13.3-‘
lit.” ,
` SKK*
..-,
”"¢$
_ L?
fi;
,_» _
,f_,,..;
»: ,»». '~
,.<g_)»`
<1 45°
L. - [5
iq I
--. ,
,292
.,.'STF-,,
' ’.l,<vf'§‘r
._ ._
P- 2:x.1=..-‘ “w
9 'fr--'
*é-==“"
.,..
.~,
,..... :§A§....__' TJ .;.' '. _:_
, :§*"'_-._._...._..__.. *°“__.§T
...
._.
...A
E "1 7<i:f;;".____--“°'_ '<%?_"`..__‘°~'___.~i?;i5§A
_ ~ ` L;;._“",.:::".;..."":‘r.;i:;_‘7;, ;1:
T,
an ~' _ .
1-,, 1* fams5»z»=_ ~- ~ V
\'l1éZ/
SOL LEWITT
U1
, \\3
' " -\ '~\>_
`\
»
`\_
,\1.,‘~»f‘,§‘
K.; ,
.,.
`,\ »
"X"-H' ~N _,J' li ` `
` >, wk;
5%
\r- 1, v` `
\ S,W,` ';;3_‘x\.`.‘5¢-
, gswvl ;\ ‘=
,S “ggi _ , ,
=~»
L ;=¢in»fb
\ » ~A f
,M k 1
, ,4 j( _%:r‘;N'f~» '
` ‘c'Z§£*`;: é; ="
/
,//\ / \'
,\? /1
\ /fx ,/
f i/
_, »‘v“ ,
~ ‘ "HJ ¢
,3* g '' ‘" f~v,,___
~ V. _ L >'- _V”__fi
gf44a
_ `~- -___,___V
y,r,’.
*PH
L'4,i `
‘Q
*M
x;
r,_f‘¢\
w,
, ' `_
’ fa
‘_ _V/V /
i
wi V
I "'
»
Q.
.-\:\
¢.
_J‘|f'3
L
,_ wi _ ,. >.~7.
mp.. ~-3.
'.¢*"' `f f
)
~z_ .f»,
_ 3'
.'*£4
ES"
» §~
1/
A _,__ M
_,_
" _
.._¢< _r _
-<~ `14Y,:;¢;-,_ -3; _f 'V 34
~ ~_ i;1_;;>;~~ ~ - ~
14
" 1% ` \ ».
~§»
.ww
_ wi
U1
~;
£
'
‘~=”§.,
`?
Z ,M
f; Lf.
Tlns catalugur is published bn ine neeasinn bf the eirliibiriun
snr Lewis A Rerrnspebnys. urgnnized by sary Garrels at rlie
San Francisco Museum nflylbrlern Arr.
signineam support nsr nie iirliibirian ms been praynieil by nie Mnilern Art cbuneil,
an auxiliary bf swlomn, by nie Henry Luce Foundation, and by n gram frnm ure
Nalibnal nnrlnwinenl for nie ans. U Additional gcnerous support is provided by
Pnrrifia and William wilson III and Henry s. McNeil. Front Covev;
Co/or Hands ln Pau: nlrefziims, 1999.
Gouache on vaven Lewnt Collection
Eirnrbrfrnn srkednles
San Fmneisen Museum of Modern an Back Cover'
February in ni May yn, nnbb calar Arcs ln four Dlremons, 1999,
Gnuache on nanen Lewln Cnlledion.
Museum bi conrernpbrary Arr, clneagb
Iuly 11 w October ie, ibbb FVOMISDISCBSZ
15 D|REcToR's Eo»zEwowD
DavidA.Ross
17 Ac|<NowLEDsMENTS
Gaxy Garrels
GaryGarrels
48 coNsTnucT»oN Smms
Marlin Friedman
88 SOL LEWITT: THE IDEA, THE wALL nRAw|No, AND PUDLTC SPACE
IohnS,WebeT
109 PLATES
378 D|DL|ocwAPHv
David A. Ross Idea, method, and honesty are central to Sol LeWitt’s work. So while a Sol LeWit\
retrospective offers us a rare opportunity to see gathered together the work of an
extremely influential artist, it also provides us with several other things: a way of
understanding the complexity of contemporary art, a method of considering
contemporary art history within the history of ideas, and the way in which ideas
form the basis of the art of our time.
When not characterized as a grand parade of heroic genius, the history ot' art is
alternately portrayed as a contest for national cultural dominance, a struggle between
distinct aesthetic philosophies, or simply as a contest of competing styles. lt would
seem to be a struggle for cultural dominance, a near-Darwinian exercise in the survival
of the fittest aesthetic. Given the nature of an art history constructed in a century
that lurched from war to war, this model should not be surprising, lt seems, however,
that there may be another method of developing an understanding of our times; one
that relies neither on hagiography nor the continuation of politics by other means,
The method I suggest is one made possible by this retrospective exhibition and its
accompanying publication; an exhibition that attempts to foreground the evolution
of an artist`s working method and well-articulated intentions. The central purpose
of this retrospective, celebration aside, is to provoke a thorough understanding of Sol
LeWitt’s contribution both within and despite the constraints of contemporaneous
art historical categorization,
For example, the movement known by the evocative but relatively meaningless
term “Conceptualism" provided an epistemological exploration of art-an essentially
philosophical investigation into the mechanics of how art conveys meaning. Not
surprisingly, it emerged as an analog to the structuralist study of literature with its base
in linguistic theory, Following a period in which artists sought ways to convey aesthetic
experience in as authentic a manner as possible, Conceptual art stripped art-making as
far back as it could go, resolving its underlying structure to reveal its essential character.
The style of Conceptualism was deeply influenced by a parallel set of developments
emerging from Minimalism-the philosophically rigorous approach to the making
of art which sought in direct experience a new foundation for art’s purpose. But
Conceptual art was often discursive (and text-based), and as a result often looked
unusually dry, especially when seen in the context of the personal and informal style
that accompanied the contiguous tendency known as Post-Minimalism.
At the same time there was something extremely courageous and honest about
Conceptual art`s ambition. It seemed to resonate with a generation of artists and critics
who were fully ready to make the moral and aesthetic commitment necessary to this
enormously honest way of working. And, as important, the spirit of enquiry and the
nature of the questioning itself proved to be resonant not only within a generation
caught up in the social fervor of the late sixties, it has proven to have been quite influential
on the succeeding generations of Post-Conceptual artists as well. Mindful of the caveat
that when speaking about art one should never generalize unnecessarily, if one thing
can be said of this generation of late twentieth-century artists, it is that nearly all have
incorporated the lessons of Conceptualism into their work,
Therefore this moment early in the new century is a highly appropriate time to assess
seriously the work of Sol LeWitt-the protean artist who perhaps more than any of his
peers can be seen as an artist who was able to not only help formulate and promulgate
Conceptualism, but who most successfully embedded these ideas into a working method
that bridged all the interlocking tendencies of his era. His works based on sets of instruc
tions insist on a level of democracy in art that still seems shocking in its simplicity
l.eWitt’s wall drawings, structures, and works on paper continue to astonish with their
pared-down means and absolute intellectual clarity, resulting in works giving unabashed
aesthetic pleasure. It is nearly impossible to overstate how critically important his work
has been from its Hrst appearance in the mid-igoos to his most recent exhibitions in
1999. But perhaps most astonishing is how completely fresh his work remains without
having deviated from the intellectual clarity that distinguishes the entirety of his output.
Fortunately, in this exl1ibition, organized by Gary Garrels, Elise S. Haas chief curator and
curator of painting and sculpture, the full range of LeWitt as a sculptor, draftsman, and
theorist without equal is revealed and explored with the precision and intelligibility it
both commands and deserves. We are indeed grateful to Garrels, who worked closely with
the artist for more than four years in organizing this luminous and exquisite exl1ibition.
Together with the artist himself and Susanna Singer, the artist`s longtime close associate,
Garrels has assembled a comprehensive overview of four decades of l.eWitt`s work, and
in so doing has made it possible for all of us to understand better and finally to celebrate
the work of a great American artist. Sol LeWitt has been characteristically gracious
and generous with his time and energy. LeWitt also deserves our thanks for his direct
contribution to the catalogue's design; its precision and intelligibility bears the artist’s
signature categorically.
After the presentation at the San Francisco Museum of Modern Art, the exhibition will
be shown at the Museum of Contemporary Art, Chicago, and the Whitney Museum of
American Art, New York. We are pleased to be sharing this exhibition with these museums
and are grateful to our colleagues, Robert Fitzpatrick, director, and Elizabeth Smith, chief
curator, at the MCA; and Maxwell Anderson, director, Willard Holmes, deputy director,
and Eugenie Tsai, associate director for curatorial affairs, at the Whitney, for their support
and work on this project.
Finally, on behalf of SFMOMA and its trustees I would like to acknowledge the gener
ous gifts of Banana Republic and Charles Schwab & Co., Inc., whose support of this
exhibition is dedicated in deep appreciation to both the artist and curator. Early support
from the Henry Luce Foundation and the National Endowment for the Arts was critical.
Additional generous assistance has been provided by Patricia and William Wilson Ill;
Henry S. McNeil; The Modern Art Council, an auxiliary of SFMOMA, which selected this
exhibition for their annual significant exhibition support; and The Argent Hotel, hotel
sponsor for this project. Without these benevolent contributions this important under»
taking would not have been possible.
osvta it wars
ACKNOWLEDGMENTS
Gary Garrels Almost as soon as I arrived at the San Francisco Museum of Modern Art in the (all
of l993» I raised the idea that a full-scale retrospective ofthe work of Sol LeWitt was over
due, and Iohn R. Lane, then the director, readily supported this proposal, A sumptuous
survey ot' LeWitt's wall drawings at the Addison Gallery of American Art in Andover,
Massachusetts, that spring had galvanized our attention, convincing both of us that the
quality and reach of LeWitt`s work since the survey at The Museum of Modern Art in
New York in 1978 merited a comprehensive overview, and there was a need especially
to see the full, uninterrupted arc ot' LeWitt`s career from the 1960s through the 19905.
We also realized this would be an enormously ambitious undertaking,
When approached with the idea of such an exhibition, LeWitt was skeptical ofthe
need or purpose of such an undertaking, his attention, rightfully for an artist, being
focused on new ideas, new work, and his time in the studio, Slowly, however, over the
course of several conversations and months, stretching into years, the potential for such
an exhibition began to emerge. Sometime after the opening of SFMOMA`s new building
in 1995, we realized we had indeed embarked on organizing a retrospective,
So I must first thank Sol LeWitt, who has been a full partner in this project, who has
given unstintingly of his time and thought, who has generously answered query after
query, and has coped admirably with shifting logistics and the complexities of having a
large»scale institutional partner make seemingly unending demands, His imagination
and commitment, his quickness of response and patience, his resolve and good humor
have made this project a pleasure and privilege to have undertaken.
Susanna Singer, who has worked closely with LeWitt for more than twenty years,
and who knows and understands his work better than any other individual, has been
my alter-ego on this project. From the smallest detail to the most abstract concept, her
attention was at hand. My respect for her is unflagging, and this is a much better project
at every level because ot' her tireless involvement.
LeWitt has assembled a team over many years whose assistance has been essential.
Their loyalty and commitment speak both to the quality of LeWitt’s art and the character
of the man. Particular thanks go to Ianet Passehl. curator and registrar of the LeWitt
Collection, and Io Watanabe, who led the execution of the wall drawings along with his
expert team: Sachiko Cho, Iohn Hogan, Emily Ripley, Tomas Ramberg, Anthony Sansotta.
Mio St. Clair, and Wim Starkenburg. Kazuko Miyamoto and Yoshitsugu Nakama fabricated
many ofthe structures in the exhibition,
This book produced in conjunction with the exhibition has had a life of its own, and
we hope will live on long after the exhibition as a fundamental reference for LeWitt`s
work. Sol LeWitt has been integrally involved in its conception and design, and Susanna
Singer has functioned as editor-at»large. Graphic designer Bethany lohns has collaborated
with the artist to produce a book of finesse and clarity, reflecting both the intelligence
and the visual pleasure of the work, With a keen overview and broad perspective loseph
N. Newland has edited a large number of authors with disparate voices to form a cohesive
frame around the work and we are grateful for his forbearance of the myriad editorial
challenges of this project. Sara Eichner provided valuable production assistance and
Shariann Michael contributed her expertise as a research and editorial assistant and
we are indebted to them for their dedication and good humor, At SFMOMA, Kara Kirk,
director of publications and graphic design, and Chad Coerver, publications manager,
have brought enthusiasm and insightful judgment, patience and perseverance to
demanding and complicated requirements. They were assisted in this endeavor by
Alexandra Chappell, publications coordinator, Teresa Tauchi, expert proofreader, and
Pilar Rubin, intern.
To have such a distinguished group of authors all accept, with enthusiasm and
dedication, the invitation to write about this work again is a tribute to LeWitt, For
adding another responsibility to already demanding lives, I want to thank Martin
Friedman, Andrea Miller-Keller, Brenda Richardson, Anne Rorimer, Adam Weinberg,
and Iohn Weber, who are not only colleagues but friends. Thanks are also due to the
galleries, institutions, and private lenders (listed on page 416) who generously pro
vided photographs for use in the book’s extensive survey of LeWitt`s work,
To help support this publication, Sol LeWitt very generously agreed to produce a
new graphic work to be included with a special edition of the book. Kathan Brown
and Crown Point Press, San Francisco, longtime printers and publishers of LeWitt
graphic works, readily agreed to take on this responsibility and we are very grateful for
their contribution.
My coworkers at SFMOMA embraced this project with tireless professionalism and
boundless good spirits, keeping it on track at every turn. If there were a superbowl for
museums, this team would be a contender. Given the scale and demands of this project,
nearly every member of the museum’s staff has been involved in one way or another,
and I deeply appreciate all of their efforts, but I particularly want to extend thanks to
Susan Avila, director of development; Michelle Barger, objects conservator; Olga Charyshyn,
registrar, exhibitions; lay Finneyn director of marketing and communications; Lori Fogarty
senior deputy director; Evan Forfar, chief preparator; Adrienne Gagnon, curatorial associ
ate; Libby Garrison, public relations associate; Keiko Hayashi, graphic design manager;
Barbara Levine, former exhibitions director; Carrie Mahan, associate director of develop»
ment; Terri] Neely, senior graphic designer; Iennifer 0`Neal, administrative assistant;
Kent Roberts, exhibition design manager; Peter Samis, program manager for interactive
technologies and associate curator of education; Will Shank, former chief conservator;
Rico Solinas, preparator; Iill Sterrett, conservator; Marcelene Trujillo, assistant exhibitions
director; Stephanie Verkauf, former associate director of development, corporate partner
ships; Iohn Weber, the Leanne and George Roberts curator of education and public
programs; and Greg Wilson, framer. I especially thank David A, Ross, director, who joined
the museum when this project was well on its way and brought renewed enthusiasm and
commitment to our efforts.
'lb execute the almost fifty wall drawings for the presentation at SFMOMA, a large
group nf individuals, many of them artists from the Bay Area, was assembled: Nancy
Arms, Chris Cobb, Andy Cox, Tim Curran, Frank Davi, Patrick Dintino, Susan Dopp,
cs
Adam l)r1gg>, I§rcl\ Illtdxmck, ILx\\d [ngcmI1r\\n_ [cum f\Iu\/nc|, Isurmg ( l\'.\I\~un Ncgl,
Amy R.\\hlmnc, I.\~uu Rulxmk, Ircnv 5lc\'u|1», and I r.\|\I\1c \\'<\<vdrI|H. I 1I1.mk||u'm Im
lhur c\>|\£¢11!m\im\ .\\ul\\\gu1|1c»>1<» hulp rc.|I\/vt|11\ ux|11I>Nnn.I’<\r\\\\1I.|rIy,I ||\.u\I\
I0011|c(}u)v:|,\\'Iwm\\rd\x\.\lu\I.\>>1>l.1m~Im.\||\. In umiI|mlm|x \\ilI\ lI\ucxh|Iw1\Iun I\\
5I`M0}\l.-\, .x \\'_\I| LIm\\'|ng \\'.\» done .u I|1c§II1m»Im1I\u.'\r\~|n Sqn I'r.\m|~u»; IJ.\\'|4|
I|\gtI1\‘\>\1,I\I<1r>I1.\ I~>.\\\x\nm~,S\|\.\|1 St.\\|1c|', Inc I{<\~c\\I>II\\\, Iluvin (1-ul \\|s|m\g,.\mI
\i\Iu.\r<I¢\ I’\m:LI.|, sl M\>?\I.'\ .\\~\~I.ml nI\|un\x ui uIm.\|1\»|x .md |\cI\d<v1 )'m!||1,|IH\1l|\`
xch\>\>I, .md \c.\cI\cr pmgr.\|n~\ was |n\\rumcn1.\I lu \\~ ~\mu~~tuI u»|npI¢||\»n.
(Zum tI\uI\>ng\1n1c \p.m nu-dui Im rhcL|c\\-||>p1\m\\In lI\1~plU|L\\,I\~m.||v\ |,\I¢\~,
.md In n\yr1.\¢I_\\\¢nd.ml <I»|»\L~y~`I\\<-M\|1L»r\-Im n\u\\L»m\I\|»¢~»pl¢\\|1\»I1Im»I\>nn|I»\m-II
||\ m.\|\\' \\.\\'\, Sul [c\\'|tl. S\|x.\|m.\ Smgur, ‘md I lugullucn \m\|I<I like lu \h,u\I\, In .\ddxt|nn
lu lhmc I\~Ic\| .\l1u\u, I I\\.\|»uII\ \I\I\crn\.\|\, I |~I\ \|<I\I\mIw.1\I\ N1\I1nI.\~II.x\\I\1c`|>m|gI_\~
1a.\>m; Im lémluuux, m1...I|I~u.. |s.m.,m.», I mn |=f.\.».I\, >~p|m» <;|.~fk¢\ 1’..I||I <‘.».»p~,
l`I\/.ulmh<i\|m\|\l<,S\I~I\n1>\m|\»»..'\1\\m|\IN\II-m, \my I ~h<»<», R<\~_1 I\1\1_\1\\I{nlwu|\
\\'|\I|\\.\\1, l)&\r\>\I1L’u I1\¢I\cr, |uI|rL'} I'r.|cnI\cI, I .unc I I||\g_ NI.m.\1\ Lmud|\\.\1\, [JA (§1.mL‘|I|~
\3.1\lv.\r.\ (I|.\1|>tunc, Lli/.\|»clI\ < }<»|n|v<>\|, .f\ILIcn I}<»nIm\, /\|c\.\|u|cr \'.\u tyruuxuslcxxl,
swf” Henry, |<1\~m.\ Hu||m.\|\,L»||\l.\r.1» I(.xm».\~,|xml.;I'§.1»\.\|1,\\'¢|1\¢r k».m\.\1»I\;.
|‘I.\rIL\r.1K\.\I\\>w,l).\\'|\II.\\\\',\I|@|1cI|CI.1p||1c,(}|unl\ I.\\'cI\\1, Iuhn I I\\'u1l\1, I .\m|
.-\|\dmui\> I c\\'\I\, (jslmlc [c\\'\\\, ldap um I \rrL\ N1\Iu\|.\~ [<vg~\I.u|_ XI.|\1ruun NI.xhu|\\,
I Awrsnu: I\1<\rI<cy, <QI1.\rIym' f\IJ\\\\x, I \~~A f\If(fI\\rr, I|c|1r\ S \l¢\1c\I, Hclcn mn dm
Me1|,<}reL1 I\1eert,I_1mi<1 I\I1\ImcI,lmx1 M\|.m\,I>.\\1df\I<\n~`Hxcml.||1 \lu|\.\h\,
Swphsn N\\\vI1n,S\|>.\nna P.\\r\<k,AI.u|\v I’\s|m1|,&Q|.|m I’|.|~<mm_ I..m|c P1/§I»iII.x,
Chriatcl R.\u>>n1\1IIer,Ur>Il.u|>>|n\1|IcLI\|I1c(iJrtIcI\I Ilcuh, \mIxc\\ R\¢Iunl\_ NI.\rg.\ru|
Riclxardsuxx, PI1IIIppc,'\|\drc I{|Iu\ux,\bn\n\<.| I{nIwcr\~`( I'\|\~\I»pI\¢| R<\m_\n, I.u\\u\ K\»>>~
Slcphcn Schcrrncycr, Bernd ScI\cIIIw|'x1,I’e\er §cIm~InI.\h|, [h~»m,\~ \hu|\¢, Ik-:ur Nngcr,
lsxlcy I. Spcclor, Dura SllcicIx\mc|', (§|1ucI\ `I11\'|m` \I.u L I.\\Inr, \\\n Iumkm, \\r.\|\
\`.uulcrIip, M.1nuclI\\';\>c\>,I\nnc|n.\|\c\`crn.1,(»|.\\1||.\mu\ un n.\` luhn\\.\\¢l\cr\Il.1mc|
\'\'a111hcrg, I-\nil.\ \'\'iggIc>w\\r\I1, New \\'uIIs, \\'1IIcm \\\»I!I, \\ |I|i.\m \\<md, Urcg \\'1|||nm>,
I)m1.1IdYr>u|1g, Rohan \'<\ung\n|1\I Kats /.\mul,
I I-\\<mI nu _||»p|I-f\.\\\\»n u»1IwIc|1d¢r>,I>I»\I\
||\~||\\1lm|m~.\mIm1I|\\»Iu.1|> -\\|1<\h.\\'ulwcn
|uwg\\|/ui on |».\g¢|1\ur\¢f|\ nttI1|>p\\N|\`\\\<\|1
mlm I\.\\u Iwun c\Krcn\cI\ gr.\\1<\\1~.\mI gclmnxn m
thru ¢<mpcr.\\\n|\, .\g.\||\ .1 \u>\.1|1wn\ in the x¢~pul
.\|\\|.\(Ic¢l|m\u||u|uIIv\'S\»Il,c\\`1\\,I|1\I1|~|cg.\\\I
I .\|»n \\m||1I Ixkc nu llmnk l,ym1r.-\IILI\~m\, \I.\\\\¢|I
»\1\\Ic|'~\v|\,I{|¢|\.\nI \r|\\>\mng, Mm- .-\~.\rd,
§|I|.\|I .-\»|m\.\|\, l>\1I|g,|.\> I§.\\\ur` NI.\r\ II|nmIc.\\1,
x1I\|\.IL-Il. Iam-I\1»¢-rg. 'lmklq <‘.\pp.m»||` In-.\|m<
<1nur.\\I-|~\'l\u\IL-Id, |’.m|.\ Cuupur,<1.\\I1r1||1c [Ln \~»
l_\n llublwu,<,.uI\cr\nc lh\c\ur, \`\\'|.\n IJ<»|~c\,
\'|rgin|.\ [>\\.m, Amy Iwlum, .f\.\|'un .md l{\»>.\
I‘,>m.1n,`l`I1c If] R(1\>I|un|m|\, Kun I-c|'x\I\|\dc/, lcft
A<K~o»\Lu>@~<f~rs vf
Mr, Shigeo llanda, Mary Herbert-Busick, Lewis Herman.
Haus laxnssen, Sarah lury, Brian Kennedy, Katy Kline, Mr.
Tadashi Kobayash1,Annc‘ Kovach, Werner and Sarah#-\nn
Kran1arsky,l.aura Landau, Michael LeWrtt, Dr. I.L. Locher,
Susan Lubowskv, Fla Majchvak, Robert and Sylvia Mangold,
Lawrence Markev, Charlvue Mattox, Roger Ma/arguil,
Henry S. McNeil, MIS Collection, Paris, loseph and Elaine
Monsen, Camille Oliver-Hoft'ma1nn, Barbara G. Pine, Earl A.
Powell, III, lock Reynolds, Iames Rondeau, Shirley Ross
Sullivan, laura Satersmoen, Dr, Katharina Schmidt, Sir
Nicholas Serota. Gilbert anti l.i|a Silvernian, Peter Soriano,
Judy Sourakli, Barbi Spieler, Mr. A. Straatman, Peter Sutton.
Roselyne Chrornan Swig, Monica Tomko, Dr. Evert I, Van
Straaten, Thendnra \'ischer, Dorothy and Herbert Vogel, Ruth
and Harvey uzrgrrfr, larncs N. Wood, and several collectors who
wish to remain anonymous.
I would like to reiterate thanks to the Museum of
Conternporarv .-\rt, Chicago, and the Whitney Museum
of American Art, New York, and my colleagues at these
niuseurns for embracing this project. As noted above, we
understood from thc outset this would be an ambitious
undertaking, and my deeply felt thanks go to the funders
who shared a recognition of the importance of this project.
\’\'ithout them it would not have happened.
I-1naIlv,my most heartfelt thanks go to Richard Hoblock,
who continually and consistently meets my ictlag and obsession
with grace and Iorbearance. ancl most often with appreciation
and enthusiasm. His astute judgments and unconditional lovc
rrrracrprrr this endeavor.
I
0
°"1~'-.
»!_
' :\__,_,;
.< .,,, I.
:Q-'$ _ _.Q
.IW
'_
.V
,.»
_:Q ,»»"'
if 1
SOL LEWITTZ AN INTRODUCTION
Gary Garrels Clarity, beauty, playfulness. Simplicity, logic, openness. The words which come to mind
in beginning to describe the work of Sol LeWitt resonate with essential aesthetic and
intellectual values. His works are straightforward and legible. Yet, upon closer observation
and consideration, even those that initially appear direct and obvious reveal complex
subtlety in decision-making. Intellectual substance is paired with visual delight, both of
which seep, sometimes immediately, but often slowly, into one`s consciousness.
Across four decades and many forms and materials LeWitt’s work consistently calls
forth the same character. Fundamental beliefs and attitudes about art and life underpin
all of his work. Yet he has assiduously avoided either an ideological ur theoretical program.
One can say that in his work he champions equality, accessibility, open exchange, and
public space.‘ These are values at the heart of democracy, extending the principles at
the core ofthe American republic, inherited from classical Athens. His work has roots
also in the values of early twentieth-century European art movements-Constructivism
in Russia, the Bauhaus in Germany, and DeStijl in Holland. LeWitt builds on these
foundations of moral purpose, re-engaging both classical humanism and the romantic
utopianism of the pioneers of abstract art,
LeWitt’s fecundity is staggering. Perhaps not since Picasso has an artist worked with
such relentlessness and range. There are now more than goo wall drawings, executed
directly on the wall in pencil, crayon, ink washes, and recently acrylic paint. There are
similarly hundreds of drawings on paper, in an even wider range of media, although
primarily pencil, ink, and gouache. And though there are substantially fewer of his three
dimensional structures than two-dimensional works, there are scores of these, ranging
in size from modest maquettes and human-scale objects to room-sized installations and
monumental, outdoor public works. Graphics, photographs, books, posters, and some
number of commercial consumer objects almost indefinitely extend his production,
Moreover, LeWitt’s work has not stood still. He is one of the key Figures from the
decade of the 1960s, bridging the movements of Minimal and Conceptual art. ln the 1970s
he inventively opened up the ideas and forms grounded in those movements, The work
ot' these two decades was admirably presented and examined in a mid-career survey
organized by The Museum of Modern Art, New York, in 1978.1 However, that was the
last overview exhibition of LeWitt`s oeuvre. The early 1980s saw a marked shift involving
sensual color and surfaces, myriad geometric forms and their permutations, and a more
explicitly sensual and expressive overall character. In the last five years, the vitality and
invention in his work have been especially pronounced. Although other exhibitions have
surveyed different forms-wall drawings, structures, drawings on paper, for example ‘~
none since the IVIoIvlA exhibition has brought them together.
This exhibition and book attempt to give a larger perspective and to reveal the inner
coherence of Sol LeWitt`s art as well as clarify its development and the diversity ofhis
While LeWitt is a well-known figure to those who follow contemporary art, this
exhibition has been organized with the goal of opening an understanding of his work
to a larger, general audience, and with the hope ot' making the logic of his work legible
and the pleasures in its perception palpable. At the same time, given the length of his
career and the quantity and variety of his output, the exhibition is intended to bring a
s1111rpcr111c11s111111c w11r1< .11111.1 rc11c11‘c11.1|1|111-1111111111 111 11111111w1111111.11-111 |1111g1.1111111.11
1111111 11.
111>p.1rc11l1 were 1111111 R11>>1.111 lc11~ 111111 11.111 1‘111111Lr.111-11 111 1111' l'11111-11 >1.111‘\ .11 1111’ 1‘1111
I1v:111111111»111111111-1.11'111111‘.11.1111111c,1111111‘11111111~.11l11 Nm 11111.111111111\1~111111111\.111111,
1111111111\’\’11i11-1111-1'111111-111111111111111111.111111111.111~111111111~r111111.111111111.1r111.111u».11111c
11151 111- 1111> 111.1111-1111111he 1<111¢.111 \1'.11,111111111-111 11111 111<,.1111111111.1,111111 111 1.111.111 1111
hc worked 1111 S1'1'1'11r1'1*11 111.1g.1/inc 111 111c 1111111111 11c|1.1r1111c111, 1111111g p.1>1c-11p>, 111sch.11111.11~,
111111111-1111111111111 p1111111g1.1ph¢r 1-.111111-.1111 f11111'l11111gn. [11 1111- |.111- 1e<f11~, 11111111 111g¢ 11.111
IW had intiny talks and saw shows at MoMA as well us galleries. The discussions at
tlm! time were invnliwd with new ways nfmtrkrng nrt, trying In reinvent the process,
lu regain Imsirs. to lie os olriectrvt' as possible. The work of Stella and Iohns, who were
in ti sliuw at [t1o.’t/IA...t1lnmt then, were ofptlrtltulur rn/crest .._. My thinking was
mmlvetl with the pmlrltvn afpmnlxng at the tinie: the idea ofthe flnr suffice and the
Inleg/1/yu/ the surfirte. Hy the end ty' the Fifties nlrstrart exprcssronlsni had passed,
ir wus played out Pop an had tr completely different iden, ll was more involved with
ulneets. I wttsrft ren/ly llml interested in ulrjeels. I was interested in ideas. 'l
The icleas and work of Albers, as well as Iohns and Stella, were of particular importance:
"I decided that I would make color or form recede and proceed in a three-dimensional
way," " The work of Muybridge, which LeWitt had discovered years before, now
proved pivotal. "
mt; 5 Donato Juan unrlrrea wee Several paintings made between 1964> and |961 reveal the transition. A work from
Oll on B mixture ol lltlultel and Sand
on masamte am veuow Plexlqras 1960 remains strongly gc-stural and abstract, although small Hgures emerge from the
colreeurw ol Pnvnls warns ground (pl, 11). ln other drawings and paintings, ligures suspended ir\ motion are
dominant, whether as a single character, as in, for example, Smrrersuullrrzg Figure, rgfso
nt; 6 Jasper Jams Tarqetwrt/1 rw
fares, less rnraustlr on newspaper (pl, 24), or in groups, as in Rim (yellow), 1961 (pl, 13). The next year l_e\’t`itt made a group
ana elm over canvas surmounrea my of large, square relief paintings with series of small figures rn sequence, whether painted
mar unter: master laces rn wma rm
mm runqeu lront conecrlon Dv we onthe surface, set into the canvas, or prorecling from rt lpl. zol. language referring to
Museum ot Moaern Art New vars the physical acts of running and looking-and to the operations ofthe mind that bring
out on Mr .ana Mrs Ruben c sean
order to perception-was also incorporated. These works introduce I e\\'itt\ method
of working rn series and with permutations that he has continued to use eter since.
The process and logic of LeWitt`s thinking can he clearly seen in the development of
his work over the next few years. /\ critical step was taken with the rnaklng of llltll Strrlcrrm'
Bllw, ws; lpl. asl. where the fractured and sequential character of the earlier works is
superseded hy a resolutely abstract, iconic, purely perceptual obicct. The rnonochrorne
background and scumbled surface finds a direct parallel in a work bv Donald ludd of
that same year lhg. sl. Both seem indebted to works by lasper lohns, such as llrrgur
wzrh Four I-urns, rqss (fig. 6), llrst shown rn rqsti .rt l.eo tlastelh Gallery and exhibited in
1960 at Mr»l\/1A in Srxzmr Arwrrcaur. Over the ne\t tew months, l,e\\'ur would explore
variations of this idea, culminating in \llrIl Strut ture, |963 (pl. 37l. an ambitious and
complex sculptural relief,
This same year l.eWitt made a handful ol' tree-standing three-dimensional works, fully
leaving behind hoth the plane of traditional painting as a support and canvas as a material
(pls. 34 and 39), " These pieces explore the intersection of two rectilinear geometric forms,
one a solid volume, the other an articulated, segmented lorm. liach of these "structures"
the term l.eWitt prefers to use for his three-dimensional works rather than the more
cw some
hc had mu|N¢-L( im t\\un\\ \c.\|\, lu' \\.\\ ~uh1m\\\]mu ilu-}~}1<»L\»\\.»|l\ \1m»/m»>gm/>/1\
m_\||\~ nh;-W p|\\u.\| `|1.|ngL~~ m I n\\'\\\`~ Inu
|5cgi|u\||xgu\ |<;e<1>.\ \Ln|u\\ m gwrm-\m ~lv_1p`>~_ bm <~pu|.\\]\ me wmv, \q\\.\ru.
.mu m....g1¢, ¢.m.'g@ .M .m\.»l..»m.»A.~ \..1m\~.nm<\\.1|\m`\\\..\§\.mk1“.».|\~.»u@»`\,~~
fpl, \.;;1. I§\ \~)A;,I¢\\'mImdu.\n»r<»|n\u<1Lt\<~¢p].m.n Hg\1v<\H\n\th1uc \i1|\\u\\\m\.\]
|mn\~, .md Im lluu lim num hc \»ug.\u nv pm \\1\|u|~mn¢\m }m»;u\\|.»n '| |m \Mm» M-M
IL‘\\`|llxmzludluuw||1|\»\.\~|xu\u\\\.\]]@11.|\\mg~,\\h\»l\ \nl1.»\|n\<J.uv \1r\pmu|u\\u|
\\mmm~\\\ L\1\\|~r|1~\A,\||l} ul ~u|t.|\u ‘pl may lhwllicy \m|v\~_1m|¢_\~11\g ~p_\\mI dL~p||¢ Ami
\\»m|»|u\||y,.u\»l l\u\.|hu{<\1 ¢\\\1¢|x\u xlw wlnlc u\lh|<u~< <»| Il.|h.u\ )<c\\.\\\\.\mf vw~\n<->,
Hu- upl-\H\|l>u ~l|\1u\uu~ .\|».» 4-».»&\ Un 1|vlun~\\iuL| ¢»}~\1~.|\ p|`\\ \1\r}\u1~;s\»~ [Ivy n\<»dn\e~
|\».Hm num H.\..n»...»L1\1@.N». .H nw |.\\w1\¥,.\m1nw~»magm_.|,.»n~1»L~g.m\.»~»“.\\
guknxmx \.|| wu .1m1U\|\\pIv\|l\ \\}\|\c\\mk\\14»m lhu nrm mggwlL\\<~¢}m~~1l»|l\\\u~,
mlm |Lm.|m |u\l|.1||vu|,\\1l|1 lhu\n\\|\ \\\.»~1Mu~1<»n\m.\nl \f]g_7: In xhu \»»m»` lhu .»\m.\]|
¢.,..,\ ..\\.|.m» mf .,\.~1mL»~ up /Ag1»W\`1L»M|\`< /.;gm.\\~ “rw mn mm .Mak-‘.»»~\
.||L}\|\u\\m.»`~rL\\n»|\.\|\~||1hur.\|~~».\|\L»vr\rMuA\\uz1.\mx11v¢\\1||/.un-»n~\|»\\.;7;.|m1;f'>
Hu upun ~u|w~\1\1Lu||u~~| mu |v.|~l gh-k,\~1u.m»\<v1\\<\1|\1c~ wu|`\1m|',m'\|x.\l :hu mggk-~1
untnc .|Nu\u~\\|r.\\ ~<»|x\;~]u\u~ f\u|\\u`\|u|u|\u1u|c\111\~1\\.\H,\1u||\.\lu\\1\\I\`.|ml.\l1\v<»\|
L\ppu.\| In lw 1\1`\q\1<-||L~4»r \.|»l, \mp|\»l»_\\»1u\1»mn.u\ Um-\ wb. :M
»¢ \»»-My f.N\\~~»,rL\~@~ \
In the mid»198os the simple, drawn lines that were the origin of the wall drawings and
their dominant element through the 197os were transformed into bands-structural and
architectonic partners to the environments in which they were executed (pls. 230-32 and
226). Squares were supplanted by cubes, and triangles by pyramids, in myriad configura
tions; these quickly metamorphosed into linked chains and fragments, playing hide and
seek with their architectural hosts (pl. 170). These ideas were pushed even further in 1988
for a grand installation in the Italian pavilion at the Venice Biennale. At t.l1e center of the
room, irregular faceted forms jutted from the floor like white crystalline eruptions, what
LeWitt would call “complex formsf’ surrounded on the walls by fractured forms rendered
in bright colors (pl. 254). Later he completely dissolved the wall as a visual support, with
origami-like folded shapes extending without recognition of physical boundaries, opening
up a freer and more indefinite sense of space (pl. 247).
Also in the mid-19805, a new material was introduced for outdoor structures, concrete
blocks, which could be obtained almost anywhere in the world, were relatively inexpensive,
and like the elements of the early wall drawings could be deployed by workers with only
basic skills. The lirst such structures were variations on the cube, the essential building
block of LeWitt’s visual vocabulary (pl. 283), But he quickly developed more complicated
ideas, and just as with the wall drawings, the more sophisticated the skills of the people
executing these works, the more nuanced and subtle the results could be (pl. 294).
There was a marked increase in the number of commissions for both private and public
spaces during the eighties. The new character of the wall drawings especially enabled
LeWitt to create works that could hold their own in dramatic architectural settings. In
the nineties, large-scale commissions, both wall drawings and structures, became an ever
more important part of his work.
Without completely jettisoning earlier vocabularies, in the 1990s LeWitt moved into
even freer and more playful ways of working. Contained forms in the wall drawings have
given way increasingly to expansive, open-ended methods of composition-irregular
hands, undulating waves, swirling nets, pulsing and fractured shapes, and most recently
what I.eWitt simply has called "blobs" (pls. 313-14, 326, and 329). His use of color has
become more variegated and complex. In 1997, he began working often with acrylic paint
and the colors are now purer, sassy, and electric. A very recent proposal for new stmctures
extends some of these new ideas into three-dimensional form (pls. 333-38).
Works on paper have remained integral to the development of new directions, and in
fact have been an area of intensified interest in recent years. Gouache, an opaque cousin
of watercolor, which allows greater saturation of color, is LeWitt`s preferred and almost
exclusive medium for drawing on paper. He has made large series of works such as
One-, Two-, Three-, and Four-Par! Combinations nfl/erriral. Horizontal, and Diagonal
Left and Rxgln Brands oftfolon 1993-94, a set of sixty-four 30 x 22-inch sheets (Hg. 8). He
has also pushed the scale to equal that of extremely large paintings on canvas, using single
sheets that measure 5 x to feet, or in the case of Four-Part Brushslrakes, 1994, extending
the length to twenty feet by joining four sheets of paper end to end, each measuring
4 x 5 feet (pl. 361).
owen
4 V Y ixfx 5 \ \\ ‘»~_\
; I M \ ‘QQ ,| §|
)`~ix-1- II /I-/ Q‘ /I /|
-_ I "" '"' » I \`~
_> / 4 \ mix) W V
car, rowers
NOIES
i. See the essay by lohn Weber, “sol Lewin: 7» Andrea Miller-Keller, "Excerpts from al l9. “Sol LeWiil, "Serial Pmjecl No, I" (l96bL
The Idea. the Wall Drawing, and Public spaee;' correspondence. roar-rosa,” in Susanna singer, quored from Legg, sol Leunn, p. ryo, zevi,
in this catalogue. el al., sol Levwrr Wall Drawings .pea-iose. Sal Levmr Crmml Terrs, P. 75 (repriured in
e. Alicia Legg. el al..SaIL¢VWr1(New York: p. es. Reprinted in Zevi. SolLeWl11 crinrol rhe Appendix in rhis catalogue).
The Museum of Modern Arr, royal. Terrs, p. ns. ao. see reprints oilnnh reins in rho Appenrlur,
3, see espeeially Susanna Singsn er al.. sol s. Biographical infornianon comes frorn zl, For discussion of lhe rmpacl of I.e\A'm’s
Lewmr Wall Drawings ross-rosa (Anrsrerdann various nnuversauons wimh the arrisl Khruughuul writings, see Andrea Miller-Kcller`s essay ln This
sredelijlr Museum. mu): lererny Izwison, sol ms, and from published sourees. see espeerally catalogue. The mos! eornprehensrve anrhology
Levnrrs Peinrs me-ss (London: Tale Gallery. Adachiara Zevi, "Sul LeWm in Two and Three of l.ewin's wrinngs ra in zevi, Sol l.e\¢Grr
isasis Susanna singen et al.. sol lemme Drawings Dimensions," ln Sul Lei/WH Crlllcul Texts. cnrieal Torn. pp. ap-99. for larieieonn-nenrarres
mfs-we (The Hague; Hangs cerneenree pp. io-is; also Andrew Wilson, “sol Lewin hy Lewin. espeerally ahour individual works,
museum, 1992); David Batchelor, er al., Sv! Interviewed" nasal. reprinred in zevi, Sul see Lcg,g,SolLe\4H1l.
Levwn, Srnunms |962-|993 (Oxford: Museum Levarr (§v|r1m1Texts, pp. in-ee, ee. Lewin in Lrgg,SoVLeWl1l, p, ss.
of Modern Arr. ms); and Andrea Miller-Keller. 9. Miller-Keller, "Excerpts fronr i 15. see rhe essay by Brenda Richardson,
er al., Sal l.¢VWrr Twenry-Five Wars of Wall Correspondence." p, na, "Unexpected Directions: Sol LeWi\l`x \4L1l|
Dmwinxf. M8-1993 (Andover, Mass.: lo. Wilson,"Sol l.eW\!\ lnlervlewed," p 122, Drawings," in rhrs analogue.
Addison Gallery of American Arr, Phillips n, Unpublished lecture frorn a symposium ea hor a full overview of Lewirvs draivnigs
Aademy, \993]. al the Queens Museum u[Arl, 1999, n.p. on paper, see singer, sol Le\*hn‘ lvruwlngs,
4. Sol Lewin, “Paragraphs on Conceplual re. Wilaun,"Sul Lewin Interviewed," p. rea, 19524-|992
Arr” (1967); quored fronr Legg. sol LeWin. is. und. es. See Adam welnbergs essay, “Lewin's
p, ras; Adaehlara zevi, ed., sol Lelwn Critical ia. For an overview ofthe rnfluenee of Aurolnugraphy lnvenrury of rhe l>resen¢," ln
Texts <Roine¢ l Lihri de Amuo, lneonni Muylarrdges work on Lewin and his peers, rhis oaralogue,
lnrernaeionali d' Anr, row, p. yo (also see Monon und Dornrnenr, seqnenre and Time ep, koherr Ro§enb1um,"No\:5 un sol LeWm,"
reprinred in rhe Appendur in rhis earaioguel. eadwenrd Mnybndge and conremporary in Legg,5alLe\¢Gr1, pp, isfei; reprineed in zevr,
5. sol Leumr Pnmx: ioyo-rpg; opened ar Anrenean Phorogmphy. mndover, Mass.: sol Lelwn Crrrrral Tears, pp, sorely; quore in
The Museum of Modern Arr, New York, in Addison Gallery of Arneriean Arr, Phillips Legg, p. is; Zevi, p pole.
me and eraveled so l-lousion, cleveland, and Academy/,\991). Lewin is discussed speeineally 27. Gary carrels, ‘>\ Conversation wnh sol
nerroir. The eirhibnion was organized by in loelr Reynolds, “Framing Tirneq' pp, een Lewin," in opens The Mngoelne of rhe san
Wendy weiunan. is. For a diseussion of LeWlu's rhreee Fmnflsca Museum o]'l\/laden: Ar! l (\’Vin\:r/
rs. for discussions of Lewin in she eonzexr dimensional slruclures, see Marlin Friedmank Spring moo), P 53,
of various genernrions of contemporary anisrs, essay, “consrruerion Sights.” in rhis earalogue.
see. in uns analogue, Anne lzorirners essay, ia. sol Lewin, in Legg, sol Lemrr, p. 57.
“Approaches lo seriahrys sol Lewin and his ry. lbid., p. 59.
conrernporanesw and Andrea lvlillerel<eller’s LB. Ibid.
“Variuies of lnnuenees sol Lewin and rhe
Ans Community" which also discusses rhe
Levwn colleerion.
`
,f"~:§
é`
FV?
'\~ ,-€l‘<§,_T§;* fm. ~
\ ~.f» , ‘_ ;:'£*.
:¥
UNEXPECTED DIRECTIONSI SOL LEWITT'S WALL DRAWINGS
Brenda Richardson When asked if he accepted as accurate a published description of himself as "the originator
ofwall drawings," Sol LeWitt replied dryly, "I think the cave men came first."‘ Though
cave drawings are appreciated as art, the actual motivations of the cave dwellers in drawing
on their walls may never be known. Few would suggest, however, that the graceful drawings
discovered on prehistoric cave walls were products of self-conscious, informed, conceptual
thinking about the nature and meaning of art and the boundaries between the artwork,
the space in which it is presented, and its viewers.
LeWitt first drew an artwork on the wall in October 1968 for u group show at the
Paula Cooper Gallery in New York. The artist had been thinking about working directly
on the wall for more than a year.‘ He had come to feel that it was sensible to eliminate
the mediating "support," an approach that would reinforce the llatness he wanted in
his drawings. In the first two clauses ofa text he titled simply "Wall Drawings," published
in 1970, LeWitt wrote: "I wanted to do a work of art that was as two-dimensional as
possible .... lt seems more natural to work directly on walls than to make a construction,
to work on that, and then put the construction on the wall."‘
That hrst drawing on the wall-an untitled installation subsequently catalogued as
Wu1lDruwing #1, Series II14 (A df B), a descriptive identification that derives from a serial
system of permutations LeWitt generated in 1968-was an almost unimaginably radical
act that dramatically influenced the evolution and sequential redefinitions of art over
subsequent decades (pl. 86). The radicality of LeWitt`s wall drawing was not so much
about drawing on the wall per se, which, as the artist himself notes, had precedents
back to prehistory and, perhaps more to the point, had developed naturally within the
sensibility current among LeWitt and his contemporaries in the mid-sixties, Rather, the
revelation of this first wall drawing was in its frank temporality, its seeming obliviousness
to issues of commercial viability, and in its conceptualizer`s denial of the exclusivity of
authorial execution of a handmade artwork. These are the characteristics of LeWitt’s
wall drawings that confound most viewers.
In terms of the marketplace, LeWitt’s wall drawings, quite simply, redefined the terms
by which art could be purchased and owned. At the time of that first wall drawing, however,
the artist was not thinking explicitly of the market issues: “I didn`t think about selling
them but it wasn’t a ‘gesture` as an anti-market ploy either,I never think about selling a
work while doing it."‘ Eventually l.eWitt worked out a system that might best be described
as confirmation of custodianship, that is, a signed certificate and an accompanying drawing
with directions (the certificate is a legal document that authenticates the work in any
subsequent sale or transfer; see hgs. 45-46). Such certificates of authentication have become
common among contemporary artists (Carl Andre, Dan Flavin, Felix Gonzalez-Torres,
and Ienny Holzer, among countless others) whose works are industrially fabricated
and/or subject to unauthorized replication.
in..
»\» v r.'~»» rw www, gm »,<~.»~ m»\»\m g nl l>uJ\.||\\p`> nrmg i|\>\.\H.1tm|\, Hui l7ud\.unp`§ |n.\n\lc, uftcn mul \u h.\\'c
>:¢,~.;»~,~,\.~r\<~»~ nf w » f ~; :
,».~~L-L1 In Lupe: |\\l1\1~,bul\mgs to Sul l,c\\'in,Thcl1\1\h.\n\p-I.c\\/itlp_\ml1cl> .xrc >triking
usufw.; ~» ~ n m yr M v,
Q4 pm-\.¢.\~ d.»//11ng\n\\~|I<§\ pm m (hu wrvm ul \i>\|.1l `1rt;c\»\\<cp\\m| p|.wmI|w~> wedded m ngmf
ww ,,<:~u»\ ‘MM U J .» ~,\~.\ mul; ~m\m»l|c\| form;\\vph\~\|~.\\udc|\g.\gc|nc|u“uhl\lcr.1lurc,mn>ic,d.1x\cc,.\m‘1\]1c
,mffanwu Lf »» rw uv J.,~w» N
:ww jf- »'» ww, \|\\u|»u Lmm <11 .ul ,md mkml 1§>A|Us.QX\|L’|UUpz’l'>UlL\| nmd¢>\vLmm.\~\|\1g \\~\\h foncful
\,\ rm » ~ _nn .\. . ma >‘..~.'» K, \l.|rny uf mm m,.»n; .-\pM..»,\ in _. wut- Nw nf m¢.1i`\\ 5.-mv lnghly ¢\pmm¢m.,|=
And, ummm ¢»\»\ \<»n~, m\\\.\\mmg uumnntmcnl in .\r\ .\~ :JL-.\.
\1\|\ur`\rL|\1~ ucrcmmi|\g\ull\C\\‘.1|l.\|\ll ||\i|\kmgn\\\rc di||\ux\»i<\|\.xllv durmg thu
W mu, hm 1&vl\\L-1\\\¢1'|94<»» mm. M.\\\,>< “M .|...w..\g ~u»m¢> Jirutly .m my M11
‘md .||up|\ ing lmpur c\A|nu|\\\\\hc\\x\|l. ln \hu|`1lu |~;.|u~l.\J\»n|\Hullmk,Ax1dluy19;(>-5|
li.||m-u N¢\\m.|u, I\.\¢l ||mml»|u-A Luge mls m"¢.\>¢l" an l>\r¢\cl\¢d .md pdumed u.|nv.\5c>1
u1u\\1|1 g \v<»|k\ ui wufh ~1/c .md .mthurily \h.u lhcv wu\|n.\|1\lsd nm iu>\ w.\ll» lwul cnnrc
m<\|n~, li; \|w |n|A-~m\¢\ .\|\1~1~ d.\\n\c\| `m|1|\cc\ur.1| »¢.\lc .\\ull.\|1\la(.\pc .\s .1r¢n.\» flu
.xrmm `nn<»|1_\\'.u>lm\gu»n'><.<»m>r.\n<;.\Il¢|vm'xy: Immscli lhcl.\mh11.nk ¢xhilwiliun
\L,1[u La » ( mm'/11 m \~;<»7, tu.\t\|r||1g Rmmld lilndcn, H.\| nun Ncwm.m, .md Tony Smith
wulpu m-~\\1 »ud\ |.\rgc di|ncx\\\<»|1»\|1.\t i\\x'n\crly ihcy would l1.wcbccn Luncciwd only
Im ulll dum \h\p\.1\'_ P.\imcr\ hm \mrc.\»u¢| \he d||ncns\m\> ul' lhcxr c.1nv~\>es: by 196;
4
rig. 12. Eva Hesse, Ac:ret1on,l96B,
Finerqtass and nolvester resin.
Collection of the stroller-Muller
Museum, 0ttertu_ the Nettterlanas.
The rnostfundarnental law ofnature is that everything that exists in space also
exists in time; artists today work with that knowledge in unforeseen ways .... But
what happens to it when it is disassembled? Does it still exist? lfsa, does it exist as
rope, as potential art, ur as art? Its installation is made synonymous with its existence,
whereas a painting orfixed-form sculpture, no matter how radical its esthetic, does
not literally cease to be when it is in storage. The ontological instability ofthe Bollinger
piece introduces, on the psychological plane, an experience ofanxiety about being,
which has been the chie/"subject ofphilosophy since Descartes. Consciousness as
pro/Jfofexistence is translated in esthetic terms: conception as method ofcreation. 'S
Since that first work in 1968, LeWitt’s wall drawings as ideas have dramatically
advanced not only our definition of what an art "object" can be but also our understand»
ing of how intimately and provocatively art can penetrate our daily lives. Like LeWitt’s
books, which are (counterintuitively) so closely related to the wall drawings, these are
works that exist in a particular time and place, that is. in a unique relationship not so
much with the viewer`s eyes as with the viewer’s mind and sense of being. (The books,
it is true, like the drawings on paper that LeWitt generates so prolitically and with such
incredible energy and invention, exist as tangible things that do not go away at the end of
an exhibition or when a house is sold or redecorated.) In the course of more than three
decades, however, all of these interrelated works-drawings on paper, books, and wall
drawingsfhavc evolved markedly in terms of what they look like, They have matured
with the artist and, in aesthetic terms, they have grown bolder and more dramatic, The
earliest wall drawings were precisely that: transferences to the wall of LeWitt’s exquisite,
delicate, nearly ethereal drawings on paper. ln other words, the artist (or designated
as wiersrassn
assistants or draftspeople) more or less transcribed a preexisting work, adjusting for scale
and adapting materials to wall surfaces typically less forgiving than paper. These early
wall drawings had no inherent relationship to their location.
Andrea Miller»Keller queried LeWitt as early as 1981-83 about the apparent shift in his
wall drawings "from being chaste and reticent to being more assertive, sometimes very
colorful and occasionally even exuberant." To which LeWitt replied, "When presented
with the scale that walls have one must begin to engage their physical properties. The
theatrical and decorative are unavoidable and should be used to emphasive the work," ’“
The work makes it very clear that initially LeWitt developed his ideas by moving sequen
tially through his preferred mediafbooks, then drawings on paper, and Gnally drawings
on the wall. Later (certainly by ig8o, perhaps earlier), and specihcally in response to his
experience with wall-works, the artist seems to have reversed the conceptual sequence,
processing ideas first in wall drawings, then translating them in drawings and books.
Whatever the sequence of influence from one medium to another, the dialogue among
these works has been essential to LeWitt, The link between wall drawings and the ostensibly
very different media of books and discrete drawings on paper is about rational permuta
tions ofa given idea, about seriality and conceptual coherence, about each new installation
(or sheet of paper or page ofa book) building on the one that came before. As we turn
the pages, literally or metaphorically, we develop a context and come to see the whole as
a product of each preceding part.
LeWitt’s wall drawings were created essentially without regard for the specihcs of their
architectural settings for only about two years. A turning point for the work occurred in
the summer of 1970 with Wall Drawing #51 in Turin (pl. 97), for which LeWitt’s directions
were site-specific (‘7\ll architectural points connected by straight lines”); the drawing
was created by three draftsmen using blue chalk snap-lines to demarcate "every possible
connection between corners of light switch plates, elevators, door frames, and walls.”
In I.eWitt`s own words, “the theatrical and decorative" thereafter informed each and every
drawing idea, and the wall-works came to inhabit rather than just visit their sites. lt was
between 1973 and 1976 that the artist`s respect for the function of language was made
most explicit in the wall drawings. In some wall-works of those years, words were incor
porated bythe artist as integral visual components, sometimes nearly dominating the
abstract geometric forms to whose shapes they conformed. In certain of the memorable
“location” drawings of this period (for instance, Wull Dmwing #274, “The location of six
geometric figuresf’ 1975) the crayon shapes served as corrals for LeWitt's meticulous written
instructions-words that carry the force and rhythm of concrete poetry. In other wall
drawings (notably the extraordinarily complex 1976 installation at Spoleto’s Torre Vecchio,
Wall Dmwing #301, “The location of lines and geometric figures," pls. 13213) LeWitt’s
words cannot be corralled, and the neatly penciled, block-printed fragments of language
distinctly dominate the lines and figures. The artist's succinct but somehow always
evocative verbal directions consistently accompany the wall drawings (sometimes printed
as a formal design element in the work, sometimes in a nearby printed label), though in
recent years words have subtly assumed the role of subtext more than text,
.Nt . if
\ , _ , - -, \ _
1, _t <f_'
‘»" £_»~
rt.|v= \ '1‘,
' _,‘f.~4-
-2- `-»<=`1 an
4F-.;e~
5» "f“_§\-Av`|§‘|l\
_-; f'.;‘_
;i\'\ ‘
_g . g, E ua*
~,, |..‘
, Lt sl'
..~=2.~» i» i.
! ,g:t_;§‘?__`,
\_1_-»-|-lr`r'\¢' "
.a *
;§JM_,&,` 'T
.g
nf :mai Halma tit>v¢‘<
/,v<1w.oriaqe gamma in
na wiv none.-1 name
of worm war 1 only
.,‘ss_ ~;.i,.,_~ lr' , "
A \ .i§_`;`g `, .
““‘ tttllljllf//l Y.;
them from predators, Beginning in World War I and based
specifically on an understanding of the effectiveness of natural
camouflage, international military forces introduced camouflage
programs to protect troops, artillery, supplies, and ships.
Disruptive patterns (first used by the British and dubbed “day/le
'F'
painting") were designed especially to camouflage ships; bold
striping and geometric forms were painted on naval vessels to
disguise their shape and length and to confuse the enemy about
Y thc direction in which the ship was moving (fig. 14). Although
l.eWitt is not familiar with dazzle painting per sc, hc created a
- -r work in the early sixties that he describes as "a camouflage piece."
A three-part relief sculpture of painted wood, it is constructed of
rig. 15. son Lewin, Pmrminq Form
a horizontal beam cantilcvered off a deep-sided square panel attached to the wall (fig. 15).
rn/an ana wnrre gamma/age), ea. 1953
Pamten wana. ceitefnan ot ram and All three elements arc painted in the same hold black-on-white pattern of iagged-edged
Jane Doyle, Raxnury, cenneeticut abstract shapes. This is a classic "disruptive" camouflage pattern, a form of camouflage
made all the more effective in nature by virtue ofbeing pattern-on-pattern." Lewitt has
used patterns for wall drawings that look similar and work to much the san1e effect: the
applied design counters the viewer's intuitive understanding of known structural forms,
thus demanding a heightened perceptual and conceptual focus on the conhguration of
the architectural setting (see pl. 243).
In the 19905 LeWitt began to favor acrylic as the primary medium for his wall drawings.
lt was the first new medium to be used consistently since he introduced lndia ink in 1981
and the first medium to alter the fundamental aesthetic course ofthe wall drawings. By
adding acrylic to his regular inventory of materials, he began working on walls in what
is technically a painting medium. Pencil, crayon, chalk, and ink-the materials used by
LeWitt for his wall drawings since 1968-are traditionally identified as drawing media."
LeWitt continues to use the term "wall drawings" for this body of work, regardless of the
medium in which the work is executed, Acrylic (and, in short order, the varnish layers
sometimes added to give the acrylic works their density and high gloss) revolutionized
both the style and technique of LeWitt`s wall drawings.
If-in purposefully somewhat anthropomorphic terms-the wall drawings evolved
from reserved and evanescent (19605) to calculated and austere (197os) to colorful and
exuberant (|980s), the works of the 1990s are audacious and unyielding. In their most
neutral incarnation-as stand-alone "paintings" presented i11, say, group exhibitions and
without any inherent relationship to their settings-the more recent wall drawings are
frankly decorative. LeWitt`s superheated 19905 palette features brilliant, intense hues; the
drawings' simple geometries in arcs, waves, and rectangles, often intersecting at unexpected
conjunctions, are composed of broad bands and sometimes include "framing" bands.
Altogether, these late 199os wall drawings are appealing, complex, and theatrical at the
same time.
The most surprising element of recent wall drawings (for example, Wall Drawing
#901, 1999, pl. 326) is a fluid form described by LeWitt as "a blob," the name presumably
larn indebted to my colleagues Alicia Legg, 9. See Margit Rowell, The Planar Dlrnenslml. nt. Lewin personally called his “carnuntltige
Andrea Miller-Keller, and Susanna Singer. It is Europe, |912-|932 (New York: The Solomon plete" to my ntlenlion in a telephone conver
impossible to write credibly about Sol l.¢Witt`s lt. Guggenheim Museum, ipypi, featuring satinn of ay /\ugust199g,nf\er he had read
wall drawings without relying on their work. Rowell's important text, "The Planar the linal manuscript of this essay ln which I
For illustrations and directions on individual Dimension tate-inset From Surface to spaee," addressed the coincidental relationship between
wall drawings as well as for detailed information pp. wat, a thoughtful exploration of developr patterns tn eertntn of Lewitrs wall drawings
about materials and techniques, readers should ments in art that have particular application to andthe patterns used in military datzle
refer to two volumes edited by Susanna Singer. LeWitt`s work; see also pp. iys-57 (Perle Thypp. (camouflage) painting. l,ewitt's eaninutlape
sol Lel/Wt: wall Drawings igsotuda nasal and part Spare cnnttrucnpnl .ind pp. ntl-ad piece has never been catalogued, published, nr
sal Lettntr wall Drawings into-top; tional. ln (Lissitzky's Pnntn space). professionally photographed, The piece belongs
addition, the extraordinary publication docu tu. see Friedman, De Slnl. p. ns treproduced to sculptor Toni noyle, tu whpni Lewttt traded
ntenting the landmark typ; retrospective eithir in color). it at the time it was made in the early luéos.
bition of lJeWitt's wall drawings at the Addison tt. Such Hesse works as Right After, into lewittls sarnuurlage pieee today hangs in the
Gallery of Arnerican Art, with its informative (Milwaukee Art lyluseunil, and Untitled, tuyo Connecticut home o|"lbm and lane Doyle. l
text by Miller-Keller, is indispensable. (whitney lvluscutn of American Art, New want to express my warmest apprectutlotr lu tht
York), bear a stunning formal relationship to Doyles who, at Lewitts request, phntnpraphcd
1. Quoted from Andrea Miller- Keller, "Excerpts nuchnrnps One Mile o[S1rmginstal|atlon. the painted sculpture in situ in order to provide
from a Correspondence, rust-t9ar.“ in Susanna Responding to an inquiry from the author inc with snapshot trnages ut the work.
singer, et al.. sal b¢lMn Wall nntwings ipntetpaa (MAY 1999), Sul Lewin reported that he was tu. stnee artists ofthe twentieth century
lArnsterdarn= stedeliilt Museum, rosa). v. at. lt not fnrniltar with l)uchamp's One /vltle nfstnnp hare used a variety ot rnetha on a variety of
was curator Alicia Legg who described LeWltt Given the close relationship between LeWltl suppurtkwtthtsut regard for traditional
as “the originator of wall drzwingsf' tn her and Hesse and their constant discussions about dnttnrtians between rnatertalsaatalnguers
introduction to the important 1973 catalogue art, this ts persuasive evidence that l-letse trio are often challenged as tu how to categorise
published to accompany the retrospective was unaware ofthe Duchamp wort. warts. tor formal cataloguing purposes,
exhibition of leWitt`s work that she organized te. Sentence #14 in "Sentences on Conceptual rnost American museums identify worlts by
for The Museum of Modern Art. Art” (tony), quoted from l.egg,$ul1.clwtt. their support rather than by thctr rnedtnnt.
a. Miller-Keller, “rateerpts frotn a p. ras. Atcordingly, an acrylte-onrpaper is a drawing;
Correspondenref' p. ts. ty. LeWitt`s contribution to the exhibition an aerylresunscanyas for on hoard ur wall)
,_ First published in toyuquoted from the was Wall Drawing ms Drowrng sertos 1 t ut aa is a pa1nt\ng.S1mllarly,an inlt-onepaper is a
reprint in “Writings of sol Lewin," in Alicia B) und 111 t (A ef BJ, Although when Attitudes drawing, but an inlteuneeanvas is a painting.
Legg, et al.. Sol Le\'Wl1 lNew York: The Museum Become Form was on view at the Kunsthalle Such distinctions. based on the artworks
of Modern Art. royal, p. iso (reprinted in the Bern from as lt/larah to ay April toad. this support rather than its rnedturn, are generally
Appendix in this eataloguel, work ls documented in Singer, Sol LeWllt practical in relation to museum storage
a Millereltellen “Excerpts front a Wull Drawings was-tgsa. p. isa, as having systems and eonservanan speetalisatiuns
Gorrespondencef' p. ls. been drawn hy lvlarltus Raetz in May rosa. lart eonservaturs speetalise and are trained
5. See Millerelceller, “Excerpts front a Presumably March |969 (rather than May 1969) on the basis of support materials, op., paper,
Correspondence,” pp. te, aa. Sol Lewin articur was the date ofthe wall drawings execution. canvas, wood, metal).
lated his revised views on "copies" of his wall Of the sixty»nine artists ln the exhibition, ao. All four ofthese tens are reprinted in the
drawings in a telephone conversation with Hanne Darboven, Eva Hesse, and lo Ann Appendix in this eatalogue. l borrowed the title
the author on 9 October 1999. Kaplan were the only women included, with ofthe present tart, "Unexpected Directions,"
6. LeWitt called out the importance of the the work of both Darhoven and Hesse closely from Sentence #tt ol' LeWitr`s "Sentences on
Gray book to him and his contemporaries in linked to that of hewitt, Conceptual Art."
a telephone conversation with the author on ta. Stott Burtort,“Notes on the New." rt. Mel Bochner, quoted in Lucy Ltppard,
aa August typo. The Gray hook was published When Attitudes Become Farm: Works Evtvl Hesse (New York: New York University
in New york by Harry N. Abrams in iota. cnnreptseproecsses-strvortanselnfnrniatitni Press, tam, p. rut.
7. See Magdalena oahrnwslti, Leah lnerns Kunsthalle Bern, tyco). n.p.
Dickerlnan. and Peter Galassi, Aleksandr ts. lbid,
Rodchzrllw (New York: The Museum of Modern 16, Miller-Keller, "Excerpts from a
Art, tugs), Correspondence," p. 19.
s. Mildred Friedman, ed., De Srgl: tot;-lust, 17, Andrea Miller-Ke|ler,"Sol LeWltt;
visianr of Utupiu (Minneapolis and New tort; Twenty-Five rears of wall Drawings," tn
Walker Art Center and Abbeville Press, 1982). sol Lel/Wit: Twrntyrrlve Years of Wall Drawings,
p. aan. See also Nancy l. Troy, The De Str/I tous-tw; lAndoyer,Mass,,.1nd saattlrs Addison
Environment (Cambridge, Mass; MIT Press, Gallery nf American Art and university of
rosa), for a comprehensive overview of Washington Press, l993>, P- 41
this material.
§
.
\
mum.
CONSTRUCTION SIGHTS
Martin Friedman Imagine an artist first associated with the purist view of form generally known as
Minimalism-in fact, one of the progenitors of its uncomprornisingly anti-expressionist
theology-suddenly making enormous, softly contoured, brightly colored sculptures.
some planned to be thirty-six feet high and fifty feet long. Might the unimaginable be
happening: could Sol LeWitt be entering a heady romantic phase? So exotic are these
new entities, particularly in relation to his readily identifiable geometric structures, that
you might think they dropped in from outer space. In vivid contrast to his production
ofthe last four decades, these incipient artistic extraterrestrials are less about stasis than
movement. Some, in fact, seem to he in the process of inflating or deflating.
However improbable these multicolored, quasipneumatic forms might seem in the
LeWitt canon, they are by no means his illegitimate artistic progeny, They were planned
for a forested site in the New lersey Pine Barrens where, ideally, LeWitt says, there could
be as many as a dozen pieces in individual settings; and, for all their seemingly relaxed
presence, they derive from meticulously detailed schematic drawings that resemble a
surveyor’s land contour studies. Yoshitsugu Nakama, LeWitt's longtime model-maker,
has translated their paisleylike outlines to volumes in a group of hberglass maquettes.
(pls. 333-38). Even if their projected scale, rotundity, and glossy, intense color suggest
a radical break with his heretofore consistently geometric imagery, their immediate
ancestry is readily detectable. Their sinuous, if quirky, outlines were largely anticipated
in his drawings of the early 199os, especially those whose wide bands of loosely brushed
color coalesced into quasigeometric shapes, some looking like squeezed circles. Slightly
earlier sculptural antecedents are the stark-white, sharp-edged “complex forms" LeWitt
fabricated in wood and aluminum in the late r9Sos. But even more immediate precedents
are his wall drawings-actually paintings-of the past few years, those great oceans of
color whose soft organic contours subliminally allude to landscape contours, distant
horizons, even to human anatomy,
Although Sol LeWitt may have seemed to be pursuing different stylistic directions
in his structures and wall drawings, they have always been inextricably related: his work
in one medium has always affected that in the other. Even when their forms have varied
widely, they have shared imagery and concepts of generation. Now, as revealed by the
maquettes for the large constructions proposed for the Pine Barrens in response to a
possible commission (whether or not rhey are realized at full scalel» the artist is bringing
together two long~separated aspects of his work, the theoretical and the sensuous. Not
since the early 1960s, when he painted his first geometric constructions with vivid reds,
blues, and yellows, has he embraced color with such gusto. LeWitt`s arrival at his current
vocabulary of soft curves, weighty masses, and full»throttle primary and secondary colors
is the latest stop on a stylistic journey that began some forty years ago,
r1r
Yu), IS Paqé #mm (he D|E\Q >E\(l\Ov¥ D7
mamma ofav, me area/ Expswme/vt
Rmfan An vseafrszzwew vom
1
Haw N Abram; vaw
4, »' * ‘ \ y,» r
'ff ;;.'$
L,-' I‘_"\.,.
ȎifF
:_ ' I 'f.
`\ ~ \ \,, ,¢, \ _ _ ` ,,\/ \
:mem Arr lmuuy m urdur u> arms .n A \.\lmI.\ r.\>.\ mr their |'¢»~»1u\\m\,1ry nw ~vm.\\,
uspumlly Lxppuulud no l,¢\\'m .md wnnmwm-\| h\~ .\ml»N\»n m duwlnp hh mm nm\¢1».\I
vnc;\l1ul.\ry.
ln lhc curly1¢;mv>,1\\.\|\v_\r1i\1\who\\u|L~l<m1\||\g|nr.\ l1c\\'.\pprn\.nl1 l\>.\\»>lr.\CI
[mm sclllcd on c|cmcnt.1| gmrnulm »I\.\p¢\, _\nm\\|xmu~ ~\1r|.\\c\,.\|1d .\ q\|.\>|-iuxdlulriql
purisl .|u>||\c|i<.'Ih1~ Iumu .m\.\lg.\n\u1 \.u mi .\ppm.\\|\u~ lu clcmcn|.\| Im m \Nlvl1clI
M|nin\.\|i»|\\s|uid~|y.1\l1iu\cl| pulwlh \mlv|h\\' m thc Ic\»\~h NIu~c\||\\`» mm |cgumi.\|'y
I’rmmry _S11|mmu> ux|\i\>\n<m ni \<;f~n\ ~»rg.\m/cd lw |§\n.\>nu\ t\I~>l\|nu.` Ilxu .xdwxml ut
M|mm.\l\~m u»||\¢1d¢l| wnh mlm nt Pup .1r\, \vI1\»~¢ n-|¢wm\\ _md il1i.»~v1m.\\\~ I.\l|1
tupuuxl »u\>|cL\ m.\I\c| .mtu|m\\¢.\]|y |\\\ni\‘ 1| f\l||1||\\`\|n|\\`> .\u>l|\uu¢ .u\t|ll\u>|>, Bur |’up\
L\pp|u.\L|1, u»x\\!wiN|1g ¢iu\L||p\|<u\.\m|.\ l>\N\.\|\\p\`u\1mn\',\\.\> c1|u.\||\ .\n.\\l\cm,x ln
chu |1c\vp\||\\l\. Iu|x\I| lhcn p|1||-\»~|»t\|\.\| and >ly||~\|» .||rt¢|1~mu>, l\\»\l\ \.\mp> had _|
\u|n|n<\|1.m\1p.\||\\'u»w|\.\\they ~~»|1~|d<m1 m lw llwu\\<»»1\ccm\»\|\u\.\l|»n\ <v|`.f\l\m.\L
|ixprc~\|\\n|~|\\,c~pcL1_\||\'d\u'||1g1l» \\‘.\|m\gnL\y>,N<\,l,u\\'|tl_1mi|11>tulln\\ \cckcr> nt
L-s»u|m_\|num\\m|ldr]|\d1h<|r\»wnmy",\\\\m||§§`}u-~l\y>,d1~\\|>>||\g\|xc|rh\|`1y .\»pi\.\
\|¢m\,“m|r |dc.x\\.|~.1n ru ¢r¢.\\u .u-1, m mm fmm ~\N<m- wwf”
<O~§»~~<~m~ WMS
Though initially well within Minimalism`s gravitational field,
LeWitt increasingly felt that the constant simplification of geo
metrical form was a reductive trap; rather, he says, “I was always
thinking about simplicity, not reduction.” He began searching
for nonexpressionist means of creating form. One, he soon
found, was through the use of systems that could lead to “self
generating" forms. It was this theorizing approach that enabled
him to break loose from the rigidity that Minimalism seemed
to stand for, Such systems provided what he calls a “narrative
option," By positing an idea as a form, other shapes would follow.
rig is nan riavm, me mamma/ mee A major influence, he says, during this quest was a 1963 sculpture by Dan Flavin, the
rm wimam at ummm), 1953,
rmminul three (to William ofOckham), consisting of six white vertical fluorescent tubes
riaaissmit iiqnt fixtures Wim aavtiqm
ismns coueumn or me summon R, installed as a I II III progression on the wall (fig. 19), The first vertical unit initiates the
Guggenheim Museum, New vom
system; the second and third each increase it by one. In effect,'each addition continues
Pam carieetiun test
the "narrative," which theoretically could go on ad infinitum, LeWitt soon began applying
this principle of elementary progressions to develop his own forms,
He became an enthusiastic proponent of Conceptual art, in which the “idea” behind a
work was considered as important as whatever abstract shape it might bring forth. From
early on, he had regarded his structures as neutral transmitters of ideas about scale and
process. They were not, at least in his terms, aesthetic objects. (That adjective applied to
his work still seems to make him shudder.) Further, he felt their materials-wood, steel,
or aluminum-and surfaces, and the resulting forms, should not be too interesting.
Nothing about them, in fact, should interfere with the viewer`s comprehension of the
finished work as anything but the totality it was meant to be.
During the tgéos, LeWitt fabricated most of his three-dimensional works himselfand,
unlike his later industrially produced ones, a decidedly handmade look prevails in these
rectangular solids and hollow squares, whose parallel sides are not always of equal length
or in precise alignment, "I was trying very hard to make them perfect,” he says, “but of
course they weren`t. l was never that good with tools." However that may be, over the
course of the i96os, an impressive array of constructions based on elementary geometric
forms began to emerge from the artist`s studio-among them three-dimensional grids,
walls, towers, and ziggurats. The basic component of each of these, their common
denominator, was the cube. From the outset, it has remained LeWitt’s essential structural
unit. Yet, for all the cube’s apparent stasis, even in those early works he was determined
to invest its static form with energy and motion, ln more ways than one he wanted to
get "out of the box."
ln the early igbos, pondering ways to animate the blocky volumes of his painted canvas
reliefs (actually three-dimensional paintings with thickly brushed red, yellow, and blue
surfaces). he began punching square and rectangular holes in some. In others he incorpo»
rated boldly lettered words such as “look," "run," and “objectivity” (a whiff of suspect Pop
tnsinuating itself?). Another method of introducing a sense of movement into the blocky
relief format is apparent in two works of 1964 titled Muybridge, which contain sequential
Martin mama"
p|IIIIIII;I_I|I|I~ III |I'nI.I]I' III|IIc~ IIII»uI'II'II IIIIIIIIIIII
IIIIII-I III IIII I.II.IIII-~ III IIII- II~|II-II IIIIII- IrIIIII\I»~
III III.II IIIII--nIIII~\uI»IIIII II-IIIIIII III.I»II~I III I~I-IIIIIIIII
~IIIIII |II»IIII~I»II IIIIIIIIII ...III II.III\II.II-IIII I2 I\'pIIIII III |I|~ hI~II\\ IIIII\~I‘~ \\xII IIII' wh) HIIIIV
S/rzII/IIII-(pl, HI,III.I|]II|.||lj,1u IIIIIII pII~ II~II III' II II-II.IIIgIII.II IIIIIIIIIIIIIIIII \IIuI~ prIIIIII¢IIIg
IIIIIIIIIIIIOII IIIII-I
a series of such obdurately geometric shapes, some freestanding, others attached to a
wall, LeWitt, deciding that their frameworks were actually more interesting than their
surfaces, got down to basics by abandoning the sheathing altogether, The resulting open
grid now became an indispensable part of his vocabulary, Hrst as a black-painted tensile
form, soon after rendered entirely in white. Variations in proportion, configuration, and
scale began to appear, not only in wood but in white-painted metal also. An early version,
a six-foot cube called Floor Structure ot' 1966 (pl. 45), represented him that year in the
Primary Structures exhibition.
Not only did the grid become a dominant theme but, in combination with his durable
cube, it led to intriguing new compositional possibilities. One ofthese, begun in the
mid-196os, is the series in which the modular cube rises from a graphlike plane. In its
simplest version, Cube/Base, 1969 (pl. 58), the cube YSSIS on the center square ofa nine
unit grid. The cube-grid combination format achieved a kind of apogee in the Serial
Project #1 (ABCD), 1966 (pl. 61), actually four separate compositions that LeWitt combined
in a single super-composition. His obsession with systems kicks in fully here. On a gridded
plane resembling a large game board are set numerous cubes and rectangular forms that
vary in height and width, Some are solid, others are hollowed solids, still
others are schematically rendered frameworks. When grouped together, the four separate
sections that compose Serial Project #1 (ABCD) become an instant megasquare containing
thirty-six cubes, no two alike, whose materializations range from solid mass to tensile
outline. That the results may suggest a computengeneraled design for some sterile, anon
ymous metropolis doesn’t in the least trouble LeWitt, who shrugs off such architectural
analogies by dryly observing that this piece was never intended as a model for a city,
but for those who persist in seeing it as a futuristic urban complex he blithely adds,
"It’s certainly no city l`d ever live in." VVhen someone who had seen this |971 work in
an exhibition skeptically pointed out that Mies had already "done it," his response was
"Well, he was an architect, and l`m not. l’m an artist."
Ftu 2| Step Pvramtu at Zuser. ra 2650 BCE But despite his protestations that such readings of his constructions as architectural
saqqara, Eqvnt surrogates miss the point of his art, it’s hard to avoid making such comparisons. Even he
admits to architectures persistent allure. "I suppose I think about
architecture more than I do about sculpture," LeWitt says. "In fact,
I probably think of it as a form of sculpture.” The evidence for such
reflection tlickers in countless allusions to architectural forms encoded
in the work, and which are by no means limited to buildings of this
century. Throughout we detect affinities with far older forms,
however generalized these references might be, His far-ranging tastes
have long been for elemental shapes that range from Old Kingdom
Egyptian mastahas (fig. 21), Indian stupas, and the temples of Angkor
Wat, to early Romanesque churches and Brunelleschi’s great dome
for the Cathedral of Santa Maria del Fiore in Florence. Illustrations
of these wonders and other grand primal structures are pinned to
the walls of his studio.
4 Maw mamma"
In large measure, LeWitt`s strong response to architectural form was conditioned by
his early years in New York, after moving there in 1953. By mid-decade he was employed
as a graphic artist in LM, Pei`s architectural office, and though well removed from the
drafting room, he nevertheless became interested in various systems used by architects to
organize and develop their projects. Once settled in the city and beginning to make his
own work, his interest in architecture was further stimulated by his immediate surround
ings. The geometry of the city was beginning to find an echo, however distant, in his
work~not only the contours of its trademark skyscrapers but the chunky masses and
stepped outlines of anonymous postwar period office buildings that had risen rapidly
from Manhattan`s street grids.‘
By the early 197os, LeWitt`s cube-grid structures had undergone considerable variations
in configuration and size. His white-metal cagelike constructions, .1 fusion of both elements,
had grown dramatically in size, and, increasingly, he used his unique, quasiscientific systems
to generate new combinations and variations. “With such systems," he says,"you could
create forms that you wouldn`t normally imagine." In fact, he saw these personal method
ologies as a way of"gettingp//1st the pitfalls of imagination.” Past his imagination, perhaps,
but certainly not past his intuition. Each of his logical systems was arrived at arbitrarily,
however mathematically exact the results might appear. (As to mathematics, LeWitt
pleads ignorance beyond arithmetic for daily use.) There were, however, a few general
rulesfhis own, of course. In a LeWitt “serial construction," for example, the length ofa
cube`s side might be the fundamental measurement that is subsequently repeated, halved,
or doubled to generate more shapes, But there was no LeWitt “golden mean"; rather, a
ratio was chosen simply because he happened to like it. A long-favored one, utilived in
many of his open-cube structures, is 1:8.5. The ratio represents the width of one segment
of the cube’s frame to the width of the empty volume bound by it. He has always been
curious to see just where his arbitrarily generated numerical sequences of numbers might
take him and what shapes might evolve from them. When asked if his great fascination
with such systems might, perhaps, reflect some deeper, mystical interest, such as an
obsession with the arcana of numerology, his amused response was, "No, but l've always
liked numbers." To underline the point, he then observed that he would have a birthday on
“September 9,1999, or 9-9»99. The next time that kind of thing happens will be January 1,
2011, or 1-1-it!"
Allowing his intuitively derived systems to dictate the forms of his objects, LeWitt has
become a master hypothesizer, an inventive positor of "what if" situations: how many
ways, for instance, are there to stack three cubes-one solid, another partially solid, the
third open? Fifty-six is the answer, as demonstrated in his white-painted aluminum floor
piece 56 Three-Part Variations on Three I)Uffercn1 Kinds ufC11bes, IQ67/1974 (for an earlier
version, see pl. 65). lust to make sure that he had covered all possibilities, LeWitt had his
assumptions vetted by a few mathematicians: he hadn’t missed any, And how many ways
can an incomplete open cube-that is, a cube missing one or more sides-be shown?
The answer is one hundred and twenty-two, as Incomplete Open Cul1cs,a frenetic 1974
conglomeration of angular metal spaghetti, readily reveals (pl. 68). He worked out this
consrnucrion status
astonishing arrangement of shapes by bending paper clips into various configurations,
The complete installation includes a similar number of photographs and drawings of each
unlinished cube variation. But apart from the empirical process of working out all possible
permutations lies another and deeper concern: the relationship of actual form to infinite
space. ln effect, this constellation of incomplete cubes is :t philosophical disquisition on
present reality dissolving into nothingness,
Throughout the tgttos LeWitt concentrated on richly detailed structures composed of
innumerable small open cubes. These line-scaled, virtually transparent masses took many
forms: some as elongated, towering volumes; others, as horizontal ones that lay on the
Iloor, There were walls, low pyramids, wide stairs, and tall angular spirals, Ot' two titled
Htxugmg Structure from 1989, out is an upside-down tower, a three-dimensional X-ray of
a skyscraper (tig. zz); the other is a llat rectangle with an incomplete corner, which in its
airiness, looks like a cubici7ed stalactite. A later, monumental manifestation of this open
cube theme is the sixteen-and-a-half-foot elongated ziggurat 1 3 5 7 9 11 he created in |996
tor The Nelson-Atkins Museum ot' Art tpl. 268). Despite I.eWitt`s reservations about
architectural analogies, its soaring skeletal outlines instantly suggest a 1930s Deco-style
skyscraper. While such tensile forms-essentially geometric drawings in real space#
are his most intricate variations on the cube, they are, at the same time, wondrous
disappearing acts in which white forms can dissolve nebulously into their backgrounds.
They inhabit space but are oddly recessive and, under certain light, take on an elusive
spiritual dimension,
In the late 1980s Le\‘\'itt began making tall, sharp-sided, and in some instances, aggressive
edged white polyhedrons tpls. 254-58). ‘lermed "complex forms" by the artist, many of
them evoke forms ofthe natural world-jaged mountains, icebergs, and multifaceted
crystals-while others bring to mind church spires and sailboats. Their origins, though,
were not in descriptive reality but in the schematic studies LeWitt made to determine
riq 22 so Lewin Hanging sf/ima/E asc, their eccentric, quasigeometric shapes: "I was trying to figure out how to make things
1989 Parties wwe vacate eoiiertm that I had never imagined," he says. "I had no idea what they would look like." The process
utilized yet another ol his systems: "I would rule offa grid on a sheet of paper and where
thc lines intersected, I would place a number, say. from 1 to io, to indicate the height ofa
vertical line from that point." The next step was to connect the elevated dots, which led to
these unpredictable forms. The drawings were then turned over to a carpenter, and small
scale wood models were soon succeeded by full-scale pieces in wood and aluminum.
For all the systematic order ol' their genesis, these idiosyncratic, even insurgent, shapes
were introduced into LeWitt`s theretotore carefully controlled hierarchy ot' forms. Until
he began working on the Pine Bartens structures, they were, relatively speaking, LeWitt`s
most allusive sculptures.
Even as he was developing those spectral forms, he was pioneering new variations on
his eternal cube in possibly the least likely candidate for a line-art material imaginable:
concrete block. In stark contrast to the transparent open cubes, but just as architectural,
these weighty structures were formed of layer upon layer of massive volumes. In a way,
they represented a new, obdurately anti-aesthetic stance, especially in contrast to his
»»_ nt ni amy
increasingly relined open~cube structures that encompassed more empty space than
solid form. But such polarities are not uncommon in LeWitt`s art, with its long history
of alternating between primal simplicity and rich complexity, between wall drawings and
structures. He Grst used this prosaic medium in the five-meter Cube he made for a 1986
exhibition in Basel (pl, 283), and soon employed it in other outdoor works: cubes, massive
towers, stepped pyramids, and walls. Though mainly an outdoor medium, concrete
block was the only material he used in a memorable 1995 multiroom installation in the
commodious Ace Gallery in New York (pl. 304). Dominating each of its many spaces
was a primal shape over whose gritty gray surfaces there was interplay of light (skylight)
and shadow. He had been attracted to this improbable medium, he says, "because it was
a totally ‘non-art one,` with no historical associations” and, besides, he adds, "concrete
blocks are basically the same all over the world,” easily worked with, inexpensive, available,
Furthermore, the low-tech masonry process lends itself admirably to the primal shapes
he has long favored. What better way to ensure that his ideas could be carried out with
ease, here or abroad?
Geography has never been a limiting factor, and LeWitt has worked on projects, large
and small, throughout North America, Europe, Australia, and Iapan, But though an artistic
internationalist, his visual language utilizes a relatively small vocabulary of universal
images, And while the architecture of a site might influence the connguration of a LeWitt
wall drawing or three-dimensional work, other issues, such as social or political ones,
generally do not, He characterizes himself as “a political person but not a political artist."
But a salient exception to this apparent detachment was the Memorial to the Missing lews,
a massive concrete-block structure made for the 1987 Skulptur Prnjekte in Munster exhibi
tion in Germany That contribution, initially called Black Farm, was a massive, black con
crete-block construction like an altar placed in a square, the Schloss Platz, in front of an
ornate eighteenth-century palace. "I wanted to make a piece that was completely different
from the lacy architecture behind it," he says, "so I made it in a sort of ungainly block. I
wanted it to be hard to swallow in terms of form and completely antithetical to its site.
Then I decided to make it even more antithetical by painting it black. Once that was
done, I thought, well, I’ll take another step and give it a title that will make it even more
unpalatable," Everyone quickly got the idea. The palace`s neighbor, the Westfalische
Wilhelms-Universitat, was less than eager to have LeWitt`s polarizing bleak monument,
which was soon covered with political graffiti, at its front door, and it quickly became a
cuuse célébre, engendering passionate local debate. Soon after its jackhammered removal
from the plaza at the exhibitions conclusion, it found a second German incarnation
(pl, 186), It was reconstructed in slightly larger form in front of another palace, the
Hamburg-Altona town hall in the Platz der Republik, across from a site once occupied
by a synagogue, "This was the only political art I ever made," LeWitt reflects, “and the
only thing political about it was the title, but I thought I owed it to the Germans
and the Iews-to make one comment.”
In the last few years LeWitt has even ventured into the realm of architecture per se.
As the best-known artist in Chester, Connecticut, and a prominent member of its Beth
co~sv»wctiuu stems
w~1~»»~ '
' ,mmo l t
5 < _ _ Qmmnnn tm; -_
t_gli@ LL1!l| . it e-;;i
» ll “ ily!M , .,;,,.:yftj`}y: j fc ' ‘lg V r__
, . ls- W
3
,n | |. t_t_ ' YW X 1%|$|$|1r1|1|1|1|1 l
c__ l ull l!!, !@@.i ,E'! u'L .
Flo 23. sol Lewin, Pmposa/ /of Shalom synagogue, he was invited by the congregation a few years ago to help design
Bern 5/ta/om synagogue, chester.
conneetteot, i999 its new building. After a model of a strongly geometric structure was respectfully rejected
as being too severe, he investigated earlier synagogue forms, particularly the humble
nt; 24 Stephen tloya, Design /of
sem sn.;/om synagogue, chesten
seventeenth- and eighteenth-century wood buildings of Eastern European shtetls. Based
connertveot, i999 on the contours of these traditional structures, he proposed for the synagogues central
element a hlocky pyramidal form consisting of three units, one above the other, the
smallest at the top (fig. 13). Their sloping roof lines were the setbacks. By this time, the
congregation had engaged a young architect, Stephen Lloyd, with whom LeWitt began
to collaborate. Their plan incorporated LeWitt’s blocky pyramid in a new scheme that
earned enthusiastic board approval, and the building is about to be constructed (fig. 24).
Against the backdrop of such simple, architectonic forms and LeWitt’s well~known
history of open-cube and solid-cube structures, the sumptuous, color-saturated shapes
of the proposed Pine Barrens works might seem startling, Except that they echo the
shapes and colors in his latest wall drawings, just as his perspectival renditions of open
Ma t r teams"
and solid cubes afloat in the earlier wall drawings alluded to the constructions of the tinte.
He acknowledges that such symbiosis is at the heart of his work and that he moves back
and forth freely from one medium to the other because, he says, "What I don`t want is
atrophy,” And last year he made his first "exterior" wall drawings. A commission from
the owner of a Barolo winery, all four sides ofa small chapel in Alba, in ltaly’s Piedmont
region, now vibrate with his high-spectrum curvilinear wall drawings (pl. 309), Sculptural,
colorful, perched on a hill, the building with its drawings of primary and secondary colors
shows affinities with the architectural forms of the Pine Barrens structures. His imagery
whether resolutely geometric or, more recently, sensuously arcedfdraws inspiration from
the underlying structures, and calls attention to the forms it overlays.
LeWitt has a simple explanation for the emergence of color in the structures, surely
as surprising to some as his new proclivity for rounded organic shapes. "Well, why not?"
he asks, observing that different eras engender different artistic reactions. "The difference
between the sixties and now is that those years were a time of very strong ideology, politi
cally, aesthetically, and every other way. In order to break with the past and make new
things, you had to begin with some kind of ideological framework." The sixties were also
the beginning of his deep immersion in the Conceptualist ethos, and a time, he says, when
"I could never have made a colored sculpture. It was something I just couldn’t do .... But
now I say, so what? lf it seems to promise some kind of interesting result, why not do it?"
LeWitt may be mellowing a bit, perhaps loosening the Conceptualist strictures of idea'
over-object, Even he admits that his interest span in methodologies has been relatively
short, and while intrigued by systems, he has never really been in thrall to them, remaining
with onejust long enough to explore its potential before moving on to something else.
Nor has he always played strictly by his own rules. The objects that proceeded from these,
for all their premises in logic (his logic), have consistently transcended mere formula,
thanks to his subtle interventions and manipulations of the rules, While such rules may
have been helpful in the short run, they were never a substitute for his purely intuitive
decisions about form. As such, his structures are ultimately as much about enduring
formalist verities such as line and mass, volume and void, as about some motivating
idea. Over the course of his entire career, he has made objects that have a life of their
own, well beyond embodying whatever invented systems may have led to their making.
The overwhelming evidence is that, intentionally or not, his elegantly reasoned sculptural
forms, like his compelling wall drawings, more than meet aesthetic criteria as well, and,
in fact, vastly expand our sense of what those criteria can be.
Nates
i. Now a senior curator of painting and 3. As Lewin wrote in a igf-es Arrs.’t1ugizzmr adequate daylight for the cny`s tncreasmglv
sculpture at Mama, Meshint was fi ,uninr essay, than tharprfdged ngginnt innnn were en-wana men. sie his "ltggurats," /ins
staff member there during LeWit\'s time at not the results of enlightened architectural Magazine 41, no t (Nov. tggel 14-1;
the museum. thinking. Rather. these setbacks were klienous (reprinted in the Appendix in this catalogue)
2, All guinea in this essay an fnnn conver- bvPf°d“<‘> Dfw wffttifllv imvosfd Simm
sations with the artist in March nm. the Citv's nina building enact dengnni in aiinw
cunsrnucriun stems
§ £
/ V4/¢.|.‘ yer:
71|-IIIIIIIIIX
=§':ré2}= F
O'
4 gs,
<1¥2
AV
G 4% 9
*Q
!:§'4;_
gil!
it ' Al
APPROACHES T0 SERIALITVI SOL LEWITT AND HIS CONTEMFDRARIES
Anne Rorimer
By the late 1960s, Sol LeWitt was personally connected with the majority of interiiational
figures whose work has come to be associated with Conceptual art. Living in New York
City, where his Hester Street loft became a social nexus, and traveling frequently to
Europe, LeWitt crossed paths with numerous t1rtists,writcrs,and musicians. A glance at
the long list of artists represented in the LeWitt Collection, which comprises works he
has purchased or traded for over the years, attests to the far-reaching nature of his orhit.’
LeWitt`s work is central to the period of ferment marked by the shift from the ideas
of Minimalism to those of Conceptualismf ln two major areas of innovation in the
19603 LeWitt was at the forefront of developing principles and methodologies that have
proved to be of utmost significance, For one, LeWitt’s formulation ofa serial approach
led him to the production of works in which visual complexity is derived from rational
simplicity. As a progenitor of what is now termed “installation art," LeWitt furthermore
played a pivotal role in the radical move from canvas support to spatial environment
that occurred in the later 19605,
A key passage from his seminal "Paragraphs on Conceptual Art" explicates the proce
dural method that has served LeWitt in his practice as it has many of his contemporaries,
each to his or her own ends:
To work with a plan that is preset is one way ofat/aiding subjectivity It also olrviatus
the necessityfor designing each work in turn. The plan would rlosign the work. Some
plans would require millions ofvariatinns, and some a limited rtumben but both are
finite, Otherplans imply infinity In each case, howeven the artist would select the
basic form and rules that would govern the solution ofthe problem. After that the
fewer decisions made in the course 0/'completing the work, the lretren This eliminates
the arbitrary the capricious, and the subjective as much as possible. That is the reason
for using this method. 5
Wall Structure, 1963 (pl. 37), was LeWitt`s “first serial attempt." * Rectangular volumes,
enclosed one within another, progressively widen and shorten from the work`s center to
its rim,jutting out from a flat plane into the viewers space. ln the following year, with
the realization of Mu;/bridge I (pls. 43-44), LeWitt furthered his investigation ot' pictorial
planarity and spatial reality with relation to duration. Familiarity with the studies of the
nineteenth-century Anglo-American photographer Eadweard Muybridge, who is known
for hundreds of photographs of animal and human locomotion, aided him in a concerted
search for ways to counteract the static nature of singular objects (fig. 3).
Muj/bridge I is built upon the eponymous photographers procedure for presenting
the subject in motion as a series of individually recorded moments to be read from left to
right. As opposed to Wall Structure. this work, also to be read left to right, is experienced
No one other than a mathematician is going to know what that series really is.
You don`t walk up in /the piece] and understand how it is working, hut I think you
do understand that :hare is u scheme there, and that it doesn’t look as fir is just
done part by part visually ..., The progressions made it possible to use an asymmetrical
arrangement, yet to have some sort uforder not involved in composition, 7
wie owner
- :I _ f/ 1/...s ‘
"l=flji'=I.'E"’
.,_- .' . e§§
__) _ |22 I 0' ~ Q é§_i ln works by LeWitt, to the contrary, the underlying program is not
|-1 7 0S;I 723,32-*tl-LX 5. 4 ‘ . . _
-\ » 5. V 3| . vw. v E hidden but spelled out in titles such as 49 Three-Parr Variations an
, ' / § Three D1ffererxtK|nds of(.ub<'s, i967»7t (pl, 65). Kept thernattcally
11” ‘ 'FM 'H " ' 27"2552‘f2) 7* \< ,g Q sf behind the scenes in Iudd’s work, the plan`s open declaration in
- |‘) " 1‘n"‘b’50 ’ 1| i ‘?1;q3) 'Y l `&‘§` LeWitt`s shows how it engenders content by means of its inherent
‘la -ll0'lH»l!-ISI I ) |'l)Z653S~*1‘l; 1X i/ logic. His serial works thereby escape the potential stasis of singular,
It #Hb
i ' I ' '4
,g.._5~; )_ \'\ . , .
ln)-a|Hi-H352 7| ) 2 i . |01 4? 5J¢PS solid ob)ects by overtly expressing the cumulative visual dynamics
,V ' _ \ I -s that imbue each work with its overall form,
ut |~t1m»b-»SS-31-'r
r__
2) j _ >§ 1`;‘{ ( ?i?;; E A brief comparison of LeWitt`s method with approaches taken
' ‘ §§~§`x by some of
~S`l;£6-7S7Y his contemporaries in the late igbos suggests how serial
s Es
, ._ - »
)_’ S6 ’ _ ' I ‘ § l systems have played a major role in the achievetnent of a variety of
'iii IS _ ,S )57,7l;’5; X l aesthetic ends. In all cases, the preset plan allows the work of art,
'S H I6 ' xy S E li ` ' §° ir\ effect, to create itself while remaining grounded in the reality of
'Z | gégmnu external factors or existing facets of representation. Examples are
' IQ-> 0 ""' 4 I )` Y found in the numerical permutations of' such artists as Hanne
'V 5;£'5"';,?;2‘°:f'i¢ lzxfgfa-r;Z;'y“(=F Darboven or Mel Bochner; sequences related to the existential self
§,{r dk ¢x4l.aa0 ’ flugpaua
_ -» nv
2 Llxgwlx
Zara (Maha _ as in the work of Adrian Piper or On Kawara; and permutational
?..,,.; 1/ pa => #Q If 0»0 -,2&,}'1zts ,qu ¢mrs?u?é progressions derived from nonart systems that underlie Alighiero e
§“gZ“‘%3g0fh':ii2'§xE"s‘ti],,% ” Boetti’s postal pieces or Dan Graham’s Homes for America.
W 5 F5 ‘;"”"|‘|l‘
itgeajzilf °'“ 'MY _ _ W v
¢>_),,,,q,»»,= The work of Hanne Darbuven
asv-»<4‘§4‘°';‘“ _ _ _rests
_ on her origination of complex
Wvlrygza
“WHY /;, $,Z,3/,q,q-__Ei£»fw1yl"f”/ 5 7) numerical and/or linguistic systems. ln t966»67, during the early part
of her three-year sojourn in New York (she came from Hamburg),
Darboven was using the tiny squares of graph paper as a supporting
rig, 26. Hanne oamoven, /naar structure for exploring spatial and numerical relationships expressed by parallel, per
In 100-00-99-2-61 |978
pendicular, and diagonal pencil lines and by lines drawn within or across individually
Ink on papen Lewtrr correction
demarcated sections, On 9 Iune 1967 she wrote, "everything is based on: Numbers, the
small multiplication table, Numbers in permutations, in progressive, symmetrical, and
mathematical sequences; shifted angles, numbers, and multiplications of numbers and
angles, all in mathematical permutations. I find this fascinating, being pretty ignorant
of mathematics,” That same year she met LeWitt and others of his close-knit circle.
In 1968 Darboven replaced the spatial mesh of the grid with an invisible supporting
scaffold of numerical formulations associated with the calendar (Fig, 26). The artist was
able, therefore, to directly construct works that, anchored within the flow of time, escape
the grid`s fixed nature. ‘A system became necessary," she has maintained, for "how else
could l in a concentrated way find something of interest which lends itself to continua
lion?"° Darboven’s investigation of the myriad permutations provided by the four to six
digits needed to record the day, month, and year ofa calendar date (excluding the first
two ofa year`s four digits) has provided her with a guiding structure on the one hand
and an open-ended, uncontined freedom to act on the other, just as it has LeWitt, Using
numbers and generic handwriting, Darboven achieves a tangible transcription of spatial
and temporal relations that testify to the physical and mental commitment underlying
the production of art. The controlled system advocated by LeWitt lends credibility to
, ..
} L . I
IIIHI-I
IIIHI-IIIHUIIUBU UEHDUEH
H--HI-U UIIUHEIIE nnunnnn
annnuan unaunun
naunnnl unmnnnn
nnuuuuu
lllE|l|
“BananaEIIIUIIH EBIIHIIHH
UEIEIIEHU UHHIIUBU unnnunu
unnnnnn nnnnnll
nnununn nnsnunu
nnununn
IIISIII SIISEISIIEDUEIBII
3535333 Bnnnmnn
Baumann
llnunnu
lunnann uuuuuuu
Illulll IIEHHEIEII namunnn nnnuunu Euununu
uuuuuun
vislmlsl.1\e|nc|\l> generated hy nn|nrri\.i| pcr|nu\\i|iu|i~ r.\\hur lhiin In }wr\nn.\I \\h|n\.
Numcric.i1sys\cins and scqiicxicu .irc icnlml ln mnih ut Mvl l§m|\1\cr\ \\\»rk truni
1966 through \q75f" when hc songhl l\\\'\lm1d.||\cr,\||y .indthcurc1|\.i||i;\|1cpiuniilnig
boundaries of thc .irl nhicu and lu givc thrininn .ind \ v~n.il pmulcmu tu the prmu|i||c~
behind ncslhciiu pmducIim\_ |§uc}\m~r'~ "dc\||c Inf an .ir\ thai dui nul .nhl Jiiytliiiig in Ihr
furniture oi the \vorld,"" resulted ||1.\|1.\|\.\lv\i~<v| how~<»|nul|in\gi»1<v\w pcr¢c1\ui.imi
undemond. |§cm\vw1 we; .ind i=;f»7, iimlimr i-\pm|m~n\<d wish nnun-n\,il i\»|\i|»|n,i\1<»i\~
derived noni mniplc >cri.\l ~)\(cni~ to <'|nph.\\|/c w|1\\rmt||n\ |\.\~ud on prngminnmlii
thought, .md n|I>\ui|\i»m\lv ru.|l\/cd "\|\.n \»un‘~ <\|~\i-11 Ilvr mm mg mn ui .in m<N~|\u|i
munlal do|\\.nn wilhnui |n.ik||\g`\Nng\"`
The .\rli»l hm uxp|.1||wd\|\.\\ in \\urL~ lvkv in I’/ming:/1/~/i~/:mlm [>n|g1i|n1~, |966
Mig. :7b. he \v_\>"\n>1irying|\»1\\.\\\u»L\i|pNr\~hm \¢» ~)m\\ ~L\1|p|\m-.i~ .u im-|lu»d."`
`l`hiriy-mx p|ml6gr.\pl\~ ri-L61 il mlm-u \ n-wpmn\~ Lp|.m, L-|r\'.\\|¢m, .ind un nur pcr~p<ui\'c1
uf lwchc scI>nl`>x\\.\l1h\||ldingN\>Ll<\,wlmli hc .irningnd .ind ru_iir.\|1gu\|\\nhi\ »l\idi<v
\.\blc. hugh srl wrrcspuinls in ihc num|»<~r\ nn in rs~p\m|i\u .n\\\|np.\|1ying grid. 'I In
work ,»i\.»\.»gm,»haL.i||y |»¢~¢.»\~~ mini mn" im m.m\»i-mg ~i|1.»mi~~ pmivii-miiimi ln
thc *mm in order tn climimnn \m<h\mn.\| min-ri.i||\i And m.i~~ Surmliiv .illimud Bndiiwr
16 highlight the icmpnml n»mp.»m»n\ 61' ~i.»|,»n.f..| i-\,»i-i .fmu ima mi- i\»<»fiiin\¢i\»m.i1
pr¢>cnl;ni6n wa> used lu rvlcr lu ~Ln1pnn¢'~ nhmyfdum~n~|<»n.\|nv \\iih\»ni lhc,ir\1>\ lining
uminnruu.inwhim.Ifu1lyu>gm/.imni ihf Wm] im-iIn>d~ 6| \linini.i|i>ni\|1c cxpiiiinrd
curly un that he had cho~cn".1 ~cri_il iunuinn |wuL.n|~u ii uinplniud J ~nnp|c ruinnwd
riq 27 Mei Sumner 36 Pnarowpn
am 12 Dfaqfams i966 Pnowqfspns
nieixns ofmcasurc, Ls., nun\hcr,"whi1u y\c|d\ng"\|~i|.\] u»|\ip|u¥i\\'."` Mimi with \hc
am mu mawif-qs mwuec on moan: faciuul uipm ofphomgmpliic d6:nn\¢nl_\\i\»|\, .\ unrk ~u\h .i~ in /'Im1i»gmpI|>imii1;
ami;-(mn ov nw scaansme sa we
I)mXmnis cmploys scriulily lo qnonun trinhtiuimi ~\nlp\\m‘ lk;-il hers lu dui\|i~lriicu\'c
im iennawnaiisi mmm
enda, Bochncfs scrml incthud nnnc\hcIv~~ p.n.\l|vl\ (hu |\.i~|k in\\du~\»pcr.imi1g\i\‘crni|\g
rig 28 naman my Hyper/mi; works by l.l\VilI.
Simi/on mo, was mann pane'
pnomqmpm mu |w@»mmm.§m»
ln lhc lulc 19605, .-\dr|.1n l’ipcr\1cg.in lu uplnrc \\.\\‘\ In cxplriniv inrcgmund hcuclf
pages cmiefnon uv me artist aa hoih che suhic-fx ml and an 6l>w<i in, hcr \\\\r1\_ \\hcn ~h¢ mi-1 I<-\\`n\ »h\»n\v nm
sccingi .ind living \|npru~~ci\ |v\, 46 Iliruu-I’/Jr! \1nm1mn>
im 'I'/rm'IJ://vwn1I\'|ml~n1 1`|<lw~ [pl 631 in iqox iii ihc
l)w.in (].\\]c\\' in New \i\rk\ Piper \\.\> >ri1l.\~\udcn\.n
jffji fY'
Zii'颥; 6
\\1<~SiIw6|6|\'\»u.\1¢\r\~\|\cru.I|\ihc mum, ~|w nmud
|1or"~i\\\|v.\lhi “nh ilw pmilinn im .in \.\L¢n hy 86|
i ._., _.___4 lu\\'m," Nuiing min ~h\\ w.i~ than "|ni¢ru»i¢d in mlm
6,
¢m\~lr\i\||i»|\ nt tinnu~\~n-n\~.,.lh.\1 ~¢r\'un\<m\\.\ii\
.nu |du.\ w1\N|\U_-\l.nn |<»rm.\\ |i|ni\~ .\nd\<\c\h.1\|>\ ihc
p\>»~|lwi||||c» ui ihu nlc.\ wi |\y thnuc |i|ni\>."" Piper
EJ _K i i~ i » L
nmdu \|w liy;mz/nw wru->, i~;f~P<»f<>1tig,;x>,‘\g1u\|p
ni |1||ic|n~c\\ ¢h.igr.\n\n\.\\|\ \\‘i>rl<~ nn graph paper \\'i\|i
9- w|1nm~|.\ ah~,wi1h ihc uml ur .mfndin v 16 hu mm
wir-<<»|i~L|\>\i~|\¢~<_ Shu rutluimi Lim on hm m6\|\.m6n
and niclhmi:
Piper took photographs, some randomly and others at predetermined times, that are
"symbolic representations of the contents of my consciousness at a particular space-time
location and monient" “ and related to the space-time coordinates she plotted on the
graph paper, In its studied serial1ty,I’iper’s work pertains to the fact that orientation in
the world 1s necessarily at tconlsequence ofdiflerent spatiotemporal situations in relation
to consciousness ofthe self. Although her ensuing work, with its political content and
use of photography and video, has followed a different course, the artist acknowledges
her indebtedness to LeWitt’s ohiective investigative strategy. "Sol`s sensibility in general
has influenced me enormously," she has written, adding that her “earliest conceptual
work succeeded insofar as it illuminated the contrast between abstract atemporality and
the indexical, self-referential present.""‘
On Kawara is also concerned with consciousness and his place in the world. For him,
however, seriality 1s usually a function ofthe segment of time defined by the twenty-four
hour dav. The 'li11l11yser1es,hegun in January 1966, now consists of many hundreds of
canvases representing the date (month, day, year) they were painted (fig. 19). I Read,
begun 1966, I lterzl, 1968-79, and I Met, 1968-79, consist of daily recordkeeping, while
the series of postcards titled I Gai Lp Ar, 196849. and the sporadic telegrams [Am Still
/-\l1\'e, begun 1970, fall partially into the category of mail art. The ten~\'o\ume sets of note
books of One Million }k'¢11's~Hasr, begun 1969, and One Million l2'r1rs-Futiare, begun
1980, convey the tast, vet measurable. expanse oftime from 998031 B.(j. through r\.D.
1969 and from /\.l>. 1981 through 1oo198of" Ten rows of sequentially tvped columns of
individual years, separated hy decade, cover standard 8'/1 x 11-inch pages. Each page,
rrq 29 or krrrarrrr 0.1 11 12175 we front and hack, accommodates a listing of five hundred years. By representing one million
trqurter an mm cmiaftrrrn 01
we Ar: mortals s* mcsqe years from the time he started each work, going backward and forward in time respectively,
ram-rrrrrr car-1111.1 mr. mr- rrrrrri Kawara gives representational form to a temporal span that is immense with respect to
human evolution h\|t,geolog1cally speaking, is extremelv hrietl
lsawaras series are positioned 111 relation to the artist's ultimately finite lifeline, invisibly
inscribed against the hackground of spatial and temporal infinity. Whereas time in Pipers
Hyjvrvzliesis series 1s iust one coordinate and for Darbuven it is an abstract guiding force,
for Kawara it 1s an open-ended diurnal continuum. Activities performed by the artist
as part of his dailv life-not as a "performance" per se-provide markers in the form
of |\e\\'s clippings |IRe11d); maps ofthe artist's route through the city (I Hem); or the
names of indivtdttals encountered during the period ofa day (I Met). These three works,
\~~» war wr
lllllll, lllllll\ IIIIIII IIIIQI! lllllll contained in looseleaf notebooks, preserve traces
of temporal, spatial, social, and cultural experience.
_'"““ “‘"'lll "run ||Qllll l||!lll` Whereas the module for LeWitt is a cubic or graphic
lllluu ll’|lI¥l liiliii ll|’lll llllillil one, for Kawara it is temporal. With his unit of mea
surement heing the day, seriality is a function of
llI!`ll`a llllllll IIYIIUII lIU!’¢ll llluw calendrical time." Quite differently, works by l_eWitt
lllilill llillili urueu. ureuvz IIIITIF do not allude to the everyday or existential. Instead
of representing temporal segments that structure the
"l‘|l'll llulnuw IIDIIUI ll*flll"1 ullluwh perception of time, works by LeWitt reflect the varied
IIQUIII ufwumu Ilumuuu lllfiilel ullwur schemes that determine their overall form.
Among the works by Alighiero e Boetti engendered
Illlliyu IIWQQIU ufsuuu IIUIQIIA Hunan, according to a plan are those carried out by sending
"l"}l llllflf uwuu uwru lll=<v!`» envelopes through the mail. Boetti’s Untitled (Victoria
IIIUIII IUIIIII uuaui uumiu Ill‘4.v¥U§ Boogie Woogie), 1972-exhibited the next year at the
Iohn Weber Gallery, New Yorkfovertly acknowledges
IIQIIII ;||u;|n lI¥lI;l; QUUWIIJ |U|llT|J\< LeWilt’s aesthetic strategy of allowing a preset system
-IIUIIIQ uoaeléo ll'¢||Ul IIWAIJI IIIIUI-(Il to replace the "hand ofthe artist."/\ statement in a
IIIFIII lllIIll.lIlilli, uiauma unusual framed panel that is part of the work reads: "All
permutations of seven Italian stamps," Each of 5,040
|l-flfllll undue uuuu IIUEJIQ uvurwg envelopes possesses a different ordering of the stamps,
l§lQ’;|| f|l||r||| QIIIIII llwtlli llI`~’N1L¢l all of different colors and denominations, which are
glued, in the usual manner, in a horizontal line at the
!Ill`|ll lllllli "Tllll Illllll IIIJIZI envelope`s upper right-hand corner. Boetti mailed the
yugo; ll¥ilI|¥ lllillffg uname stamped envelopes to himself in Turin from different
|||;|| ll‘lllll vIII_§lv!I Illlwml cities in Italy, and then framed them in groups of izo
(fig. 3o).” Colorful rows of canceled stamps replace
|n|||;| |l|;;V:-Iliillll "nun iluteurn traditional manifestations of color and form at the
same time that proof of posting adds further visual
Illlal Wllglanl lllllU_l llUll!Z1l lllllll incident, By sending the 5,040 formal components
nuttin eu;}u` uuueuii llUl'll "www (the stamped envelopes) through the postal system,
IIUIIII "uw: uaufa; llllll‘I IIIIIIGI he validated the work according to the function of
"noon nun: ll'|lll! IUUIWIQ lllilllil the stamps in the real-life, nonart context of the mail
service. Following the example of LeWitt by allowing
||||||o |||||u| Ilfllill IIUIVII llllllirl a permutational system to replace compositional
decision-making, Boetti circumvented the need for
technical virtuosity and handcrafting to create a
seemingly sell'-propelled work.
ng, 30. Aliqtuero e Boettt, unmlea Serial permutations in Dan Graham`s Humcsforftmcrica, 1966-67, rest on the artist`s
lvretar/a Bangle wouqis t<netat|>. |972 scrutiny of social conditions rather than on his own devising ofa scheme. This work
42 frames each eantaminq |20
stampea erweiapes, courtesy takes the formlat) of an essay in the December/Ianuary 1966-67 issue ofArts Muguzuie
Jann weve: setter-,_ New vm. (Hg. 3\).“ Utilizing linguistic, photographic, and contextual modalities, it presents one of
the possible serial variations in basically uniform tract housing found in many American
\_ 'H '.¢
~ 'v
7 L'
mi 3' Da»»;fa~a~ »<Q~~@< cities. ,Although thc houses are virtually identical, (iraham demonstrates how language
fm ,1m.=H,r Aff, ~,+Jaa;~~@
nw iwcrowl wif zlrrrvm.
i» one tool uxed in _utempts to disguise the underlying uniformity of such coinmun\\\e>,
W an @~¢<vv.=r\ 4-al pr, \\'h1cl1 are commonly given names like l`.ur Haxen, Pleasant Grove, or Sunset Hill Garden.
ww. wt
with covert co|nn1en\,\l1e article documents ti typical town that offers prospective buyers
choices of eight llama models, desrgmled by rnusical .times such is The sumo of The
Nocturne, and eight exterior colors,\vh|cl1 include Se.1tb.nn Green and Colonial Red.
tiraham lists all ol the possible combinations in .\ hlock of eight houses \n which four
model typo ...Q tml.
\.\ nh tltrect reference lo the methods ol sermlny inherited front Mirtinulisni, Homes
/ur .-lrizerztri deri\e~ ns lot in from \he mttsked realities ot tl\e contemporary industrial
|.1nd~tr\pe, Penelraltng beneath the \erl\al \encer .ipphed to the sale ol' houses, the work
reveals hon the |\res\|\u.\l1l\'twhlective qu.\l1tiesol'lorn\ .ind hue acquire suhyectivc under
lones ln coniunction with associative pliraseology \l\.u "colors" A tntuupulative, hidden
.\gend.\ motwatetl ln' economic greed rather than hy models ol' social enlightenment.
Rather than representing the outcome of ;\ serial scheme set forth by the artist. Graham`s
plete tnvestigtues preexisting applications ofserialilv in the real world. For Graham, serial
permu\.\t\on, resting on gi\en aspects ol vernacular architecture, points in the direction
of social c\‘ili\|ue,\\'l1ere.ts for l.e\\'il\ wrmlity retains its generative function.
LeWitt began to apply preset “narrations" to drawing shortly after adopting them for
the realization of three-dimensional structures. Simple visual points of departure that
adhere to a set permutational sequence have yielded the same fusion of clarity and
complexity in two dimensions that characterize the many cubical works made since his
first serial piece. ln drawing, his serial method led LeWitt to the broad scope of visual
ideas and effects manifest in his books, prints, and wall drawings, A systematic approach
to the creation of his early wall drawings enabled him to free line from subordination
to representational cross-hatching or contour.
In LeWitt`s drawings, line-including straight or not-straight lines, broken lines,
short lines, touching or not~touching lines, etc.»is employed without descriptive intent
for a wide range of visual purposes. Environmental wall drawings, in which preplanned
permutational systems play themselves out with immediate reference to their physical
location, are governed by language that details the plan in an instructional manner.
LeWitt made his first drawing directly on the wall in the latter part of 1968, and by 1969
he had arrived at the idea of using the totality of an enclosed space as a site for drawing.
A pen-and-ink drawing of 1973, for example, sets forth a plan that has been used for
numerous wall drawing installations: All Combinations of/tres from Corners and Sides;
Straight Lines, Not-Straight Lines, and Broken Lines. No longer serving simply as a neutral
background support, tl-ie wall, rather than a sheet of paper, becomes an integral part of
the drawing. Redefining earlier approaches to the creation of interior environments,
LeWitt’s wall drawings “draw” the supporting mural surt'ace(s) into the content of the
work. Significantly; "no matter how many times the piece is done it is always different
visually if done on walls of differing sizesf’ l’ or of differing shapes, according to the artist.
LeWirt was one of the first to define the surrounding reality of a given architectural
enclosure as an integral part of the work. Some months after LeWitt, although indepen
dently from him, the German artist Blinky Palermo likewise initiated a series of wall
drawings and paintings in which the surrounding architectural context is inextricable
form the work`s totality, Whereas LeWitt's works involve the fusion of verbally designated
linear systems with their appointed spatial environment, Palermo`s, somewhat differently,
meld their background support with forms obtained from architectural reality. For a
1970 exhibition at the Konrad Fischer Gallery in Dusseldorf to cite one example, Palermo
painted to scale the projection of an actual staircase profile onto one of the gal|ery`s walls
in a suitably proportioned, relatively narrow space (fig. 32). Affording an undulating
shape, the staircase prohle correlated with the observable reality of the exhibition space.
Not unlike LeWitt’s linear systems in its function, if not in its form, Palermo`s staircase
profile-extracted from material reality to serve as a found rather than an invented
shapefmerges with its background support. Suppressing authorial signs of arbitrary
decision-making and dispensing with the conventional canvas support, both LeWitt
and Palermo, using different means, established an interdependent relationship between
exhibition space and exhibited work of art.
Sol LeWitt is a centripetal figure whose career, crossing the historical threshold from
Minimalism to Conceptualism in the latter half of the 19605, ushered in a new era ot'
Anna Hammer
NDKSS
With thanks in Tamara lalanieh for her initial 9- ln "Artists on Their Art," Arr Intsrnatiumzl 10, The beg111111nyenne|11d1ng dale, nary
eaiibrial ei1n1n1enn_ 1e,n<>.4l/lpr1le11,1ass):§;, according lo the year 111 which Kawara began
lo. See Richard S, Field, el al., Mel Boehner: work on a particular edition. One1'v1vlImn
1. See the discussion of LeWirl's collection Though: Made Visible 1966-1973 (New Haven: Years-Puri exisls ln rwelve editions while
by Andrea Miller-Keller in this volume. Yale University Art Gallery c. 1995), edirlol-ls of Une Mxllmn Yellrs»Flmm' are silll
1. By virrne of his famed “Paragraphs on \\. Mel Bochner. ln “Mel Boehner," Dum 2, in progress, about n1ne having been completed
Onnceptual Art" (1967) and “Sentences on no. i<l=ebrnary197e>1n4_ to date.
Conceptual An" (1969), Lewin has been given 12. Ibid. 11. ln the may series,Kawara1s nni hound
credir for launching the term “c11neepn1al.” 13. Mel Boehner, conversation with the author, bv a system uf production, painting one or
new applied re. a wide range of aeaihetie November 1gq;, several pa1n1111gr an some days or nnne bn
production initiated in the second half of the 14, lvlel Boehner. ~‘serial11y and l>he»1ngraphv." rnher dave.
19s°a. Both lexrs are reprinted in the Appendix catalogue sratemem in Av! in Series, Finch 22. See Bruce Boise, [Alighiero e Boel\l],
in this earalb511e_ cnuege li/l11ee111n, 1967; repnniea in Mel Borhner A1rfb1nm11.nn.1nllnne 1973); s3_
3. Sol Lewin, “Paragraphs on Conceptual (Rio de Ianeim: Centro Arte Hélio Oiiielca, 23, Dan Graharn,“l~lerr1ee for America."
Arr" (19s7).q11n1ea from Alicia Legg, e1 al.. 1999), P. 54. Boehner enlieel his review of /me Magneme 41, ne. 3 lneeernberelannary
Sal L¢VWr1 (New York: The Museum of Lew1n'1 Dwan Gallery e11h1b111r111 saying: 1~;6&67): 21-zz.
Modem Arr,197B)1p. ies. "The indicated sum ofthese simple series is 24. Sol l,e\'Virr, ln Legg, Sol LEVWH. p. 130.
4. snl lewin. in l.egg.s11l Lemrr, 11. 51. 1rrea11e1ble enrnpleniy _.,_ They aeinnna" mm
s. According 111 hewitt in ennvereannn Magazine 40, nn. 4 lsepiernbereoeinber 19rb|=
1 November 1999, he raw rhie work 1n navina bil. Furthermore, in “The Serial Attitude”
atndib as well as ar the Green Gallery in 1464. <A7.~/11711111 5, nn. 4 [December 19571; z&33).
Fur an iu11111ari¢1n,aee 115.4 in Martin he discusses preeeelenrr for, and examples on
rrieiin1an‘a emay. a range nr serial nieihniie being used a1 ihe
6. Sol Levlhn, "Serial Proieet ri," Aspen time in an and music.
Magazine section 17, nos, 5-b (Pall-winter 1;.A1lr1a11 Piper, 011 0/Order, oar rfsighr
1967): 1-rp. lreprimed in die Appendix in (Cambridge, Mass.: MIT Press, 1996), 1:4.
rhis czralogue). 1is_lbi11.,p,;.
7. Qninea in *D1111 1111141 An Interview with 17.lbia.,p.19_
lohn ceplane" nan /add (Pasadena: Pasadena 11. lbid.
An M1|seum,1971),p. 41. 19, lbia., p. 141.
B. Quoted in Eva Keller,"l. Konstruknonen
1966/b7f Hanne narberen lsaaeli Kunslhalle
Basel, 1991), p. 3 lrranelaeed by l-lbrai Schasrok).
_ l
~l_"l
1-
_,_
‘ -_.=:=::::=:;;:.1€>
::¢!!se.s1e:h&
1
.=_gi
7IIf\]7»¥{¥L.7!.JH.-1.1:,‘..'.
-"‘“'._¢
%;=
1' ,213
H41
'l
L;1I‘¥*I =l`.'iJl‘I=l!1.}=\ '= ' -1
- _Z1| 1T 3iv
|
L--___,
i- _' DISC?
' nn gsm- 3111,
'ii 2| li*
I |»1'P..'=»L-n|--|1|.\|-.-
1-1_1511n|sc1
£2 51%
T-'_; 2?
11 MUSICIN
Muslcm 12
g
'%-»_' -1:1
musmm 11 Pnnrs-Pnnr1 1s;on i-*Tj
Musnc 1mj_"12
21Pnnrs»Pnn13
Musncm 12 Pnnrs-Pnmz
11 Pnnrsvnnrs
mns-Pnlue
151211
41 Muslc m 11 PARTSPART4 21:02
14:34
16:57
15:50
2- ii*-1.,
;.. _ »
_€'1@
,I lg.;
l.
'11 _I_fu
I n
2-
5- _,
<
INIZmsc; _,_ _ ,
in
li -u=-£1
1 1,14|31rv|us|c|N1zm1rs-Pnnrv
Mus|c|N12PAR15-Pants 1a=17 21:12-_'*-‘“.
11.-.v
J_I1-=-¥ *ii
11 MUSIC PARIS-mare 14=-as gg
1- V --1 __ .
1 ’ -V ~ 11 zxmuslc |N12PAn1s-PART 10 11:14 |151
1 - * 3| Musncm 12 PAn1sYPAm ll 14:35 1-4 4
-.*_4' -171
4 lid
_ I “
l_3Ii.IL-_
=_ 4| Mus|c|N1zPAn1s-PAnT1z 1s=z3 _1l'
_
1; ='.-"E
_ _ __-n Z-;€
£13
l- *_ '
1`\.,.~ “,,_. M. \,.,,,\< .,, V ,.,, ~,.»,"” ...D ” 1 .1 1, 7Q_
_ = U.W\W,.,~,1.,\,[,..»~M,1. t
1
_|_¢=
<.»u1 l
l_
-J
=
=7.1
-
-1I
1 _,E
'*'*"'-S1
-1'“*"‘
Q:
-
'i-5
...l
1-_
_-_
ini
.1
1
Q -
ill'-
l.`=
_‘Z
i li'
_
ix
.
ia
.1'=
li
11;
{
31. g _.E
1 1.
`__Q 1"'£"-
1;
\ _1 :_-""’°‘ 4
"€1»1é»'=
~ - ~ .___--""
22
.___
'l__
-;u_*`*
- -*_* = JN IINH HHH --=“=
1 fl ‘ .‘ `!;*. . 1 ’
71 _...__
ii - _.,v¢,_€y=;.=:=:<§....
, 1 : ‘ 12- ,_(__7-7,
1 '_"' 1;
111-1-.1~|\1»-1:21.15
-1, 1
vAR|EY|Es or INFLUENCE! SOL LEWITT AND THE ARTS COMMUNITY
Andrea Miller-Keller
With all the recognition that he has received, people still don’1 get how important he ts.
Solis to art what Bach was to music. - Adrian Piper, 1999'
Sol has been the greatest example ofan artist able tu keep moving while staying one
hundred percent true tu l1in1seM - Chuck Close, 1999*
Sol LeWitt's influence in the world of contemporary art during the past three decades has
been broad and deep. Many artists have drawn inspiration from his ideas about making
art, the aesthetics ofhis strategies, and his inclination to engage the architecture ofa site.
His early statements on Conceptual art have become classics in the literature of twentieth
century art history. lt is a compliment to LeWitt that, although minor copyists dot the
landscape, the several generations of artists who most readily acknowledge his influence
make works of art that pay little or no visual homage to LeWitt's art. While his own work
has remained almost exclusively abstract,” the artists LeWitt has influenced are remarkably
diverse and include many whose works are representational.
LeWitt’s greatest impact on younger artists has come from the extraordinary ways in
which he has managed to merge those two traditionally dichotomous titans, form and
content. Most influential in this regard has been LeWitt’s focus on the abstract art object
as a carrier of ideas rather than as a formal, seltireferential entity.‘ His bold wall drawings
and extensive sculptural permutations that self-confidently take command of entire
spaces have encouraged other artists to think more expansively (see pl. 118). As important
to many artists has been his richly generative, almost narrative, deployment of individual
units in a way that abandoned traditional compositional hierarchies, More subtle and less
fully documented are the myriad ways in which LeWitt’s regard for other artists (young
and old, successful and unrecognized), his collecting practices, and his professional
methodologies have influenced not only artists but also curators, art historians, dealers,
and collectors.
¥__` v
.
V \»
‘lc"s ~4 i .
~ '~ , Q
sis , '
Adrian Piper considers LeWitt the individual most responsible for restoring content
to art through his insistence on privileging ideas. "Sol is the person who decisively broke
through the knee-jerk, cartoon-Kantian critical response: `l'm a sensitive arty person.
I just feel things' Sol restored the value and the utility ofthe intellect to the visual arts
better and more emphatically than did Duchamp by making a system central to the con
ception ofa work and the procedure hy which it is realized." For Piper, LeWitt introduced
a whole new sensibility and reunited the experience of intellectual complexity with that
of strong visual nrtentatrnitf
I.cW1tt`s use of modular units and serial systems along with the expanding scale of
his wall drawings helped to inspire lennifer Bartlett`s epic Rllapsvdy,1975-76 (fig 34).
However, Bartlett takes the lessons learned from LeWitt on a very wild ride. Rhapsody,
more than iso feet long and constructed of 988 individual one»foot-square units, is an
exuberant and unruly exposition on the basic elements of painting and the nature of
originality. She explores aspects of line, shape, scale, color, and four basic figurative
images (mountain, house, tree, and ocean). Despite Bartlett`s decidedly non-hierarchical
lorward march, numerous passages evoke (in part, by chance) familiar art historical styles
from Seurat to Twonthly, and, ofcourse, LeWitt, W`hat initially purports to be methodical
and classical evolves into an idiosyncratic, bombastic triumph uf intellect and humor.
4 A ti smite me
||A. n.Q,1 U:“Ihh
1» `~dl:
an~1|| nu
.t trll I...
_ _ -`... 1n »ni|,|u|'=l::'“||'
_ _ _ _ .=,u_~‘_
~| t_|
HHH
HHH
HHHHH
mi _lnlllla-I
LH;-Q_._¢ ;.¢ `_. `,, i____
no as sannv smnftri me H0155 W Sandy Skoglund found certain c\\11eep\u.1l>lru\eg1es uxeful elirh in her dimer, In I/11'
5 sa/rm cfmef, 1914 r1@¢1mqfap~1<
Holes in la Sultirze (jrllclwr. 1974, she photocopied <1 mltine .ind tl1e11 rep|\o1ne<»pied 1h_11
|7V1r1t CUHECUOV1 M1719 srt1S\
image and .tll suhwquenl inugw l77\1111e\) untll\he>\1btle.111eehr1111c.1lshi|`t>111ude1n
rig 35 Jw-acne" sumvw crmfmq positioning by lhe copier moved lhe inuge ol' lhc emeker o|T1hepr1gc rtigqsb..-\ltl1\\l1g|1
ffm 1101/111/1111, begun was sigma
meets U1 new an new ccrierrmn she eventually changed course, Skoglund ~e1y> sl1e"1111u.\ll\' tound 1h1~ work re\\'.1rd|11g
nv me arm, it was very cerebral. Ohse>>ion and repetition in theproee<<oi'111_\lti11glhi11g\i»o11e
constant element in my wurkf” Le\\'in`> i11cre.1>1ng|\ r1»er\1\¢ use ofthe w_1|l und
sometimes all of the walls) d1rectl1'po111ted \he w.11' to "111>t.1||.1t|\\11 .\rt."Skog|1111d, who
worked on .1 I_e\'\/itt wall dr.1w111g 111 1976, l.\|er o|1»e1\'ctl: "The et\11\e111por.1ry impulse
to work directly on the w.1llof1he e\l1ihilion ~1te1>, I \1el1e\'e,h.1~c1lo11.1he|gh1e11ed
awurenesx ofthe relationship hetween the 1111.\ge .ind ils p|.\ee. \\'her1 the inmge 1> milh'
an idea or eu11cep1,.1» 111 Sol l.eWi11\ w<»rk,1hen the \\‘.1|l workx .\>.1>url1\ee,.\llowi11g
the idea \ooverc<\111e lhe 1n.1leri.\l1\y."" (Hulitlredx of rirtista, including, Skoglund, h_1\e
worked on l,e\'\/i11'» w.1|| dr.1wi11g i11s\.\|lr1\1t111»."`l
lonr1\h<111 liorol$l<y'» (,`11m1/111g/111111 1 lo In/l11111',l1eg\111 1909 ll1g_;6),1eA\\1re> an .iccu
n1ul.\l1ng mick nl X '/1 x 11»||1eh sl1eet>ofpl1pero11 whwh \he r1r\1\\ 1~ \\'r1\111g11\1111l1e1x
in se4|ue11ce,wh1eh he hegrm by e111p|oy111g "Nat pe11,pe11cil.intlp‘1pe1...,\11d\1>i|1g\he
111111d.,.loexerc1>e d.1ily."" lhxrtvtiskfs co\111t111g began .\> .in imenl1o11.\l hre.\l< lor his
thought |1roces5c>,.1nd even inside the res\r1c\1o11~ ol lhis very l1ne.1r .ind \'erye<\11eep\\\.\l
S013 work and my work a/'tltis ltitnl were very irdluenced by our readings ofSarnuel
Beckett. Berkett...lms this very interesting way of draining external references frnm
it sittlatiun, by listing the permutations, listing the variatians, in how a character in
one ufltts early novels can behave. He achieves in that way a kind a/existential clarity
becuase one is confronted only by the situation in a senti-meaningless form. But of
riq 37 Jann simon, Jr, every/nw, i995 course the meaning ofthe situation is simply the situation itseM It has nothing external
sonware, Annie Powertmot no courtesy
of me artist ami ssnara cerinq osueiy tn ir. Sa that would lie mmrherform of the permutational conceptual strategy that
New vom Sol was using. 'i
.lQt lIl
hundred trillion years for the grid to become totally black (the
last "icon" that the applet is programmed to exhibit). Simons says,
"Because there`s no word for that amount of time and no word
5:
A
+ii l
“iiiEEEiE!.i5EiEiEEEEEEEEEEEPE of making you think about a very long time," "
The radical precedent of visual artists such as LeWitt, Hanne
Darbnven, Mel Boehner, and Douglas Heubler employing self
-:t|.:::::=.':::::::::=:::=:..:i: consistent mathematical systems in their work has been important to
"'::::::::::=:::::==:::::!="" Simon. Nonetheless he sees an important distinction between their
preference for systems that they could see through to completion
..:::::::::=:a:=:":::=. and his own work which, in direct response to the vast capacities of
~‘ 1
the computer, works with ideas that play themselves out on a scale
no Ucon.
l i efv E* 1 rv ~' §ui~»1~»» 2 vi1~ '-sz: i
‘ r<.,;~=‘ 'i. if. 1;:_o:
of time that exceeds even our imagination. ‘S
l.eWitt`s work has often been thought to be exclusively cerebral,
and the artist to be the ur-rationalist of his era, despite his own
4r 1 s Miner mer
Q(
_v _
___ .-»_ _
l
\
‘/
‘‘l
y,
from as Jann aalasmn, statements to the contrary l"(Ionceptual art doesn't really have much to tlo with mathe
sa/aesssn slag; tewln, ova
\/.neo courtesy ot me \/.aw matics, philosophy, or any other mental discipline." ‘”> l,e\\'nt\ preset systems, along wnh
nate asm., cm<sq<> the dominance of straight edges, right angles, arcs, and geometric tigures, haie sometimes
more 39 on Hoaqes, nl/ mn,
distracted viewers trom discerning the sense of plat' that ripples through his art. As this
|995 Pre-soetenea canvases retrospective confirms, his teuvre includes humor and flirtatlons with the ahsurd. Sherrie
Courtesy ot me .arm and cm;
Levine is one of many artists who "grew to appreciate l,e\’\`1tt`s light touch...the playful
Gallery New vom
ness of systems that go nowhere." " Iohn Baldessari paid early trihute to l_e\\'itt's ideas
and sense of humor in Bfxltiessnri Sings I.e\Vin, 1973, a twelve-minute videotape in which
Baldessari sings (flatly) each of LeWitt`s "Sentences on (Ionceptual .-\rt" to the accompa
niment of snippets from familiar folk songs and show tunes lfig. 3R].
lim Hodges describes his relationship with Lewitt lwhoni he has neier nietl as one
of"ideas and casual fun...sort of like a square dance, with changing partners." Hodges
tlrst encountered "the idiosyncrasies andthe kookiness of I e\\`nt" at Ie\\'m's rugs print
retrospective at The Museum of Modern ,~\rt: "l t'elt a kinship with him andthe profound
humanness ofhis work. It was not as cool and analytical as l had previously thought."
Intrigued hy "how LeWitt,1n usmg the wall as a ground, uses architecture as a material...
[and takes] architecture to make a painting," “ Hodges created the esact opposite at
the Center for Curatorial Studies at Bard College (Annandale-on-Hudson, New York),
near at long-term installation ot'5ol le\\.’itt's \\l1lI llmwing 2475, igtto, a \\orl< teaturing
color ink-wash pyramids. Hodges's lil] Tllen. 1995, is a to x to x 14-loot freestanding
room with portals, built out ot |34 stretched canvases tlig, 391.
It is worth acknowledging that l.e\\/itt has helped to redeline and expand what we
understand heautv can he. He suggested in his |967 "I’aragraphs on Conceptual Art"
that "what the work ol .tri looks like isn`t too nnport.n1\" and that "Conceptual art is
made to engage the mind ol' the viewer rather than his eve or emotions." "' However,
Louise Lawler suggests that "1.eWitt was always very generousmevervone was welcome
at the table ,... He consistently offers the viewer pleasure and beauty, and opens up
these possibilities for others." L" Chuck Close notes: "Sol l.e\\'1tt’s work is always so
V J
"Vin always surprised," says Byron Kim,"how beautiful his work
is. l think it is more than that the system he devises is inherently
right and beautiful, and that it therefore produces a beautiful work.
lt`s because he has a great touch and a great eye .... And this is
,,I
where he has influenced me the must directly .... There is some
"39é"¢?5"¢i£~"£€"` ' f. iirriira
‘ 5, et “
thing about getting the idea and figuring out exactly how it will
5Q
TQ’ . I ~ . .kia
iii lflilirmd ¢i_‘1‘t§l1r‘ r i`?i‘i`3
K E 1* 41 . ,_ _
new arf form ._.. But must important to nie is the ravishing beauty
which Sol so often attains in these works." “
"I have always loved Sol's work," says Mierle Laderman Ukeles.
~» - =>*i an » - sssss '- ~ an artist whose own art has engaged personal and civic responsibility
oI .ita1»f~»
§ea;*=aka_n=a§fE => '- ¢ 'r 'fd' 'ITM
lfig. aol. "lt is 'lalmud\c4that is, obsessed with trying to think
things through. He has spent his whole life trying to think clearly,
at' FlNP¥,¥'!‘
ha’ Q; ~=';,.
Fm, .H‘_Ie~_ as a visual philosopher. There`s clarity and honesty, a democratic
openness in his work .... His large wall drawings may he detached
from his hands, but they are plugged into his heart." 2*
ri r » liar
You seem the same as always, and beingyou, hate every minute ofit. Don’t! Learn to
say “Fuck You” to the world once in a while. You have every right lo. lust stop thinking
worrying, looking over your shoulden wondering, doubting, fearing, hurting, hoping
for some easy way out, struggling, gasping, confusing, itching, scratching, mumbling,
bumbling, grumbling, humbling, stumbling, rumbling, rambling, gambling, tumbling,
stumbling, scrambling, hitching, hatching, bitching, moaning, groaning, honing, boning,
horse-shitting, hair-splitting, nit-picking, piss-trickling, nose-sticking, ass-gouging,
eyeball-poking,finger-pointing, alleyway-sneaking, long waiting, small stepping,
evil-eying, back-scratching, searching, perching, besrnitching, grinding grinding
grinding away ot yoursebf Stop it and just no,
From your description, andfrom what I know ofyour previous work and your
ability the work you are doing sounds very good. “Drawings-clean-clear but crazy
like machines, largen bolden real nonsense.” That sounds wonderful-real nonsense.
Do more, More nonsensical more crazy more machines, more breasts, penises, cunts,
whatever-make them abound with nonsense. Try and tickle something inside you,
your “weird humor” You belong in the most secret part ofyou. Don’t worry about cool,
make your own uncool. Make your own, your own world. Ifyou fean make it workfor
you-draw and paint yourfear and anxiety And stop worrying about big, deep things
such as “to decide on a purpose and way of Me, a consistent approach to even some
impossible end or even an imagined end." Mm must practice being stupid, dumb,
unthinking, empty Then you will be able to vol I have much confidence in you and
even though you are tofmenting yourself the work you do is very good. Try to do some
BAD work. The worst you can think ofand see what happens but mainly relax and let
everything go to hell. Mm are not responsible for the world-you are only responsible
for your work, so do it. And don’t think that your work has to conform lo any idea or
flavor It can be anything you want it to be. But 1/'We would be easierfor you #you
stopped working then stop. Don’tpunish yoursebf Howeven I think that it is so deeply
engrained in you that it would be easier to Do. 1”
This letter, a deeply caring vote of confidence and kick-in-the-pants (the repeated
word “DO” is drawn large and decorated), has been music to the ears of several generations
of young women artists since it was tirst published in 1976.l" lanine Antoni, for instance,
who does not see a particular connection between her work and LeWitt`s, shares this text
with all of her young women students and assistants.”
,,,1,;_,
1»,, 111
~11111¢1111-1111";;1.1111i1}11}11~1|v"111i\11¢1\111\¢111<111r11g¢11h¢ 1 I lv i
I ¢\\'111. H1- 1'u~p11111|1~1| \\11|1 11 <.1\11|11g11u\1y 111.111, 1hc11 111.11l¢11\111d111\1111,.111dg.1\u her
111 mm 11.11¢11111 ~ 1111111~111 11111
Professional Stance
As influential as LeWitt`s work, ideas, and quiet generosity have been for several generations
of practitioners, it may be that his methodology as an artist has had an equal impact.
Byron Kim, more than thirty years I,eWitt's junior, suggests, "I think that a lot of artists
unknowingly owe Sol a lot, The reason we are unknuwing, I think, is that he has influenced
our modus operandi more than the actual things we make." '” Chuck Close aptly says.
"Sol really knows how to be an artist. He wears being an artist like a fine suit of clothes.""
LeWitt has taken an active role in introducing dealers to the work of other artists,
something both frequently remember with gratitude. A number of now-prominent
A s as miie neue
~s
~ ` I°T®
l,.§?lR
rf
[gl
M*
M
A
` V@ 'D~»;m>
32
`l` N;tE'£§§EcuJn`r§$1£tl_';\4\11l0
§l|`U`|l`K Fun
:Zi/wggltfafi
~';.zQ-`»-’\_"§,
f"?5'l7?"‘2Ye.`;,,,>7§_‘
>,§¥1§.,»,$¢;\,`;` .< ~<<
Q'-` /;L`\ = 5,15 111-iam
§ ‘ws
"Wifi '-)i~-i#z’5%?`Y£ 1* ' "' Q ‘il/'\ =
-iw wi;
zyifés. . ;.:2»; ;;\Q ‘‘ \-Q
{~;§¢~<'<%l
.
uf. » eg,
4 55;-., m
sf ~L <5
" ~>,
' 1 ‘ A7
QOQe
l
, *lcv/r-ey' `\§~»;»,;,; ~= im » _- _ 4_\.?
|félT“l"' `1 g¢55,5 `~‘v»_5»~
Ig*
" 1, ., A f~\ .. ,f Q 7‘¢_g¢»
» ft, Qi
5. rx; _
1
fm "5
‘”
3
ny ,->.,;,» ~, -A, N;-r:-s.§§,H_\;YQ52 . £6 f- _ 1- _
~~“=¢l“'l A- ~>~ 1* - '
K \.,>\f.s ww \lf>'»¢,~$,~4<‘*,=_va~\*f~, nf. .¥\e~~ i P /'9‘( ~\\f` I Q, _
j§;ei\la*S‘
54.'H>??%`ff»‘»<f;¢mi
iE\f"§-'%5Fe%"§‘* @;¢;f5‘r='ffQ&{f»ri§~§§‘§ Hall l,)=g§¥,£*i=<'T ""
nq az Sol tewin umm 0/r/0/we and unencumbered. "` He ndanmntly refuses to he thc signilier nl' his \\'orl<, lie shows
P 609.1976 Cu! /HAD and ink
Lewin colimron
up at his openings reluctantly and ns late as pnssihle. Chuck Lilnse, who Ihr nuny years
wanted LeWm to be the subyecr Mun: of his mnvnumenml piurtrrms, has wrnu to respeci
his friends position .md nu lungcr uwnsiders surh tx request .\pprupr1atc. "
Like nuny artisls, l.cWi\t is consistently generous lu .\r\ .iutnnns #br causes he supports,
sometimes lwlh giving n wnrk for auction [\\‘nhnn\ selling .\ reserve) and purchasing
work hy Another artist at the same .\\|c\mn. lie wiis .\ c\\l`\\undcr nt' Printed Mutter. the
Gm distrihulnrul`nr\|sts'l1m»k~ in thus u\\n1\ry."Un se\cr.1l\\cc.zsi\\m when Primcd
Matter has fnlteretl, he and A|\drmti<> I e\\'i\\ stepped in to help ensure its sur\'i\'i\l.
I,eWi\\`s presence .is .\ nun nl principle in the tirtistit tomn1un|\y has been meaningful
tn nmny. "Sul was thc mnr.i| center ul lhc group," rcmlls r\dri.\n Piper, Q' referring to the
innov;\\i\'c and polltieally astute downtown cmnrnunily nl' thc late 1960s ihtxt included
Lucy Lippnrd, Robert Ryman, Hans .ind Linda Himckc, (hrl Andre, Dornlhen R\>ckh\|rne,
Mel Bnchner, Sylvm and Robert Mangold, Dan (iriilmvn, and o\l\crs. Although [,eWit\ has
Epilogue
Mitchell Algus, an art dealer and science teacher, encapsulates LeWitt`s far-reaching
impact on the art and the art world of our time saying: "Sol is the contrarian paradigm
of the successful artist. Alert, yet retiring. Responsive to other artists, yet utterly focused
within his own work. This engagement is manifest in the selflessness of his worl<`s
execution. He is a mysteriously benign presence, odd for an artist who is so rigorous
in his work. This magnanimity gives his art a moral presence, one which is deeply
humanitarian." 5° As a pioneer and inventor, Sol LeWitt`s redetinitions ofthe practice
of art have contributed to many ofthe major changes that characterize the landscape
of art history at the beginning of the twenty-first century
1, Adnan Piper. eunyersarion w11h au1hur, 17. sherne Levine,conversat1on wi111 author. LeWitt is widely respected for her sensitivity
io 1v1are11 1199. 11 February 11111. to the needs of artists and the nonprofit
1, 01111111 Close,conversat1nn w11h au111o1, 1a_ lim Hodges, conversation w1111 author, 11 institutions that suppon them. She has brought
18 Murclt \999. April 1999, her energy and talents to many projects, from
1, Exceptions 111 Lewirvs al1s1ra11111n have 19. "Paragraphs on Conceptual Art," quoted Printed 1/laner in New York city to rhe revirale
frorn Legg. Sol Lawn, pp. issoa ization ot' Main Street in Chester, Connecticutr
occurred 1nus1ly1n his ar11s1s'l1ouks,sorne of
zo, Louise Lawler. conversation with authori and as an active trustee at the Wadsworth
whi111 are eoniposed ufph11111graph11 unages
11 March 1999 Atheneum, Hartford (1993-99). In 1980,
(pl. 34912)
1:1 wanted 111 ge1 as far away from non 11. Close, 18 March 1999. Androeeio Lewin oo-founded Ceramica. an
ludd's ‘spe1in1 objects' as pustible"(LeWitt1 11, Byron 1<in1, correspondence wirh author, importing Grm that mitially specialiaed in
eonversarion wnh au1h11r,1 Nove111l1er 19191, as February 1999. reviving traditional ceramics from oeruia, italy.
1. sol LeWitt, " Paragraphs nn Conceptual 11. carl Andre, correspondence with author, 11. The collection includes i1npor1an1 works
Art" 111691. quoted froni “wr11111g1 of sol lo lune 1931. by Hanne Darboven, lan n111l1eLs,1~1ans 1-laaeke,
LeWitt," in A11e1a Legg, e1 al., sol LeW1!t <New 24, Mierle Laderman Ukeles, conversation Eva Hesse, Donald lt.\dd,Anish K.-spoon Richard
York; The is/1useu111 of 11111dern Art, 197111, p. isa wnh au1l1or. 11 1s»1ar111 1999, Long, Adrian Piper, 1>a1 Steir, and many o111ers_
(reprinted in the Appendix in 1h1s catalogue). 25. See Adachlara Zevl, ed., Sul L¢Wir|: 111. John Paoleni. e1 al., N11 mu; The
s. ~' Paragraphs on Conceptual Arr," ouored Cruiral Tern ilzornes L1l1ri de A1;1u11,1og;l; Cnllemnn of Sol LeVW!T (Middletown, Conn;
from Legg,SolLeW1t1, p. 1111, as well as in Legg, sol Letwn, pp. 1ss~74: Wesleyan University Art Gallery and Davidson
7. Piper. in March 1991. and 1111 Appendur tn this catalogue. Art Center. 1981).
a. carol s11u1er1, “Fn1er1ainrnen1 and ao. Annette Lemieux, correspondence with 17. lady zellen, correspondence w11h Lewin.
u1s1re1s," tn sandy skngiunds lreahry Under au111or, 1.11une 1991, 11 May 1999. Other students in the seminar
siege; A Rcrrosperttve (New York: 1-larry N. 17.1n Legg, sn1L111a11_p, 111. included artist Renée Green and lohn Ravenaly
Abrams, 1998), p. 29. 11, Luey 11, Lippard, Eva Hesse (New York: currently eurann of 1wen1ie1heeen1nry an a1
9. Sandy Skoglund, correspondence wi1h New York University Press. 19711, p. 15 rhe Virginia Museurn of Fine Ar1s.
auth<1r,1o 1/lay 19111. 19, 1l11d. 11. This was the Erst long-1er1n installation of
io. others inelude Daniel lauren, charlie 111. According 111 Byron 1<1n1 lin 1<1111, as c11111ep111a_l art in a United States museum. 11
Clough, Ronnie Cutrone, Peggy cyphers, Allan February 19991. included work by Eleanor Antin, Mel Boehner,
Davies. 1>1e1 u1r1o1, Herbert Disrel, 1<a1uk11 11, Lewin lnrnself recalls a 111111 when, in the Dan Graham, Dorothea Rocltburne, Bd Rusclta,
lvliyarnoru, A/lar1ha Keller, Christian iviarelay early 1~1o11s, new 111 New York and having quit Eve Sonneman, and others.
Man 1/111Ll11an. saul osuow. Luea Paneraazi. his 11111 in order 1o he a full-11n1e art1st,he was 31. 1<irn,a1 February 1919.
Adrian Piper, '1-r1s1ano 1zol111an1, Ulrich fuundertng a bu. not rnaking art. 1-le o11asi11n 40. Andrea Miller-Keller and lohn Ravenal.
lmuekriern, An11111ny sansona, Marien sehou1en, ally went to the Cedar Bar “to meet artists ..., From the Collection of Sol lellhrt (New Yorlc
Peter Shelton, carey s1n1111, Pat s1e1r, Tony However, 1 was 11111 s11y to talk with anybody Independent Curators Incorporated, 1gB4)_
Tasser, nayid Trernlen, Pe1er wane, and but I saw them." He recalls with gratitude that At. The l.1cWitt Collection also inspired a
lames welling, Earl Kerkham, an artist who had studied with number of small one-person exhibitions in the
11,1viar11 Rosenthal and kiehard Marshall, laeques Villon in Paris and who knew his way Atheneum’s M/1T1t1X program: Eleanor Antin,
/1111111111111 lznynplry (New York. Harry N. Alsrarns, around 111e New York an world, approached Ida Applebroog,la11 1-1arni|1on Finlay lee
|9501 P. 33 the lone artist, visited his studio, and opened Louno, and Sylvia Mangold. aspeeially over
11. lhid, doors for htm at the Stable Gallery (which 1111 past decade. easy access ro 1111 eolleennn
11, Adnan 1>1per,“><enuphn11ia and the kept LeW1tt`s work for six months but did not has allowed the Atheneum to enrich the long
1nde1111a1 1>res1n1 111 Lecture." 011111011/en s1111w 111 (LeW|tt,conversat1on wi1h author, is term installations drawn trorn its pern1anen1
0111 1ys1g111 icarnlnridge, 111as1,1 11111 Press, March 19991. collection. Most ofthe 1we111y e1111il1i1ions
199111. 1 111 11. un111d s1a1rs taxIaws,wl11ch permit visual drawn pnniarily from 1111 Lewin colleenon,
11 Matthew M1rapaul,"ln l<1hn s11n11n's Arr, artists tn deduct only the cost ofthe materials bnth general and thematic, bear the imprint ol'
nv1ry1111ng 1s 1>oss111le,"N1»w vnyk Tino, 17 April for 111111 own works nr work they have aequired young curators committed to the use ofthe
\997 hy trade, discouraged Lewin frorn nraking 1111 Lewnr c11llee1i11n1 Ann lxuekley, 1o11n lzavenal,
1s.|o11n s111111n.1r.,111nversa1111n wnh author, gift at any earlier date laner Passehl. laekie 1»1a1_Allis1er. 1<1n1 Davenport.
11 1/larch 11111 A working version 11fs1rn11n's 11. Glass quoted in The Portraits speak: and iarnas lzondeau 1>ul>|i1 edueanon prograrns,
Every 111111 has h11n implemented as a lava Chuflt Clasei11Cm1versati1m with 27 o/Hts including extensive doeen1 rraining. numerous
applet and 1sl1»1a1ed al fvrry iron. other subyerrs (New York: A.R.'l` Press,1997)»P. ga. gallery talks, and lectures, have always aeeorn
11er1i11n1 1an be found on simnns hnrne page sa. car11lAndro11111 Lewin now performs a panied the 1ollee1ion’s use. 1/lost signiiieanuy
and s111d1u1n.an online an gallery sp11ns11r1d role equal to her husbands tn their collecting the LeWitt Collection, despite the sophisticated
hy 1>1a csnier for ihe Arts. Go 1111 de11s111ns_ For several years she was an assistant challenge of its content, has become a user
inynnnumeral 111n1, to Brice Marden and Chuck Close, who calls friendly experience for Atheneum visitors,
11. “ Paragraphs on Conceptual Ar1;'11u1111d her, categorically, "thc single nrosr sornpe1e111 The collection has lung since grown beyond
1111111 Legg,S11lLeV1ht1.p,166, person l`ve ever met." She also worked for the rnuseum`s Capacity tu care for and store it.
Robert Feldman at Parasol Press. Androccio The LeWitts recently renovated an abandoned
andyea Milrer-Keller
factory near their art-lilled home in Chester. 49. He has been ahle ro maintain rhn rnaee ea. "1 do rnn make nrt nr change ninety. lil
cernieetienl. where most ofthe later acquisitions pendence tae well as his extensive schedule wanted to do this l would make different kinds
are stored. They have aien placed a number oftravel and praierr dearilineel with the able nf art" (in Andrea Miller-Keller, "Excerpts from
of works on langerenn loan to colleges and help ofSusanna Singer. his assistant since rata. a Cnrreepnndenee, \y8lfl9B},"Snll.¢'Wx1l will
universities throughout the Northeast. Fnnenhning as an nannniarrnnrr and reigning Dmwmgs i963-|984 [An\s\erdam: Sredelllk
42. l<irn. is February rage. L:Wilt historian. Singer coordinates all installa Mnrenni, nasal, p. zzl,
43. close. is March im. tions and commissions. She was also the editor Se. Glenn Ligan, correspondence with ainhrrr
44. Max Protetch. conversation with author, ofthe three catalogues raieannee of lewine 19 lune lqgg.
els April 1999; and correspondence with author, wall arawinga. in lewin, conversation wirh author, i7 lune
17 Mly 1999. 50. "I am not Rock Hudson," he once im. This prere was nrheeqnenrly pnrrhaserl hy
as. Nicholas largdail, correspondence with explained to an approaching newspaper the cilyofHamhurgfA1nrna.
author, Jn lune 1999. photographer as he quickly covered his free. 57. /‘ts quoted ln Andrea Miller-Keller, Glenn
46. In 1996, in gratitude for LeWitt's frequent This occurred at the Wadsworth Atheneum Lrgnn/.warnlx ire lnarrrnrrlr Wadsworth
support. lnng-rirne New York dealer lnlian prior tothe opening ofSalLeWl11 wall Alheneum. l99zl. p. l.
Pretro bequeathed his personal collection to Drawings, rees-rear. Thc phaingrapher war ia. Susanna singer, enrreeparnienre with
the Wadsworth Alheneum, including works by documenting the installation for a Narrhmrx author, 7 luly 1999.
Carl Andre. l0hn Baldessari, Robert Barry, Magazine cnver story. Lewin ie more relaxed re. lnfnrrnea alrhe sponsorship just shortly
louise Lawler. Allan McCollum, Eve Sonneman. with cameras in a fannly context. before the exhibition opened, Haackc chose not
and others. gr. Close, in March rang. lo undermine the curatorial effort by withdraw
47. For ineranre, Lewin would send ink Sr. The other cofounders were Carl Andre. ing his work. Instead, he asked that a stalemenr
drawings on postcards of portraits to Chuck Edit eiertk, Lucy Lrppard, walter Robinson. of protest be plaeeal nerr tn his prere.
clnee and on postcards of flowers and gardens Pat Stelr, Irena von Zahn, Mlmi Wheeler, and ea. Mitchell Algae, correspondence wnh
to Leslie Close. who is well known for her Robin Wllltc. author.11l\me\999»
gardening skills tclaee. is March regal. 53. Piper, ie March lass.
43. lbid.
,nf
SOL LEWITTI THE IDEA, THE WALL DRAWING, AND PUBLIC SPACE
John S. Weber The decisive contribution of Sol l.eWitt’s work to the emergence of Conceptual art is
now self-evident and widely documented. During the igoos and early 1970s, LeWitt`s wall
drawings joined practices such as Happenings, earthworks, installation art, performance,
and the creation of artist-run spaces in dramatically challenging traditional thinking
about the art object and its place in the world. These radical developments were the work
of two generations of artists who sought to redetine the structures of art and rethink
how it could be made, shown, and supported. During the same period, the widespread
founding of civic public art programs devoted specifically to contemporary art testify
to a parallel and related dynamic: the attempt to make art available to a broader public
while supporting the creation of significant works of art by living artists. The relevance
of LeWitt’s wall drawings to that history has remained largely unexamined, but they
derive from the same era and a common set of concerns. lt is time now to consider the
relationship between LeWitt's work and inherited notions ofpublic art, for, in fact,
the two histories have a great deal to say to each other.
Over the past thirty years, government programs of "public art” and “art in public
places" have evolved into a sideshow for downtown real estate development and mass
transit projects, just as direct public support for artists themselves has eroded. Public art
has been defined in most cases simply as the siting of art in a publicly visible location,
regardless of the nature or content of the work itself. Civic, federal, and leveraged corporate
funds used for “percent for art” programs have focused primarily if not exclusively on
commissioning site-specific works or simply buying existing art objects and placing them
somewhere nominally “public.” In some instances, artists have been commissioned to
work on design teams, as in the creation of mass transit facilities, government buildings,
and even police stations. In all cases, the tendency to originate work of a highly permanent
nature has been a potential problem and real stumbling block for a society with little
social consensus concerning what art is, what it is for, who should pay for it, and where
it belongs in public life, The fate of Richard Serra`s Tilted Arc in New York City is but one
example of how this situation can go drastically awry when public art programs try to
commission ambitious works. And when they don`t, even arguably successful public art
programs foster legions of forgettable plop sculptures in urban pedestrian zones and
decoratively abstract paintings that languish in courtroom hallways.
A central problem has been the practical irrevocability of most decisions concerning
the commission and siting of large-scale, site-specific public works, a condition rooted in
ng. 44. so| Lewin, wsu orawmq #530,
1991, Color mu wash, mstanea in me the nature ofthe works themselves. Contractual obligations aside, once they are in place,
nmny ot me Arthur M samer Museum it is seldom feasible to move or reconfigure major sculptures and site-specific works as
Han/am umvemtv. camnnaqe,
Massachusetts. courtesy ol me roqq sites change and opinions evolve. It simply costs too much, and in many cases such works
An Museum. Harvard umversrty an can’t be re-sited without undercutting their aesthetic rationale and meaning. Imagine the
Museums, The Margaret Fisher mm
ana tnmoqn the generosity ol rue seal
consequences if contemporary museums operated under parallel conditions and were
ramuy formation, caerreuna ne Ferrari.
The Hate room1at»an,A.;nes sum ana
oamev senaozm, Peter sonane, and two
Anonymous Donors.
tatéA
tt-
7) ) '*t
|‘¢
l CERTIFICATE l
.si I
‘ mt. .UKK
"tact ma......§.,tr.w.....tta..-at ,p¢*
N ...laanyt>...¢...fa.a.....t....
sm. tt f ..n .. _,
3 ,,
‘ . X d ..;"A°"i:.: . 2: :::=':;t§:.. --- '---)»-3- ll
.t D. ,. c, U... a.....c.Q .
t mn man mi” liilii. mln.. nw,
.\_`_"‘
W. tm ”"" y I <3
l
.2 ,
l 1c.a.<.n... , ... .....,.... f... U.. ..., am... y
..,... ___ ( _
.m..,.w....r ua ...\ ..u.....,..~.,......t....a y
.i aaa...
s.u.~...
Qi WMM/l
effectively restricted in perpetuity from moving major works in and out ot' galleries!
g Af
Yet it is this assumption that dominates public art programs and the artists working with
“till
|DIAGRAM them.’ This leads to a situation of timidity and risk avoidance in the Curation and jurying
of public art, and for good, if lamentable reasons: public art commissioners and juries
}f;i`
have to live with their decisions forever, and they never get to have a new or better idea
about howto use a given site,
The wall drawings of Sol LeWitt offer a strikingly different model of an art structured
,t l .|
to move fluidly from private to public spaces, and to inhabit something we might think
of as zt public domain. Indeed, when LeWitt first began to make wall drawings they were
not intended to be "public art" as the term is described above. Despite this, they constitute
.~%»~
..._\ \/// ,.,V
l
one ofthe most publicly accessible and adaptable formulations of art that has existed
L L_ Q
y.
since the emergence ofthe patronage system of the modern era in the latter halt' of the
nineteenth century.
A brief review of the particular conditions of LeWitt’s wall drawings is a useful starting
. . r,,.. ,,___l
point. Each wall drawing exists first of all as an idea, embodied by set of instructions
written by l.eWitt. See, for example, the instructions for Wall Dmwir1g#366 from 1982:
Black mfs using tht' hriglil ofthe wall ns a mdlus, and black arcs using the midpoints
me 45-Aa snlcewttt w.n/Dniwmq ufllu' wrill its ti mtiius, Tltelm`st1re]illt'd in solid :uid drawn in India ink,
:ues 1982 wma my courtesy at me
artist rim taut tmaqns snow me (Quin
fate ann maqfam rm me watt arawwq Each drawing is also documented by a small diagram which gives a sense of how the
an pany ,msc or its installation ami
~» rtwaafamp me fnmutptan
instructions might be followed (figs. 45-48).
The actual on-site execution of I.eWitt`s wall drawings can be done by LeWitt himself
(although this is now rarely the case). by a team of his trained assistants who travel
around the world on commission, or by teams of artists or others hired locally or recruited
as volunteers to execute drawings for a particular exhibition. LeWitt has conceived several
series of wall drawings specifically to be drawn by nonartists, and has been known to
encourage owners to execute the simpler ones themselves.
J suse
I.uWir1h_\§ <\>mp.\rud I\i» m\uuL1i<»n~ ln .\ m»|»|\.\I Mm .md mm nom! mlm hu hm i
:hu idm\hn1uncw.1||drn\\~i|\g gm ¢>\i>m §um|11_\|\¢\»u\|; m dnmunm I.»h\m\<»n~_` .\|\u
char v:x|1ib\\|un,\|1c dmw1ng> hm lw p.un\L-A mfr ~4» `1» nm n» pn»lncr`\\¢ mu nun-,
\’\`.11l\|m\\mg> Lan be wld .md rcwlnl, .md \hc\ .ncu\\1l||1<‘l\'\|r.\\\n hu c\|1|ln\\<\n \\\\h
.»u\ lwmg pmL\\.\~¢L1,Am1 ..» uk- |~11~\\~..\g_ ,».»~~\|»\v mm hm; m1m\g@\\.\»\.»\m1~(»
Mlllcx-Kcllcu du\i|\;;l|\uc.\rly |9x<»»x\\`\1\c\ dcnr, Iu\\\u l\`\~ nm .\l\».\\~ u»|\»|L|urud lhu
\d¢.|~11>| Im w.\|| dr`\\\~i|\g~ .\» ~ul\iu\ m \|w vmrm.\\ ~\r|\\\uv~ m`pri\.u< u\\n¢r\lup
.f\ndrc`1M||\cr-Kcllcn'\\'/1ur|V\m1wlln\ml1Jm\\n|_g/U11/w|v|zz.m»»llm1mur umm/m
u/ml |> zz //ml ,um zhmk run mu ~w/lm_qf I/:u mlm! Ihr p/nur
Sul |c\\||1. Hu//1/<ru1z|>u/mmlw/r, lm: r/wp/nu umlwz/>n(\\1¢/zum: n [vumylvm/_g/11.
1/~»,¢l.», ~~.,\~z». L~~,;-»L»/|L-/|.1‘»./ 11, L1/f\~.»,..»>.'l»/W I/f.»,»l,¢~
\?\IK ,M-\'<»1<~ul/m_g1/rm1_q/zz1uzf~um1nl¢u|1lml|>_~z/l[»um>\Imumvm///mr>/up
Urmmz /u'lr¢1r|~/H1141//5
\| _ /firm Umm: by .m/ml lhwy /fuinugzu\\l|mrmm un/im~l»|ml>1/:um I/zv /um
n1l\¢'»/1/vI1y'>rm!/mmL1mllmmm\mmlfyurl. Hu; Ulm: muy iw puwssm/, `Z\ »\m'l\
u/¢¢l1,"~n,\'> Um/rmlu Slum, "1> ml/fm pun'/w>> ur wm'1/1/w»
,/rt’/W
,. » 0.
AMK: lint tire very often travelling in order to share your work with anyone who is
i/’.. .eh ie §"i» genuirtcly1lttt'rt*stt’d in it, Wu certainly have not reserved the enjoyment ofwall
tirnwings hir only wealthy collectors and museums. Your drawings have been done
in numy prestigious institutions but also in tiny towns and srnall universities across
the Uni/ml Stntes, Canada, and Europe. To whom do you give permission to do
~.».f_,.a.
es `_<a . your drawings?
--.:.wt.»f\i -,1:,~ ~ r. -if ; ' SL: Anyone who wouldfollow the plan is eligible to try (in goodfaith, lwnuld hope).
ii: q`“w=m=»»m}4 AMK: How would yttujeel ifsonieune executed rr wall drawing ofyours without
‘\ it ‘ifltli \\“' pernnssmn but with fmt’ to follow the instructions and in an appropriate sire?
#2 SL: OK,
ef- age- ._ AMK: Would you consider this an "authentic" l.t‘Witt wall drawing?
Sl: les. lt would Ire authentic.
AMK: Would you consider such an unauthorized use ofwall drawing instructions
unethical?
__ _ _ .at ia
Q .F
SL: No. It would be a compliment."
es-»:Véi
‘ ,- ”"`f "`: ;';-JM
-V There are few formulations of contemporary art which have gone so far in proposing a
' ''f
` r,
distinction between conditions of ownership and possibilities forthe dissemination of art
ideas and experiences. Taken to its logical limit, the permission LeWitt apparently grants
in this exchange would lead to a situation of free distribution of these works. However, it
would be a mistake to assume from this exchange that LeWitt ever intended his drawings
to be disseminated by an underground army of guerrilla wall-drawers working without
_ ll ; ‘ _ "5--'I
ll » " iz i ly ' It might be "OK," in his words, and might result in "authentic workf' and might even be
|~ ”
l Us
e.f
` S F' ` r `- `
*TFC;
“ ~ _-fr ,As 1, ii _‘ y
rQ;\P,.,s-VV ‘> _ "
taken by the artist as "a compliment." But I.eWitt never meant to set up a do-a-l.eWitt
yourself franchising operation, and the wall drawings themselves, which are frequently
quite demanding to make, should not be understood in that manner.; Rather, his intent
was to create work that did not require his presence or hand, based on ideas that could he
disseminated widely and with relative precision from simple instructions, then executed
in a variety of sites using readily available materials. According to LeWitt, he wanted "the
idea ofthe piece to he the constant and the physicality ofthe piece to change," a situation
in which "placement wouldn't compromise the meaning."" The result was a model of art
production and distribution which remains largely unprecedented in Western art.
Other radical models ofdistrihution worth considering in this light include projects
such as Eleanor Antin's iuu Boots, the series of postcards mailed to hundreds of friends
and art-world associates (figs. 49-52). In a related development, Fluxus artists and mail
mst
Facing page;
rig. 49. cieenor Antin. l00Boots1n the
Market, 1911. soiana Beach, cuniornia.
may 11, 1911, 9:30 sn, trneilea June 1
19111. alueu-annfwntte picture noeteem.
Courtesy Ronald reiarnan Fine Arts,
New Vork,
artists ofthe 1960s and 19705 also made direct-distribution artworks, often in multiple,
that circumvented the gallery world. More to the point are Felix Gonzalez-Tnrres`s stack
Fig. 53, Felix Gonzalezrrorres, pieces from the early 19905 lllg- 53) By requiring exhibitors and owners of the stack
Untitled, 1993.01fset nrrnt on uaner
tencless cnmesi. Collection of the
pieces to give away individual examples of the offset-printed images whenever they
San Francisco Museum ov Modern were on display, Gonzalez-Torres reconfigured the boundaries between ownership and
Art. Accessrons committee Funa.
possession, using the exhibition and sale of works to underwrite their continuing free
qitt nv Ann S. Bowers, Frances ann
Jovan Bowes, collectors Forum, distribution. Yet even this step falls short of the model of structural accessibility embodied
Elaine McKean. Byron R Meyer, in LeWitt’s work.
and Norah ann Norman Stone
LeWitt°s wall drawings are ideas made manifest in a form that is material and visible
in any given execution, yet potentially ephemeral, able to be redone somewhere else.
To be sure, LeWitt has also made permanent wall drawings on commission a11d has in
fact always been interested in the creation of permanent wall drawing installations. In
recent years, his work has evolved explicitly in this direction (pl. 312). But over the past
three decades, the most radical and characteristic aspect of his work has been the practical
elasticity and conceptual portability ofthe wall drawings: their capacity to appear in
different sites and scales, then disappear until the next incarnation (see, for example, pls.
214 and 217). Based on the set of instructions conceived bythe artist, each drawing is.
in a sense, a potential visual experience waiting to take place. We might think ofa LeWitt
wall drawing as a materialized instance of an initially immaterial conceptf The most
obvious comparison iS. again, to performance works based on notational systen1s,scripts.
and scores, particularly for music: any given performance of a piece exists as an enactn1ent
of an ideal that is recorded solely on paper, in musical notation, One might also consider
Jw s waser
Ftg,5a Amt Hamilton Beret/nt/ng 5 related paintings is likely to he presented as .tn"mst:tl|.1ttt\n,"le.1eltngtt> .t degree nt'
i992 rw mom; nest am gms;
UOUVS SO0\ hiked walls floor of semantic slippage bordering on tncoherence. 'lit the extent that .mygenernlt/.tt1t\|\
wmnerea steel totem, vttnne or concerning it can apply, the lluurishing of tnstnllttttort work rellects .1rtists'<.lestre to
hollow wal HEEUS and 2007199
transcend the limits of tntltytdurtl tvhtects and exact increasing ctmtrol over wh.u we
vtytnq eanavtes New Art Gallery,
university ot washington seattle might think ofus the menus of reception .md display: the physical .intl perceptual space
in which the viewer encounters the Artwork, particularly the gnllery .mtl tts light, its
sense nt' presence, its mise-en-scene, .ind its cnpncity to .thsurh the \ ie\\'er. At its most
impressive, this impetus has resultetl in works such .ts Ruhert Ir\\'in`s perceptunlly suhtle,
unphotogrnphahle scrim instttllntions ol' the tq7us .mtl \\1oos,.tntlr\nn ll.\miltt>n`s hrenth
taking, densely metnphortc works ol' the l.\te tgtlus and e.\rly tggos ttig. $41. lly 1970,
l.e\Vttt`s wall tlntwittgs hntl detnnnstrnteti .1 relntetl .nnhitinn regttrding the senle ol' the
work tn relation tothe gallery context, to .tn e\tent th.\t they might he described .ts
"inst.\|l.ntons." Hut in et>ntr.\st to ninth recent tnst.\ll.ttn»n work, they r.~m.nn distinctly
tntlehtecl .md often stupt isingly clelerentinl to their surroundings, sometimes utilizing
the .trchttecture .ts .1 tlelihemte toil hy engaging \\‘.\]ls, corners, and other structures .ts
etnnpotteitts ot their eotnpositionnl schemas lpl. 259). Their .tltinity to instttllntion works
lies inure in it mutual .tttentpt to get lweynnd the limitations nfintliyidttnl nhieets tn the
pursuit ul’ telen~_ lnkewtse, following l.e\'\'itt's wall tlrnwtngs, m.tny recent |nst.\ll.\tim\
works propose the artwork .ts .1 perltvrmance ot one sort or .\nother, whether .ts .t unique
11, Jw s wcnef
.|llnw\ngl10r/hmmt<\;.\ll.\n1dc.|mlnhungmorder\\>c\pc|'\cmu|t_l]u\ur~4|n,¢»9
course, purcl\.1s\‘\|w riglu \u \\\\|\ .md Incl] thu ¢\m\m1\|\ \.\|uc ni l|\.\\ ld;-.\, ,md thu
nghl\<\cu|\1|uiss\<»|1l.c\\.'i|l'\\\wn\\‘.\|M|\.\\\||1g\c,\mluvxcu1\ch\~\vurk.|\mrd11\glu
his wmhcx, \'cl the um|\\|.\ln.1luruu( \|1ul1.\>iL L-L\u\mu|¢ \|.u\~`|r|1\\|1 gu\'ur1\|ng lhu \\.\H
drawxngs rcm.\|n~. |`hc |dc.\ ilwlt 1cm.\in> |v|u<\~L~|\'\}1.1t .1wmupt.md|\<vl.||\u|»;ul,
1101.1m.|\cri.\llhmg.(f\|r\<\\1~|\.\N>|\\.\l\c\Iu\\'|\\\\\.x||¢lr_|\\'|ng~ c»»rr\t|<xll} |n\pur\mu~
\<\1l.\|u.\gu.\m|\hci`l..xhmthat|1.\\||mu.\~x|\g|y .\p|w.|]ud\ulm\|1pr|\.\\u\\\I]uL\ur~and
pubhk xl\\\|\\lli\rl\>,r\I1L| l¢\\\\l'~pr.\\\m-uf .x|Im\\ng\hu dr.\w|ng<vt"u\l1ilw1|n»|1mlm-~"
.»¢ \v<\r\\\`1lrc.\d\'wld ..N.mfh‘\\L.»\1¢<\.»~ ,Ju ~|.m,v \~..f1~ \f.\»..»L.\ Wu; um.. Hp,
xlwruby Imvmg shun c.\Lv, .md _1i|m\i|\g llw puhlmk m cn 11, um,
'nw \.m.mp|..\g<~| L~\\|\.\W \`\|..< mm `1|~p|.., pm-..\a.\|_|1\L»1..\LU| .\...»1.,\.¢.».,g\,\,.|_
.md thc \.\p.\L\\\' ul I v\\'m'~ w<»rl\ lu \»u \||.\\vn by <»\h¢-r> l\.\~ Iud ln .un |||1pruLudc\\|u\i
(\\.\»|..|»1|.\, .»1 Im mark Turp\1N\@ 4,`,»|..,, um thc 1;-..g||» .»1 hu
LTO mrucr. cx.|n\p|u\ 0| I u\\'|\\`~ gum \\.\|l dr_|\\'\ng~ )\.|\'u Ivuun L<m»\.\nt|\
Jw
on \|u\\ in Iml\\u»|\~ r.\ngmgIru|nm.\1ur1\\u~.cuu\xL\m|§,;.\]Iu1|c~
mpr|\.m-)\m|»@~,U»l|ugL-g.\\1\»r|<~,mkiuxfwr »|~.\<¢~_ In runum mm
he Im .mlm nmdu h|» .m 1\|m~L\\`11|.\lw|< un thu Iurm LvI`m|c\\g|\> Ihr
Milli mrnnurc,<i~-wrm\¢_|r1~, \\.mhr~,<xmi mhur |n.\~»-pr~d\md ur
umlyp\|r\h.\>cdart1i.\cl»<1ig.;h1,'l`h1\|»\||wl1\.\\.n|.1b\||\\'|~mhcrcm
in lu\\’\\\'~ \<>|1<¢p\1\»|\ <v|`\l\u \\ur1\, _md u 1, uhuud hy I u\\'|u'~
.-an-. du\'<w|mn\\>\|u-p\|b]1~1\1\\|1ui which _\\;u1_\\wlu _\ru~1\m<vL».\nd
prm\\, hi~ uuloundllxgm>H’r1n\cd ?\Lu\\»r b\mk~\-mm, _md hh \v<»|-L
.1> A mcmbcr ui thu .-\r\\mrl<ur~<,\».1|n|\m
Ismwinmmml.\\.1\|.»1~1|n\,\\a~\\~fL,»f<.,».,~¢».\m»|..m~»
5% 2 ///fn puhlu .1ccc~>|b\lny\|1.n\mn>\cnd>tl1u q\1f~\1<»|m1 \\1\¢||\¢-r h\~ .Hx
i~ >|lul\\1.\p||\»]1u>\ pnv.\\¢ Im.nmn Im vt pmg|'.1n\>s\I pulwln
km hm und¢f>1<»<»d “,»u1»1»¢ `,»_\¢w,»m.\_m\v.|> _\ lin-|.\l,ph;~|\_1I ¢@|m< ~»|1»\\L (u¢»1\\¢\f
ng 56 sm Lewm »w:f~@> wa u1r.\I>p.\<u< .md url\.\n strucxurc, l.¢\\in`> \\‘.\|l dr.\\~mg> pn»\|d¢ .\n\ul\¢-r mndul of Imw
Pumusm-n rw wo Pam
\.vc|\\1gl\Il|\1nk L\b\\u\\hcnw.1|1||1gntp\1l\l\\ ~p.\<c .md the mnd1\1o|\>\\Nd1wxmuunu
xl. Ihc >itc uf |1|> work|~|1u|hlllcml-thc\\..\l|\nn \\|mh lhsv .wr \|r.\\\n-and \c\
dL-11I1cr.1tc1y|n1m.\|un.x|,1<lml1m\.\1,.\nd mdupcndum uf thc p.\ru`n|.\r :L-.\l ¢~\.\\u lhm
.m\.p,v|‘|1@f\.m|....\.-m..1|, <umupn|.\1,|w\.x\m|\.\1n.\n|rc\»1 |¢\\m; M11 af..\\a.»g»
cm\~\r\N~ \\h.\l wc nngln ull A "dm|lw|u-~\\cnl"cn|\d1||4>|\ m \\'hN1 thu m.\\cr\`1|, p|\\\|¢.\l
..1~1L\m¢.»» nw L-M-k\1\¢u `1f..w|ng ..|\\».,\ ~.|.»\\|»|L-<` mf .km Am mg .\ »\ml uw lm
nwn |~1M|¢£m|»m»f1; \wym\¢1|»hy>|\.\|~p_|ku`||\.\p\1l»l\\ \1~»m_\m .»| l\\\m.\n1h\\ugl11
u»m¢rN|ug _|r1_md lin’4|u\ulupu\ux\\nI `\u>|\\<m mrm .1 d\»|n_\in nm \> lu; I<\\'\u'~
dk-ti|1N\»n1\\»\»\|t»|¢-u lnIhr||\vrm.1|\u\\|(A\\<\|u\\\ p|w~\\.1l nl~|L\\>, .m \»\v|wr»\1ip, .md
lhu cnsunng cm|m|\m~ nl \».m||y‘,"Idc.\~," .\~ lu' |1.\~ I.\n\<»u~|y \x\»\~(cd"1.\\\|v\\\ lu* \\\\nc\|
Ihcy |1c|<\|\§,;||>whn|x\u\.ur u|\dcr~|.\m|s them ""
[,u\V|\l\ w.\|] dmxungx u|1IurLc (\|1cu\|u»\\\|; mmiul .md .\ wt ul |\\c\|md> nl prml\1u\<\\\
gr\u||\dul in J¢u'n||Wi11l§'ln\’|r\\l.\||\'Al\y.\\|x|xC|l(C|h.\l |\ xmcrcncd in tlxcm. l`}\c} lrump
Imuiling uu\din<\|\» of \mx\d111.\\|¢ prmlnnctmrx, <.\pi1.\1 1ntc|\>i\'u i|\du>lr1.\| fl\hric_\|\\m,
s was"
Notes
i. Obviously many public an programs have reading ofrhis interview in regard lu Lewnes ofthe cave. The comparison is perhaps onlv
successfully sought creative ways to circumvent original intent ln creating the wall drawings; partially appmpnale, but il does underscore the
this condition of restrictive perinanenee through namely, that his views on how, when, and by exleni io which leWllt intended his ideas in
temporary projects. the funding of residencies. whom drawings ean be leguirnarelv drawn have an existence distinct from their redllzarlonv
and other ways to bend the rules: yet the com have shifted over the past decade and a half, to and in fnet, tu be capable nf existing as art wnh
missioning of permanent works remains a a point where Lewin rodav seeks to exercise out ever taking on "real" form ln thc wurld. As
governing assumption for most major public a greater degree of artistic control than he indicated in his insistence in his "Sentences on
eorninissious. Arrisrs want a guarantee that formerly felt was necessary or irnplieir in the caneeprual Arr" lioaolrldeas ean be works of
their work will rernain on rhe site as planned. nature of the work, clearly. he is rnore parneular art" lsenrenee noi. ln other words, rhe idea for
and commissioning bodies warn a guarantee now ahoui how and when his drawings are ere a given wall drawing and the directions rhai
what the piece will withstand the phvsieal ravages cuted than he was in the statements quoted in embody ii are nor merely functional means ro
of time. rosa. hui he has never retracted the permission an end, they are ln a sense as much "art" as the
2. Quoted from Andrea Miller-Keller. granted at that time, leaving the current situa drawing rhar, perhaps rernporarilv, ernhodies
“Exeerpls from a Correspondence, igai-i9s3," tion ambiguous. However, rfa wall drawing the underlying ideal on the wall.
in Susanna Singer, et al., Sol LWWI1 Wall were to be executed without LeWm's involve 8. Marco Lil/ingstone,"Dc| it Yourself: Notes
Drawings less-rosa ranrsrerdarni siedeliik rnenr by surneone today. ir might or might not on Warhols Techniques," ln Andy Wnrlml»A
Museum, \984)v p. zl. still be "OK," but it would delinltely not repre Rervospeflive, ed, Kynasron lvleshine (New vorlrs
3. lhid., p. aa. sent a situation the artist now eneuuragei, The Museum of Modern Art, New York, l9249|,
4. lbid_ 5. Lewin, ai lune l999. p, ea,
se The seniiinerns expressed in this paragraph 7. ln this regard, n is tempting ro compare o. Miller-l<eller,“£reerpu from a
reflect LeWin`s comments in a telephone con Lewnrs pairing of conceptual idea and irs exe~ Correspondence," p, aa,
versarion with the author on ai Iune logo. cution as a wall drawing to the Platonic notion
However, it should be noted that in her essay of an ideal form that casts a shadow in the
in this volume Brenda Richardson olTers another rnaierial world, as outlined in Plato`s allegory
`.-~ - 1f_:1 =
sol Lzwlrr: nr: mea, me wait uwswiwc.
___‘
in L
i
` g Q YEMEN
l,
tl
` su.:
\_.»‘ --_;
ess/
nu.) ‘~‘|
11;
iv.: ‘-’
'
‘-'* , __,
¢_.v ‘J
.1
VL\
'~ l 14
"1
A
‘A1
,L
ii?
`M.~¢) ?f7 " ' A* i f'$“'*
~;
LEW|TT'S AUTOEIOGRAPHYI INVENTORY OF THE PRESENT
Adam D. Weinberg How do we know who we are? Are we defined by where we were born? The friends we
chose? The career we pursue? How does one write the story of one’s life? Does one
begin with family history? From the first memory? Is there any point to searching for
one’s origins? Or, is the point of origin the present? ln effect, is who one is, what one has
become? If we dispassionately scrutinize the facts of our present, are we likely to know
as much about ourselves as we would if we studied our past? Such philosophical questions
seem grandiose and solipsistic in regard to Sol LeWitt`s Autobiography. However, issues
of personal identity naturally arise when faced with an autobiography, and LeWitt
questions the very definition of autobiography itself
LeWitt has said that he considered calling Aurubiogruphy "Self-Portrait." However, the
idea ofa self-portrait seemed too narcissistic, too definitive, and too direct for LeWitt.
A self-portrait, even one made up of hundreds of images, suggests a monolithic, singular
quality that is uncharacteristic of LeWitt’s work. The viewer ofa typical self-portrait,
confronted by the image ofthe artist, is challenged to examine every detail of a picture in
the hopes of apprehending the very "soul of the artist." We ask ourselves, how does the
artist present himself? Wl1at is his pose? How does he regard himself? How do we regard
him? A self-portrait is theatrical, staged.
Typically, one thinks of an autobiography as providing a privileged view ofa life.
Often told toward the end ofa person’s life and career, an autobiography is a confessional
account, "the inside story," offering a chronicle, gloriiication, or apologia of one’s experi
ences and endeavors. For LeWitt, however, his Autobiography is part and parcel of his
rruvre, even as it reveals parcels of his own life. For the artist, despite the title, this book
is just another work, no more and no less important than any other.
In Autobiography, LeWitt presents more than a thousand black-and-white images
in grids, generally nine to a page (pls. 349-52; figs. 57 and 59-61). The artist catalogues
virtually every corner, crevice, and item in his loft. We see an aggregate of unposed
images-the bare facts of his everyday existence, The emphasis is on the stage that is
the artist’s home and studio, There is only one out~of-focus image ofthe artist himself.
And, as if to defy identification, LeWitt’s face is hidden-we merely see the top of his
bald head. We investigate each image, but the significance of this autobiography derives
from the connection between images on a page, on a spread, and from page to page, as
much as from any individual picture, The book as a whole is replete with information
about the artist`s life, but purposely lacks the fanfare one expects from a self-portrait.
To the extent that Autobiography is a self-portrait. it is an image of multiplicity in
which the artist is hidden by, and revealed through, the abundance of things that
rig, 51 sm Lewin,
Auraamgrapny, isao. surrounded him in his living and working environment at a particular moment. As
snaeu-anafwmte pvmmgrapns
much as one might search for a specific image or images that provide a revelatory key,
mounted on navel.
Lewin Collection. each picture, be it a detail of a plumbing fixture or a marmalade jar, obliquely tells us
tot
Q
something about the man, In Autobiography there is a democracy of images; in their
presentation, no image is more important than any other.
LeWitt`s Autobiography was published at mid-career, in 1980, when the artist was fifty
two years old, The images, produced over several days during the previous year, were created
in his loft at 117 Hester Street in New York City, where he had lived and worked since 1960
and where he would remain until the mid-1980s. Autobiography was not produced as the
culmination of an event or at a turning point in his career’ Instead, when published, it
was one of I/eWitt’s eighteen "artist books" and one of six photography books: Stone Walls
(1975, pl. 340f43), PhutaGrids (1977, pls. 345-48), Brick Wall (1977; pl. 344), Cock Fight
Dance (1980), Sunrise and Sunset at Praianv (198o; pl. 355-58), From Monteluca to Spoleto,
December 1976 (\984),L The organizational structure of these books is relatively simple
and straightforward, the personal references are few, and each is of a fairly modest length,
These books are no less profound than Autobiography, but Autobiography is a more
complex, ambitious, and in some respects, intimate project.
LeWitt’s artist books situate themselves among dozens upon dozens of the artist’s
structures, wall drawings, drawings, and prints, For LeWitt, none of these works nor
media occupies a privileged position, Each work is part of a chain of artistic production.
The significance of each ultimately must be understood in relation to all the work that
has preceded it and will succeed it. Every work is part of a nonhierarchical whole. Thus,
contradictorily, LeWitt’s Autobiography purports to be just another work, yet its special
significance is undeniable.
An autobiography, literally the writing on one`s life, is a more appropriate form to
LeWitt than a self-portrait. Autobiography is discursive rather than iconic. The images
are modest both in terms of how they are made and how they are presented. Each two
and five-eighths inch-square image seems to have been casually taken. They appear to be
humble snapshots. Many are out of focus, off kilter, over- or under-exposed, or loosely
framed in the camera. They seem to be uninflected by the “personality” of the artist.
Produced at a time when fine art photography was in the ascendancy, they counter
fetishistic notions of formal invention and print quality, and instead assert the workaday
qualities of a medium used to record factual information for its own sake. The square
format-of the individual images and the pages of gridded imagesfis the two-dimen
sional version of LeWitt’s structure of choice, the cube, which he calls the "least emotive"
of any three-dimensional form and “the best form to use as a basic unit for any more
elaborate function, the grammatical device from which the work may proceed." Like
words or phrases that derive their significance once they are linked in the reader`s mind,
the images in Autobiography are made to be “read.” Yet, unlike the elements of written
language, which is linear, the meaning of the images is variable, for the square grids can
be "read" horizontally, vertically, diagonally, or experienced as a single visual whole.
Although the images are presented in a nonhierarchical, seemingly neutral manner~
manifested by the repetitions of the grid structure, the typological organization of the
content, the unnumbered pages, and the unpretentiousness of the pictures themselves
they are not completely devoid of emotion. The rawness of the images works to under
saam u.weir\1>erq
mine the grid.\>|1\uel1<\>u\reml\>rccxl.'|`he\e<l1reet,.\|n\u»t lender p|e\\||es Llm\11v1e|xlsng
\l\c <\r\i>\`> space and po>~c>»i<»|\~ l11e\.1rle\\ e|m\¢.\| \h.m \he} n1|gl1t.|ppe.u on 1l\e~url.\eu
ln fact, lhu >ce|\\1ng r<pe\N\ene>> ul’ the images rre.\|e\ .\t.m\|li.1r|\\',Am|11lnr\\1\gL\ll\<>t
drama [much like the music ul l’h1||p (}|.\>> ,md Slave Rcxeh, lu which lheru .\re |eleremc\
ln >nn\v: ofthep|\m<»gr.|ph~1.The viewer|\u\\\\ultu~\u\|rtl1eu11.|ge~ Imm edge tu edge,
frmnf<xregrm1ml u\l1.\el<grm||\d. I`hc .n lm lw.u'e~ e\er\ p.1r\ nt h|> hte hy prow, ||\\'1lmg
L1s1xm\l\i>pr1\x\\e >p.\ec, pen mntung \1> tn ex.\m1ne \\\\uuri\tie.\|ly e\er\ nluect-lm
even' ~hclf, ln every rnmu, m e\ex'\ e|u\e\, .md on mer; \\.|ll. |l\e.\|'u\l\|itl-i\1nutte\\
rcmlered lr.\n>|\.\\em. ll|~ .\ppru.\el\ xuggesh \\|lnemlv|l\\\ \\h|le H \~ »mmll,u\e\\\|>|\
gmled hy gridm
A1 hm glhme, .f\1m»[»/l=_Qm/my nm we-|11 uh he .m ml|1l>.ue \n\¢-mmf; ul l|m\g>,1_\ekmg
.\d\»liml l\ug|nn||\g. x\\|1l\Ile.<»| eml. lI<\\\e\\~|,\|1elm\»l\ h<\~.\ \'c|lcd nlc\cl<»p\ne|\l.\l slrne
|u1e\cn\||1l>u:|\\ um nm»\e.\lel»|\\|\<»\|1|\n\ 'I h\~ ~|r\l\\\|re1\ >\|gg<-well lu luur l»|e_\k> in
the tkxrnm ul nme in\.1gu> m .\ phge |h.|| »re.\|e mlm-um-|\\~ or eh.\pler~.
The tim "cl\.\}vIcr," rnmghly une lhml ul \hc 1;Ap.\ge\,\»eg\\\\ \\1lh |n\.xge» re-\e,1|ing
ng sa Auqusr sam, lhcpl1y>if.1lc|\_\r.\e\ur .md emmruemimx ul xhe hm n»e||: lhmu. \\|m1u\\~, ee\|ing~. d\\<»|»,
Mwpfmehfe/, mn, lmagly m agen plumbing, .md eleurlenl lmure-\_ lly'prusex1(\1\gll\e.xrchxleelure tim. l_e\\'l\l md1re<\|\
c<>mq»@> waz mm ana Wm
nmmngfapn col/flew Alam reler>\n>h\sp.\>\,1n p.\meu|.\rh\\ “url .\~ .1 »\»ung .\»»m.mz in xhe mthe nl .mlmeu
same' Afmv comme l.M.Pci. l\.\l><\sllggesl>tl1.1\ l.e\\'itt`\pr1n\.1r)'c\»neer1\ <m<l\|1e I<\\1nd.n|lml»| h|~\\<»rl\
l>1n >\r\|<\ure1\>ell. lurthermmc.|.\l\|ng.uel\|1eemre.\~ .\
po||1\\\t\lep.m\|re e.\l1~ .1Henl\\\1\lulhe|vl\emv|1\e|\\»lug\'ul
~p.1e¢. By |<»eu~\ng lm lhe »p.1ee m whleh he \\.1~ exmelmcll,
uf’
l,c\\'\ll n\.\ke> u> .xculely .1\\'.\re of lhe ~p.1ec we mlmlvnl ,\»
_ ~ 'IV
‘_ ~'=_
me uur>e|\'c> experience.-\nru[vmgm]~/1,\
.Mm she >\mL\\u.\1eI¢n\e»u~,\l\¢l\l».»k \egl|e~m\l1e~N\l|\»
arm nf lhe lun, uuh/mg pnennrm of >n\l<c\~ .1|ulclce\r\e.xIe\»nl>
E ~ 15”
.1>nwmplmrie.\1cm\|\e<\mn>\l> nhe m.\\@r|.\1~ .\\\d.\r\iI'.1¢\><rI`
hi» ~ludm,l`r\»|\\\l1e c.\l\mc\\ _md d\.\\\er>, \\'l\ic|\ remmd \\> nf
grid> .md >\r\1c\ure>, to l\.m\mer> .md >.1\\~ lllg. 371. llere we
see she cqmpmenx .md muh uf \he trade-the .mm _\> wrlwr,
the humble er_1i`\>|n.\n. The n1.1\\¢r-<»|4_\em pre~e|\\.\ri\\n 1»
rcmi|\i>centufL]crn1.u\ phuu\;;r.\pl\er _»\\|gu~\ S.mdcr`~ wx |e~
ol\uci.1|andprn(o~~m|\.\l|m\'lr.11\§l|1lrn1()|n Tum-, m \\h\el\
lhe nmh llcllncll1eucc\|p.1l1l\|1 (rig, ax >. \\`¢ .ue .\I>\» mme
_\w.ne,p.\r1ien|.\r1y xhrnugh rhc.u|.\\ ul nm-.\~urmg de\'1¢e>
1'\|lcr~,'l->l|u.\re>,.md pm\r,\el<\r~-- ul \hc .mm .n :he \ru.\\~>|
ul ~\rueu|re~ .md \h¢|| e~»n~uu\e|\\ l1nes,\|1.\pe~,.\ml hum.
'[`helue\|>\l1c|1>h\l\>Ir<»m\|\e \\»|\>\ru¢\|~m \\>n|>.wl\\el\.1re
n\\>~t1yl1\||1gl>n w.\lI»; ru thu |n.\rk-nmkmg |m»l» muh .\> pcm,
pumilg, l1r\|>hcs,.\|\Cl m.\rl; \:> xmxlm meh .mg >pr.\\' p.\|n\,
gems, enamel p.\m\, rubbel eemcnl, .md lllm. 'l`h|> tllm |\ml<v~
.x p.\>a|ng rolbrenceln \|1eplmu>gr.\p|\> in /lmulvmgmp/1\' melt,
irq so ssrrs-war while the ruhher cement alludes to the glue that affixed the images to the pages ofthe
,lommqfaom wav
hook rnechanicals. This ts followed by a brief but detailed excursion into the bathroom
and ami who pmzoqrsm
msanrea rw uauer with its hars ofsoap, toothbrushes, a shower cap, and plumbing fixtures. The section
iswrrt cniipfrm
y en of
concludes with a thorough inventor app
thetances,
kitch - l'pots and pans, utensils
lots of containers, and foodstuffs.
The second chapter consists of four spreads offering a foray into the "more intimate"
realm of the arttst's wardrobe and details of fabrics that presumably are in his sleeping
Lone. ln this section, as in preceding and succeeding ones, we are made aware of how
things are ordered and of the processes that led to their disposition. Thus, clothing is
hung, folded, stacked, and crumpled-a reminder that, as l_eWitt wrote,"The concept
ot' a work may involve the matter ofthe piece or the process in which it is made.” Here
also the artist calls our attention to the patterns, materials, and construction uf fabrics,
with .r particular emphasis on geometric patterns.
The third chapter provides a short interlude. It consists ofa single spread of eighteen
plant details tollowed hy six images of plants, peacock leathers, and assorted keepsakes
arranged on shelves (fig. 59). This section, in effect, clears our visual palette, shifting our
attention ever so hrretlv from tlte manmade to the natural. lt serves to distance the viewer
lretore delving into the heart (and mind) of the hook, two extensive chapters-the first,
twenty-tour pages long, the other forty-seven pages-that encompass such materials as
Le\\.'itt`slil1 t l I " ’ ' i ` `
rtry, ns ntustc collection, his exhaustive assemblage of ephemera, tchotchkes,
and his own drawings, notes, and structures.
sam n wwuefq
The overall progression of the images suggests several narrative structures, First,
though it is risky to attach a distinct narrative to Autalriagmphy, the book, while at times
digressive, intimates a diurnal rhythm, This is particularly evident at the opening and the
ending, On the second spread of the hook, all the images ofwindows, with one exception,
were taken in daylight, while among the final spreads, LeWitt includes three pages oflight
Fixtures, most switched on, immediately followed by a spread largely devoted to clocks,
further suggesting the passage of time. There are other sections, such as the kitchen
sequence, into which one can read this rhythm as well. It is a mark ofthe ar\ist`s ingenious
ness that the book is delightfully ambiguous, hovering between a deterministic and a
totally open-ended reading. Another narrative involves a movement from the outer to
the inner and from the less personal to the more personal. While the first two chapters
tend to refer to the physical space and such bodily activities as cooking, bathing, and
dressing, and the third chapter serves as an intermezzo, the fourth and fifth chapters,
or roughly the last two thirds of Aurobiagmphy, are largely devoted to the life of the
mind, the core of LeWitt`s endeavor: what he reads, listens to, sees, and thinks about.
The images build in intensity, creating a crescendo.
On the opening page of chapter four, LeWitt signals that we are entering another
phase ofAurobiography. For the first time we see his work itself-a LeWitt»constructed
table on which rests a maquette of an incomplete open cube. We also get a preview of
his library and recording collection, and, as if to indicate that the making of the works
is inseparable from the ideas that spawn them, two overall views-one of a workbench
and the other ofa flat Hle, (Both subjects were examined previously in close-up, but
were not seen from a distance.) This page of images serves as an overture to the section.
In the next spread, devoted to a compendium of seating-chairs, stools, couches-the
artist seems, tongue in cheek, to be offering us a seat from which to examine his library,
On turning the page from the chairs to the books, we might initially be struck by the
physical presence and arrangement of the volumes themselves, only to be quickly seduced
into reading the titles and authors (pl. 351). For the Hrst time words take over as carriers
of meaning equal to the images. This section is one ofthe most fascinating and perhaps
informative about LeWitt`s interests and work. In examining the books, which are system
atically organized by topic, we see volumes devoted to film, architecture, history, drama,
sports, literature, mysteries, cooking, sociology, and others-all subjects of interest to
LeWitl. And everything that is of interest to the artist potentially has a bearing on his
work. Every depicted volume is treated with equanimity. Although one can single out
almost any book and offer an exegesis on its relationship to LeWitt, from volumes on
Piet Mondrian and lean-Luc Godard to a book on the history of his native Hartford,
Connecticut, the totality of these volumes is as important as any individual book-a
point made apparent by the last page of the three spreads devoted to his library, in which
he includes five long views ofthe bookcase and two out-of-focus images emphasizing
the building-block forms of the books. Even in the next spread, consisting of images
of LeWitt’s notebooks and catalogues of his own work, we get the message that his work
is entirely ofa piece, We might imagine that even Autobiography, which seems to bring
so much of his life and work together, would be just another book on the sheltf
t in mam D warm-rt;
2 `
~F;
"
-57
mit
lv: W " r~~ -ii , lu, 5 r
g,,r, IU|xjL,_--li
( J \ my
g1- ~-
,:\-~ wb
A
l
ii
71? ‘_-*"¥#§ V ` ` l | ` i
¢~'
e- 'f~
, Qi-"'` »Wl '' *"
"Pi, .eta "e
Jrf:i
;"~»=»-\u~ l
» ' “T l i at
~ #Q F* ~ ll
' -- "` ' I ~ / C' ~:~
Q1 if _ - $1 _ r
>,,'l
),._¢§_4 l lg# - 'DlllllSl-l fi, _
="' 1' =.§ 'L I i lb* i v
r# 1. J ~' e, Q _
rig ei sol Lewin "Winn is rt liiilicrultigzstf, to a page that iuxlapn>e~ images of a hrnaclly >n\iling Rulvert
Aaron/nqrapny vaso
stack-ann wmre pmrwaprrs Rauschenberg and Hannah \\e|nier, to a yawning cal and a eartntrn of the art|~t Lvnda
moantea on naner Benglis nude aping the pose ol the Statue nl Liberty (lig. trol. 'I here are perwnal relbrence>
Lewin cniueerron
in both writing and pictures tn friends and lellnw ,\rt|>t>, aninng them E\ a He>>c, Larry
Poons, Robert Mangold,Sylv1a Mangold, lnlin Baldessari, Nancv Holt, lack Twnrknv, In
Baer, Richard Lung, Robert Smithson, Gene lleery, Hanne l)arho\‘en; arti>\ l1>rel>ear> such
as Fran/ Kline and Barnett Ncwn1an;..\nt.l performing .xrtnta muh aa Laurie Anderson and
Iucinda (Ihilds. There are sensual and erotic images ranging truni .\ ptmtcarcl nt a paint
ing nf an ecstatic Leda mul 1lu’S\\'a11,twt\ nudea frtnn hi> nwn work, _\Iin'1vr|iige ll, 1964,
und a campy picture ofa nude stiggestivelysmt>k|ngt\\'itl1 the iintanari iriimeren lie liz
m1tivUslfig,6|l.Ii1 looking at \he>eini.1ge»,tme al~ol1ect\ine> engni/ant uf the pntential
liar categuri/ing and s)'slen\ativi|\g these sulviec\x~liun\nr, friendships, and ernt\ci>|n,
For all the order implied hy thew >y>te|i1>,t»i1e realinm that ultiniatcly they are cun»truct~,
nftemime> idiosyncratic antl perwnal, in l ewin muted early an, "conceptual ar\ia\> are
niy>ne» rather than r.\nt»naIi»i»_ They leap ltr eniieluainm that logic eanntwt rcacl1,""
ln the tlnal chapter, with picture> like the .rtlrrerrieiititmetl Leila ami rlie mini, a
aequcnce nf lntlian drawings depicting a cuuple cnpulating, and a >ign lim \\ \\ nt lt
|'l1 \\| , one ~en>e> a feeling nt ct\|i>\||n|natmn. l)ep|ctit\i1>t»f l,e\\'itt'> earlieat tigure draw
ings l'mn\ the late |9505 and early 19605. and nneigus ol' antl related tn h|> parenta, suggest
a cyclical rhythm, a return tn the urigim nfhirth, lamily, and work (pls. 550 and 352),
lfone thinks nl /liimlimgrizpliy and l.eWitt'> work as a whole in epislenttrlogigil \crn1>
Notes
t The year aftet the book was ptthhahed, 3. Sol LeWitt, “The Cube" (1956), quoted fmm s, sal Lewatt, "Paragraphs eh catteeptttai An"
Lewttt ata, however mate te Spoleto, lraly, with Adachiara Zevi, ed., Sol LKVHU. Crxriml Texts (i9e7)» quoted from Sal llvwn Crmcal Texts, p. so
hte ftttttte wife, cami Atttitoeettt she ts pictured ltlome: Libn de AEIUO, 1995). p. 71, (reprinted in the Appendix in this eatalhgttex
tt. the latter part ofthe beak. 4. sal Lewitt, setttehee 1:17, "setttetteea eh 6. l£Witt, Sentence M, “Sentences on
2. Shortly after ,ihtahtagtaphy Lewttt Conceptual Art" (when. quoted from shi Lemn ctttteeptttai An." P. ss,
pteatteea cttw" vthttt, whteh uses a format of cttttear rem. P. he rteptthtea tt. the Appettaht
thtttyetwtt tmagea th a spread to thvetttety the in this eatalhgttet
space and obyecrs ar titawh Point Prem
.tram D wemtaetq
PLATES
I EARLY DRAWINGS
II EARLY WORKS
IV SERIAL STRUCTURES
V, LINES
VI LARGE CUBES
IX LOCATION
X GEOMETRIC FORMS
XI STARS
XII BANDS
XV OPEN CUEES
XVI STVROFOAM
XX LARGE GOUACHES
Q
J ' `»=" *;f-’f¢”‘}~ gf* /Q! f
:J ' _‘Q 'ig' `&
` n.,.;¢;¢;§] ‘ff » Q'
_'T "ff Q/ s / § , .
$3. 5 ii?" ' )` .M
, ~ .5 _
,. '5\
' /' f »i.;i' ~ " '“ *ff
E
1
1 »»
1
\ ,J 1
, / ,7* A~»,~
W /x
“Ii ; `/,gf/ AV,
/_\
/;_>
x‘ fr \
\, ~_rf
/_
“ ‘3 /Lf
‘Q My »‘
_
\ -,~//~
W
A
/L `<~ ' ” " \
/\ ‘ / ;‘FR f /
W @;
fi; 1//N / I "HH /r\\
/§` j
V >\
| M" \ , /;,
§ />%F”//
‘\\§Qf ~f /\f?
\`"`\F
A 4 ,,
'”i~ ;>§`£Q,\\
V `
/' ' \J~\\` .
,fb `._,/
f \\1,M//A\
~,\
\ ' 1 f Q ` ‘\ `
- f \
» \ mv / ~
.X , =T VU mx
x
7/ {\\ Q# V; Jgjy/
I//H 1
5 ` Q »; RU Q9 M *
l/"W
/ lg
/ (W
\§>, 7 /rQ '~}\,/
FW
l"I,~l “J \\
//,~/'
,"\l
. \ `\`\
ré
y\ ,l,;
L Study alter Prem, l95s_
lla
\ Rl,
Ink on Dawn Lewrn callernon.
I,l
Queen at Sheba, ca. l454»5B laelarll
Fresco, Church nl 5. Francesco,
Arezzo, llaly_
se Sandlo Bonrcellr.
Ins Frrmave/a, ea. 1482,
Tempera on nanel.
Galleria ai Ulllzl, Florenne.
l. new nnwlaes
' 'ff.__éY'
-1
' ~A ’1` 1 ~~
K1,
1/
11 /_
"
\\`
if
if ,‘fm
_
-1
11
_ _\\ ,f 1 Z,-f-'1f~ \ ,1
1
1 "<~,;¢=
11
S may 11191 01113, was
1111 Un 11.1p@1 L»v1/111 0111151111111
f ;'/`<\’J
\ ‘W ,:,=’ Y' \; =~
.0 1, , 1 1 ‘ 1 , _ -1_ , 1
1`V/' '1 '1`, Museo am 1>1E11<1, MA111111
1. 5101111/111100155 1155
1 _ __
.1175 1 F` 51
` ‘U,
7/1" g;l1.11.
@ 7 11 »/11 \ ’ 1 P@111110n page-1 1»w1uc¢111e<11011
HQ 11' " , f M. M I’ \ 1 ‘
` ` ‘ <; ` ` Y* 1 \`
»" ' , ` ~<
Q 51011111/191 1/¢=1asa111-1 was
1111 1111 ,1.111e1 Lew1u 0111151111111
1/ / \> ¢_\ 1 ~/
B. new 1/@1@1¢1~@1
111.1113 M.11q@1111, <1 ness
011111 canvas c<>11@111011 01111;
><~n§m1§1°11s<»@§ 11111521111 we-11115
;, 1
, Zi” 9. 01900 ve1a1q11@1,
51111111.11 53110111132
1 _,x
-1 ,). ,` _
, \'\1 `V;
011111 15111.15
w.111.1<@ 0010111111 101111011
1\f1`\_A»=§
>` ` " ‘ *Y f 1,-~
-/‘,\\ 1 = ,_`
Y 111. srmv any ve/asauez 1955
1/ ,,,1
\y’
J'-»‘11, ,,
» _ ff_»§§_, ‘ /` ‘}\ ` 11 A
|111< an new Lewm 6010111011
\"‘~,L;{Q/,
\»>e \_ ,/f* -‘V
1. \,/` 3'
ff K,
ll
1<1m§\111§w11;¢r1@, M0se01w,v1en11a
me Museo as|P1aa11,Ma1111u
1 1.
11 5111111 51:1-1 Rubens* 19513
Ink O71 D/SPG! LEW1!( CU||e[(l0r\
1He|Pe1ske11l,1é36
011011 11111115 c¢1||e<¢1011 0| the
1<011su11s\¢1115<r1es Museum v1e1111.1
1 1.\~1~ M 11-111115
I ’\
.f
tf\\~
1/ Y»`
.,,*/% /‘
`r \
. ' Wy
‘ an
.,, / ; 'C
1Q
‘ 4"
`c_.
\'
E ._
‘va
\|_ Qil <fja
Ȥ
<¢` \. `
;’
rf!
,. P
`¥ \
1, \ `“"'_:_‘
s\V \\\
\, Q M
‘” “fin
\.
~ @©\ \_.
` J/4
@”\ \
mv fr, ` //if / \V ~ M
>§\}§§1, / ' f=
‘~*.
\/ ~4, my ,gal
X ; _,>>"J
¥\ 1;%,_
/77/;,`§_
f, ~ ~ =f@.1~ \ //4”/1
&
&Qs
“rea , h'A,f'~»‘ J A 1 `<%' V
gf* \»;’s§§x\§ “\
=f\\,|H§5 ‘¥‘\`\ f:}"/" '
\
Q, _,__`;`§;: _N f\ ` \
,/- fT*\
//1\/4,
_/'
“T f
~f/\ Q
~f\ \\
(\/
/ ,/ / V7 LY
{
f
\
.\\f \Hé
swf? 1
»K
us.
~1 -7,
- ,5\ ;
* wg
3 gi
W“
\;_‘if
"V
,\l 1Mf*M..
3*
"‘
5
‘ , §§3ea§»§ ,,.= .=§=;i@¥
'\
\.<‘ Q. U/ _
E _?:_.
new nwnww as
W, J
r
BI
UB _IE
UE
rv.7x `! ' }
,Av ,-
J/ _ / »» J L' ,-5' _ ‘i\
_
2/I3V, 1 :fx
`_¢L. _V_;,/af
,~ , 14,
_J _J l__I
za mn /~/v, 1952.
on on canvas .ana pamxea
wana. Lewin cQ||e¢rion.
aww wuwws
21 ww wsu 11 /.
rm nmafwap ww ,‘~f\-u..,~,»\ f < »»£ wx mum nr
L~\ ram/r
1; ww sa mm; 'U ww
0w1»f@;~.'~; nm >@1M,;.\~_@.~r‘> 24 f 4 f
;~u=-1~m@r=»»r»f Lgww Q ~ me A nf \ a n
\ \ <‘\x
rw 1 <1 ww
,\ , A _,g ,,~,- ,,~ V \_>,,,\; A ~,<_»»-&~_»"»<\,,~r w
» W »\<.\ N »~\~\, ,~- 5M v- »v~<»\»»1\.», mf \
_-P___
_ *A _»,:_1
~ . _~
_v uY. _ _-¢\,_.<¢»4§xas».
__ --_,__.:. ,_ ' gk __
\» .xeeff - . ,,§___7_ ‘ »_-:_,_
,_ _ F
' " €~"-
r__ ,, ,‘S. ._
f,Qi"‘
,.--.¢_.. ,, ‘, . = 2, ef - _ ' ,
._ ,_ i_, ~
--“ 'T
Q
~ > ~~ ‘ ‘f ;%r.§\"i@\“__
_, .r
> Q
l7_~~‘
°'
2,
-."‘5
\ _ ` r
`_-.u
.L~
W.
“ T.
1 , -~» “\ ==f=., __ ~“
_ » '-< Jr
, f- - " - J; » ,; ».,
~v~
'.._,L
.3
_»»
"li;
_,
f=’#~‘"3.
"
.
e_ 3; '_.
-`*¥
e %
' "'?"*"'
Lg? .I
*L_
PQ
ea.-_ ,
a
' A.F; -1 '; :, ;r'r» _
r.- ,- -~ _ me " .
M
<<~ <.-,
N, Q.-.nv wow
,K
4%5§;~
13
megf~
.ww wgws
as
15 "~.~m\f vu. vi
u ~»\ =\»..,\ Wm-~».1.\»~~.
VW rp _~u§ 'W
"""§ »;°=' .\,
I
11
11 my/'>1f..1f.,/~ \/f,<
ow W Mm w ~w~~ ,,\\~\1
Cf»\~~,»\ »\',,»\1»\1,\f-W
»
as eww ww wud
mmu~<1,'.@¢: Jw r~,»
1; m~¢>f>z»~.':..» ‘M \ ~
my :fa Mm ww -\ im 1
W
-$5
f Jw
‘f-ff
h ¢f1
W 1° dl
»
3 .kginiéi
-‘:fE_,.,
a
*nfl
, -1'1i55‘1}"
_ - ;r,’@',`5
_lm
-;.’
.V
»
"sr' fx,
-ggi
§“‘*'i`.f9
1 ,_
zq?
,’-35?
J,-L._
»~ ,"»
'_
‘1
la;».5J,
:ff,;§"; `
-hff ‘1*v,j¢»_j¥'}\“_
2
L¢.
, E5¢`§`T* 21, ¥:=L¢=‘=
QE -;f='
3 "Q -j~;_»=¢;;,.;:r
N4
ia? v `”;'=.." ~ \ ., fé : "'“5 I
‘QM .f ;'#,,Y ,
¢m==f>'1§»»§.
I-` ;£'»ff,{»,§¢.p~
¢»\ ».& ‘N
¥
N W3
Az. Muynndge /L |964 4:-u. M1/vzmaqs/, |954 (schemam
(schematm repfesematvonr repveseneamon and excennr wew>
Pamted wnud wmv mn comparlmenls, Pawnee wana wmv can cnmpanments,
mn camammq prmmqfapns ny each mnzammq pholoqvauhs by
sarnara Brown, Las Anqems, ana Barbara amwn, Ln; Anqeues, ana
auasmnq mms, Lewm c»|>e¢mwn_ uasnmg uqms Lawn: cmuemw
H. wmv wow;
ww”
2
x
L
"Q->
QUQ.
"l
§\
\
~
4
~."»~.
‘v
"K , ,,,
; (vg ‘*~
¢ s
~ » f-,H-.H ~ » f ‘\ '
1-_
.H ./va//sffmw rw Mmm/U5
W/m one amp B/.M web
Pm/Ned wond CU\\0;\\Ofv of W:/Kwvl
.am swf; Mgyvqma wa§r»mf,m»\/\ \.»
NEW York
49 nm Mmm/af slfwm/v ww
s>a»m»-fi Ween c0s\e<m» Ur ww mw
WT
TTT
sn -\ ,J M H ww
sv ~ \ , vm; 1 .wwe uw-A\\,»»
~~ "fn \rn.f~_| /f=~~\ rw,-. vm,
»,~ \\r~ ye/
S5 M:!rY;.€3/ Culvs' Wir?
saw. Wm. .W =\Um~»..m <<»u¢~f¢\<>~
EEE? FW
W W if 4Emn
Wum _1|m1
E
M@ggg
EEEE §@
ELE EE
, ,W , A,.,,.m ww, ,», ww MQ
lrT
ss ww. pu 5¢~» wma
saw: ~~ \w~~‘m " \e\
wf mn w f~5L.,~~ \ v »xv»;»L
w.`
,\~m~ > ,M W
sv Vu K ;:_=\( , 1.
Rm w mf rm wa t
ss \
'mm » \~\ M
MA
sg vw, `= < u» wp
M wha -15° »,~»1~:\w\»n Jmw vw W
r.~,\f~w» np rw L-www
<;?
§,,, 4,7(__,
if__lr
\ ;~ 1 7
1|
/‘ Z f4 7{\'79
` `7
,I L .
!€§Y,BFf%'@°>”'7"‘-’ "Hn '<~~1= ,
4
wM
uv. s_E1§I!fA¢.
U'
SOI- I-ewlrr PWAN u.\.|.¢n~1 1.9: ANGELES qvnu. IQL7
pau. a/u.u’7u/
nxfnn A‘
E -5 . _,_ , “L_ **°f'_ @ §;,<»<»/1'*f‘Jm
kw .QE 3%
S5 5?
¢».:“,‘ua#~/»f#/§-¢
§\ .,.,
:Tw‘
__ »; ,Y ..-» _, IV ". _f _
/I/ II'\/__lL_1
,'IfIf’EL!
I,I _--,---V
/|,II/..f‘, Ilah
,/ _Ae
1_' /' I' "I
"
T.A
K
f I_. -
mmm,
5, ;
,
-;
gf
' _W
&&;éf'
»»!s1=f1?fI,;.
I f M41 I/ si
-nm..
' , ', '.II1, ,*Je/L;
, V/I I,
/I / 1.
/_M
1;
I I=;?=4l6_
,Im/W7
If l
.=7
, :ww
Siam svnuuunrs
WWDUHUEEUDWDGID
QHEDEQEHDEESUED
EIHEHDDEUHHEEID
HDHUWEHEHEHHHEEUIIEEHHEH
DUUEDDUEEUHUIIIEEEEEIIDD
HUHHEEDQDEHHBHEIEEUEBHDH
HHUEHUQWWUEDUEDIIIUDDWWD
UUUEHEDEEDEEDUDIHDEDHWDD
HUEWEHDHDUUDDEEEDUHHEDDE
DIUEEHDDDUDUiH§HEEUDE
HDDEEEIIEEHEEHEHDEHEI
DEEHUHHDUWEEEHBHEEEH
IIIIHIEEIEHIEEIEEIHDEEEI
EIIIIIEIIEEEIIIIIIIIIIII
IIHIIHHHHIIIIEIIIIIHIIIH
IIIHIIIHIEEEIIIIEIIEIIIH
IIIIHIIIIIIIEIHEIIIIIIII
IIIIIIIIIIIIEHHIIIIIIHII
IIIIIIIIEIEIEEIHIIIHIIII
Iiiiiillilliiiillllliiii
i
iillliililllllliliiii
EHEEEIIEIIHIIHIIHIIIEE
A
-,1',
r,;
I-’1
mv:
.V ,Y,
'41/`
_= 3%
‘L
'PL
.,|
H+:
' 1 1 m::r4:“.,af:"" '~1:$“'“'
,1 / zu 11.
1' L'111 111 11 1
sr in
Jr Jn 1 1 :fn
&1 \ ’
1 11 11 11
11. 1.. 1.. 11. 1.1
11. 1.1 111 1. 11. 11. 11
11. 11. 11 11 1. 1.
1. 1.1 111 11. 11. 11. 111
11 11 11 1 1 11. 11.
I 11. 11. 1.1 111 11. 1 1
1 ` ‘ : r
11 A _, 1. 1. 1. .
Jr I .ul lr n an
1 11 I 11 11
.1 1. 1. ` 1. 11 11
1|
1.1 1. ”
L
11 1~
W
.1 11 l»
11 11:.
,.
.1 1. 11 11 1. 11 11
1. 11. .11 1.1 .11 11. .~ 1.1
5V
11 ‘ 1.111
I 1-1 11;11.
11 11.
11
11 l 11 11 _ 1. ,.
11 11 11 11 11 11 11
1 1 1 1 11 1. 11 1. ,1
11 1. 11 11 1 1 1 1 1
1 1 1111111 srwunruwfs
vAn|AT|oNs or nggpmgurs o|=£N puBg§
4 wh 42 I “ ‘ W I ¢ ,
W,, $%@p,@ _ l, Q
¢@&»@¢w¢ww;Qw@Q
@@@@@w@m@@@@@§
2<H§‘_VUg»KW,,@3f>® QQ; “
Qi M291 VQ Q1 QW” UQ, Vi QQ 121 >Ql@%€
12, M. KU Q Q,” Q2 Q iw; Q] 551 Qi G1
@@@@@@@@m@@@x@
®( Q Q 5% Q Wi, QD QW Sw, QJ 5
®@@@@@@ ®@@@®
%;;@@ l I
3
Il
II
/)/,m _ ‘V
,v | » | r H
DTI" §”‘~,;
.
4'
. fiigfii
‘:`~=`i=,
_
N.; .M-,.._»..... ,;
’__
,¢
-_Ar
_
._
",_J?)"!
.-_,.-'
_A'
.
nf'__;
' _
- -__.=_
,
-_
I/ ._
I
.' "v .'f.~
-" '
'f)'/ ,-
,v;..,--
_-
,
, ,"
"
_ "< _
~
~__
ni
4~_,._1.._.¢
2' 3'
~ e' _
'.f
S,-I-»:~
»» _ §“~“/1/,\(f.*\» <
'J' "'__4'f¢_`F
_,yr
-' ¢_-,V
/ I' , , » . <»- . _
_J V
_f
~
‘ _if__.1,y,lp-
\"
NX
_-_
_:--1
2,/_. »\_\'
¢`i"'°’;"
4...
_.
" -_f', V_=.
____-,4.
'_/~_,-
LYH.-".;3A"}
N
-qt,-7.4;
: _*x
.~/ If 1 1 `§-_ '»i-.".‘;» _
B' ._ »_
_
.gn .°._§C
__-‘ua
(1-.»»_ ',-_
n.cf{_;§_3?}Xi¥_?;¢"*:' - - v_,Y _/' if _r _gb rv £'_\_: tn; }_g,;_f¢`;_{_\;{ 2; ?___:\,» ___._;.¥_;;____J_f_i_5¢;_`§",f_ Liv-,f__¢ _ _:ff
1' ? - ' ,A/7 I ~~ ff! f _ ` _.P »-' -' _ 1- wfgff. '_; '_Z, __:»f_r" _-'__,v,,¢ §_"_.,~_~
_:¥-J" fl.:-' _ /4 A /. _.- _»‘T,~. __= ;-'\,'$;~._&_Q_}:~_,.'\Kf» f _ L__'~__ '__ :__ :_ __ _ J _
.
_J _3 'J _,
r: 1 ~ ._Av _ _
J _ -/_S __ _
41 __a"{"'i» __ - _
_ - 5 _ r _‘§""f‘
` !’__/" __-‘5__',_,5Q_;-'__J"
f _; f /.1. »- .r\_
_ /,_~
, . A.
_
‘A -1} /!,' _¢;rf“) I V" ¢° JF .fl-""-`_ »' ,‘>=.§_'t "i, -Q '}Py"». `§`2'°,_W' .' R; 'V
\"' _».__-»___
U fu' ,*`,"; - ;n__.¢
__f?L~_<"ff~
__ _,_,, __ _ `_; ,_fr.
;‘:Q-’__,f ¥.,;‘éTf'-7,§»g;*\_f&%`§»»__l§__:'i-if-_
a af, ._ _:__
_,
_
3` >"x`-ff ‘i ¥.L'€7';'.¥‘<fv"'\~<-
_f-__,_-._.__-/-.»~-,.~
N .___1(_
__ 1: _,r,Q
`{ ~.,' _#_jp,_'g'=,=,»
u_ r m _-_ _Q___
--H,_--
,2_. uf*
.'__,(
_"UZ:-_<-
:_
.<.'__,"HJ
' ~`; ' '4~
nA/-__
i: .1 -.5_.;;/-~
"X ."
,1 e
\
/¢
¢.rf
_ "_ _‘f
rf" _ f_" -_
X” »'___
._ _ Y‘_
/"ff ‘ _,a2»*
_J “`(¢
_,__ I1''~
' .‘\»__ ,J-,_
~'_ " 4. _r` ___
1;______,__,__..__~
Q, if _\" , _.__
4 ia,
f >~
7‘;_I"_
__/_ ,_
____ »__._
"r:f._` _ ,j_;',_
,. _*___*
,f§_ _ f-_
_;'
~/1,1¢‘,
' _ `- ft rn" 31" f "_/4
‘-1'-f..~1-,=»~_-_,_
}'» f ' n .{¢"iJ';'
.LinV"-:'€'_‘<`__T€’.'f_`;-A
' ‘__
7“:T"""§5‘
_if _'arf _J,:"____»__,_.» ;;.,:_, ____f_,;_ ,J //I;/,o_,_'__ __ _f\_¢_f__:_, ._7.__.___ f__,f_ __/__ QP, E? __.._____»>;),-T ___-1 _ .I __.____¢.~;__. _
_"» T* _- _ .
¢..~~_
`1¢`.»'
==2"-"'»_'1_-\.'
14; *
»7<»1“;~»'
fx
3f / ff //gf f /_
,J ,d)|/IJ]/Ifé‘
'ff-
J I J/.`I/rFIf __,,
_/'__/fl
*Q.°/Jay*/|,,,__,»
tI' <»v=’
.- ~
_ _,- __. ,_ r¢}r
_ -1 _
¢ _v f.._ ' ‘._
fp '_ __»_(_\;__ ___,‘»_ 1 =`f"
___t}__,f';_)
-K 5/I'/__/‘y,_¢¢`»___'_[_w_1\‘_J¢
-_‘_-,»~.
____"` .SL_.\‘.<-
_»___
_ ;,= _~ - \ _»__ _ _»_.;)_{ _ _,___
~ V/\.= 5:2 _-_.>»-_
1" ¥.~~.__
_ _ _ __»,. -""~:'t-'__
‘R _-_»'~<
,_.',--
~.._'.'-‘»'.
3? _ ° f/ " Ai,/rf 'J K' _\" V,” /' »" `JA‘\»' Pa if w" '!_>\' 'x' ;.>‘»>=/~_f~.~/f,-""'~‘"a »1 fy' 3' --_
,
'~':
___ _ il ____ __
__
__ ,_ _,4'_,-. .f /Q, __z _f _/ _. __ ,_ _/_,__ ___ ;_,~,_,~__. ___.g\_,f,__»»_____»___»___».,___f___~.§____ ;»_ _f {_.__ E _,_ ,___,.____,
7»»~ /° if -_/_ .J ~¢ _ I P 1 _= _- _; ~;_ _' 2- »-5 -_ e1_ _.-.__,- ~ J~ , ,_ A /___.§ _6 1 __»` ___ _._ \ __
3 { _(I nf* /,a _fy r/fu' f' Jw fr. _,f __.-_ If_;_§.*;_.-"1,‘,_,"‘\.€__,'_)`§___-f_.3¢`.~___.___¢”'__¢‘ 3 __;<_._,_._< ‘_-__. __~_ _
J' /'_/' ' -" 1' f .*' ‘- =’ f .»" A Ve' 91' ‘»1`i("a' _-'-,.'.." ff;,,"`.,'- ff./`-J* ~; "1 >~ _'4'_
//‘ ifJ ,A _
,gf - _ /‘ »'_, _/‘ / ,f )»°_;__g\_<-5; F ,-*._>,-; ;-f_;*:_I?'~,_i,>-2; :sf ff'-<“;_;
; fi& . _ 5-°'@_‘
_ rf;
$32
.gg_ ~.]I itf‘ f.`
J-';_/_ _-’
f#',fI 1"/"
1
_ 1 ’K':=';~<`“»2
Q , ,_
" ff>_.
'.'.»,_ __ _,_ 'Ji--‘Lfx
\ _‘--Lf’ 5-ff
r'/,<\`Zf_ ;_f`, 5 _j';"_;<`}.-.a:i_~J”'.."`¢1'-.~‘_ 7'-‘Rf I- 'I 7`€"" '1'
_-»" ?'~‘_
iii;
-4
3
a
1 a ~|
P
A
/'I /' 1 ‘ff _ f ~'¢f;_"~'£§
QR? _;. a Y
J
§ §
ia, Y
.~ 1 , -' ;-~ ,- ___-__-Q '__ -"1 ~' _#_A _._*.-"=._»
%»‘“1q’;' __1;/’/>_/ff __»'f§_r_ ?*___~,' __¢_ ,sq *_{ _§‘»_j»'k}-'_;f_ _»- _5; _#_ _:___
. ./ g 'm “~/
‘si 1
S
I fI _” If_ /’f''J.X/__,~”!X.__'»-¢_j__~I__?_¢__/
' /' _-'_ .»’§./fy *X* xfxz ,}24"‘.‘__.r'~,.*~ ,f‘.~"‘_.'f if _' ~ ’. :
Sf'
3
3% _ gi
_ _'_ _l-_>___:_ __ j`;___~ .i,1"f-if,» __A __.'\ }
Q; 2 r E ‘ ~ J J JR-",f’ Y` 'I -*W ‘»"1.¢j€'./"-'f,"”.-"'?" Q* ,if I J" .~'r`-‘
53 1 lb"
€
_- _.1I, _.`=,r' ,uf3,/‘j__/~,¢’-e;'T:'
/A!‘.,4
/ » .’_f=_.“,;1~-'rf ,~_; u' =' if $7J
qgé§é"‘ ` f ,_ "ns‘ 1f' _‘ _7'»“`§>f_i~*‘~/
f>
3
'D
5 } X
nf; __ ‘_.f1.f~ "z'_+”__>-' _;§,'_,:‘
_ A./' 'f _"_,, _.`<_.‘,f¢__",)’= __ Jl
Q 50? lf Wa `
_»
*E “i
Iiii'
I' 1 <19 _ _ ,_ "2 J
_»j;?;~;f
M( r r}
iff *f_l'f1l17'* I _,,._ __ _ _ _ _
‘ \’V8il|l|¢ll°l`ll‘l
1 ‘ ' ` .1 _fr & ~f ~~ ~~r~_
3 5 | ' .1 _ ' _‘tv ' _ .3 '_ _ - '_ »\- _RQ »_ ,_- ,_ .{~_,,f___,_`__`:1ff»:f`-_;_'jf§`_.1‘ff'€_"!
, _ \ Q ' _ y*_y
.`f_i_l__`_ I" ¥ ~¢ p
" ' 4 `_ Y
I » 0If
*T "',
2.
___
;.» ‘E"-
:' _ ' 1-.,`*?w"£
»__¢_
r-L_ P5 ».~ I #_ _34_i`
.- -'~-Av
»'-.¢ -7+ v.__
,yf 1-
‘VT’=f
_gf_*___`_L§__, _Q A .'\__&___-_.___
*i I?-{4r¥-{`~}
._ 'J..:_.~ ?}*;>,<___;:,____.,:__.7___‘.;_f._?____,
5_-f-iq-»’~;;-~l-‘:7<»/'l_~»-~£A-f~41
_<i.faz'.;. ~;~ ~;._‘/__i:1,;f»,__- 4 it -}
-»~. ):.;,£__{ '51
\~,-\_
#__
__ _f'~"¢`
fQ_ 'I . "£~¢-r
'- Y \-..
'
._ ._ 7-._
' " ' " -1
'
4¥‘-
' "'
‘ ='~
’~f' iw
~~» -7-r __ _"i"‘<
.qiww ffil
‘kay
_ ~ _ ~".5%-Y
4-f¢-\¢~¢¢~-,-4»~-.J~J ."
_ __-_ ~_ -- ff? ~
-`-'"-_Q-‘1fF<»~`.f»57~-I-»"-.»~ 4""`¢
’.
__ - . _ ‘___' -Z 2 ‘ _ ' _ - ‘a',.,a{"- ’ _ ' _;- -1;-;§,_gfg,»€_~;=#.§
A1
- .- ,,_,»_,,._- I | “ I~
-'L ,_,_.__-J_`l_;. _ I R | `~' .» \ '| ` _
rt ‘I *_ __'f7ff.€_=
T ~~ ' f
1_ 4,1; »1
-__-_.;.J¢..T_L§f.L.;L_.' *
_11
» 55 ,_ up " ` ' -~»-
` " nf -~ ..1f' ,___
` ` ' ` ` `
_ ~: ._/\r'a»-tv “9f~*31“ "’t~f‘u_'*`:"5`ff"-.1’5‘f1f'P"¥‘7"‘\|\"“‘/`,fl¢(
1--2'-~-rf ‘Ur _"S: »_- if _ ff. ’€
___-_ f ,__ _f_,"'*f§`!f
_~_-_;__f:~,
¢
9'
»-. __ 1-_ »___ Y
-:- - ix-fm# ~ ~.- »~~_~f~.&Q& __ . ‘:¢-- ;. -_-, '3_ 7»
_J__i_f?__§__`______§__ ,_,_f.,f.__.,..._5.¢_~ __-(-:r.(.._...
(_ H>__._ 4,_ £¢ 141, __.§,§#' '_ :ra ,~ { ¥_~
-f _ _ .:- :r'f'$‘*}_<=¢’w’%‘N.
»f`»Q-ywwp 4 » “‘2"‘=-~‘5_P‘
_;»_,,)..»,¢ =*/*.%‘*
~.;,1,¢. _=*__-f~.~
¢.., fr/_,_
¢ _ :~»,~;<_,-__ ._ _~_¢~f_~ff”__\;_ _,. ;.f=,,~__- ‘v ,r 7-:fr . ;
__ 1 _ 4 __ W” _ _ _ _ _ _ _ _ _
_.;..f;¥-4- z;---¢»- ~'*"§f""°i“‘,"*'2 '-g'+~z-~=+<;~
-..3.~=~¢_.y%-1~}-¢-wi-+-»--;~,- *f* ' vi' “Q "~'~“'4*;»‘~Y
,1,,J,$_,)_ s._;,, ..._.|_.,;._,,,J_ __-_‘-- -iw--_
_‘ 2.1 L'~,"__1. _1_;_~_, ._ '.¢~ ' -v' 2"1<"‘f`°
~$ Y '?_.:__‘°¥.P2r?Qz _._-_.J.l,_}_-’ .
§'-'\‘,f"°:fn~|3{-/v.>F»;h~Y*>v~q-.-fQl,;;,l¢1¢3¢1~;4r_>4;K~].~
dd- =~~é."v.»f,-*:~#~_~~~- -*‘~ 4“=_%=" "4 =¢'~>=>-f-‘fi ,_
'§":"""'-rf-~"s" »»~¢ __ ~';~f»_»< »<_»~ _
“--‘H f-_-‘V > ` -_-'»_r,_; ‘ ,_ La. -Q _<,1- ~_}_;;',4 _¢;__
.-,q
“u 1
5
,wi
N.
».‘
W
F
1\
_iQ
mL ,1 mm: Qu~,~¢,
'4 m
v. was
EH: Q ==;i;;f;’-*if -~ it: _ ' *;"i;,_;":" 'A:;§;€@;§§§5g"Ti'
, , f_\ =-a ¢» |6vo) __
\\\x\|\N"\Dv\_/ /\ §»0¢¢w,u/
Z
v wus is
11.
/
15.
1|
sa 1. was
va
M7
nhl;
1-L
v. was 157
va.
___§
v. was |59
_
, ~= >' =~,;,\~:;§
4 '” ~`ff=?¥ =
, f»-;»;,-_fy A i
w, , ’Q»--»~- =»e
-_ ' ;>_,%
»..
`.._`»rL__
l _
\
' ,, 2 ~a°'S»E'§I‘=T§`~
\ ,._I"1»~'~“P* .IW
“\
1
“So » was
'H ,MI/»i7`,~§ V7/an
v. was 161
§§llll
llllll
ll pl
lllllll
WE -f , 3? ,. ,, , , ,,
=====n~
`§ 355' T\
J ', '1
;,.; f,-z,»;»'-¥»”"7”“/' "4 JN' ' Y
mfs
f
M/*LL M/WK/A/65 SIL LEIMV7
1)»wf- #www 5
ZW ae/k,1~¢ »f»f»WM///»..A /»»J»W »a~.,¢/W,/»f&¢¢,,¢f,,M“,/,/¢¢,,,;M;,,,
A
Tk ww,-ll ` jL f Aa; ,/
m. ';':
~=»-as~»5\.4};:fr
mffnmj;
0r11</»‘/fwd W
aww//mf//Zfmff
, ¢W,»,/
42 Sf
/1 4/¢/./1/Q
I dl M# Ma
Mu/wa
, /5 mf A
Maw/,em
/17<»~u//~//'14
,L PM MV
423 @-01 JE
Wywawd
~
in/&w
pM”ZA/-j/
/¢,u¢</aff
m
H. /»W/¢/~//
/z /wif /M1
2% /w%f
I
_/1
#fb/7
M.////M /Z
‘iz/:_/ 'm»£4w4/f/1f//
/</»~o -é¢
\_,,-V\ /7 5:/w.A¢
;7,,a /»-.ff/“.<
ly./“M
“;;;;f“ '
LQ J Zjyzm
¢5¢a¢,,//Z
p¢¢»~~L¢
lI.,fL»%
f' fvLwJ»
I 72,7 , , , q % 1 , ,
""‘“ D @ M/wi.;/.,M.w» gy; WM./V 4 %,~Wm,Wff»
* ML. »»L\.L.A‘.~ M
I»~<ufl<wv»1<
L11/\»..,,A,»-A-$756
nrnmblnm qw
/f,,\,,\wufaJL». 1;lf~;»»-Z/Lu, `,)»1.,An<.1MTl,m/-.»»»®1/V»f‘1 we/al/d7‘Lua»»rupaj.
4111/914111:/u
;;a»~y».1/.~fl»/r,1/~ff¢f-~»'*7 ;;W»,¢;, Q) M My V, ,,M,,@M
4»»7f».//».,./»/»ff»A/~* ;1,;@,v,../ w.,¢,>,44,m,
az
V mfs mx
U” 'Q
.U
]z 1 In
‘ ‘ 1 BIIIBI \
ll\I|B
,Nm
JVAHU
'- “ W _
______ gymunn»___
\\-~,
‘ '_ \ ~ 3
\\\|‘
\\‘ 1_'= _ \
N
|W|H ||WW||H
==, :»a§éaaf\ss¥seaa'
|\
iii? }
,x 7,
\
ff f
1
___‘,_l|
_,H
;=;11§
*;; /uw
,5L.1_ -» M Ya
_ __ .M <1
_Nu
an Came andG°, 868.
mu m papen Lewm cwecesm
v. Lmzs
$25
.¢
3k
.;¢.';, ;.
%
PLM Fell W/u.L ur1»\w|~¢/ www wow: <;»msrLy/ my \s,u,\\1,q
v. was
_ "_\_` -'<
_,___,, , _.-t‘1.'}l
"Ȣ:,' `, H5l= _
/mi '__ Q \ ,//, ,1 \_ '54 , \< ' iqfg ,
'V -1 " ,éf A ?><
g,\ 1 ye,J
<'>Q!w;¢>+' 'f` " ' fi f f" "`
\b§f&"g\°¥
£4
iz~.‘4_
»
R` ‘E
Sk
;,§\f ' §
K §r
-_.\5_fé,l,-Q3
, A-_. . - ,.~~.
*Q31`f’ ,'
~»
_\ u_;
mfs
~\\www
\ V;\NI
\,\\
`\ \\1
i
," \\\»\Mvagr
\
, \. ‘V
,~\‘\
\\ ,M
%\1 J N-»:
Y‘\:"!‘\§
Q; 1 14 1"
_\\\ \\\ ‘ ‘l \"`z¥
`,,\\
,\ ,|`\,\\`\N\X\
=
\\`\\`~\,
1‘u, f\‘\ \:
` ` ‘ \\ qw \
1
.
, ~‘ \ wJ
\
S,
\
‘M`"` `` , \
"\‘>
W \ \ m, i§S\ ‘w "u '=\ \\
\ \ \
\ »\
_\\,‘,Lf`~
}z`, , ,\ \
\\ \,,\\\\~7
\ ,\~ ¢»\
M mf# ‘\ H ¥\\ V
NW'
‘ 1~»‘*" w , ~ ,\~ ‘U
V\‘Him
gif ;\‘,1`/‘M
\` LN
, ~\
\\ ,M
\_ \
¢‘,-\
`\ 13” ‘ ‘\
\
RW
1\
fi If '_!}ff/
¢g2¢;3%
W' I f /, 1`__`_§_:»%.
_,\ ;`:Ȥ;A' 1
f / /.» -,ff , f;:\ ;~»é<
5`~ __
._"{/_/"ff: 1j`1/Q3
"‘/ ?-’f. ,,»\~\;»»;'»3'{"é
~.. ` / . /__,»T_:__,`* , , I , , 1
~ gffggg ; >;y>3,~
fzgff `z;?;;g;?=a§sS'X\‘~Q \ ~»
‘ ~;S-» .>ff# `§2>¢f; <; ~ 1 ~ ;\; X ~
f "‘ff_{~`fe;$§'<'r\ 1 ;’{ ‘\' ; 1 3? S *X
. , _ '_ "°'- , " \ ` `
L4 22‘5`§ ~` T T9 -42.* - 'SR 31 f ‘
‘¢é<颢¢(}\`.`\_`\`*
¢¢¢_¢¢"'\ ‘X `
~;*\°"
-Q "' da <¢¢¢A~"» ` \ S ` ¢1
4 _
‘ Q ¢¢A ¢
`; `_` `_`
""’“ *“:‘ ;`\` \` \` \ A_
s ` ;
` `
5 “4""_\"‘
,;§, "`§." `
¢4 ¢,¢"Sf
i ' I
1"-p_§`
4. » Ii `` ", '
"~
9. M :>»=,-,»»; ua W;
cy wee W .» _awf qv-11,».
Qfqwm .-,Q = :w»~'» ¢»~
S@\\>f~»» Q ;_n~»f~w ww
`l=~-. (Uk 5/A” 1: \§"\=r~
§vl'2fvCf'G L'>~|vv
95 ww ww HG va: @~\
ww! ww fm gm N »r
aww, im +=~u@»1 /W
_/ -\\ _
,Z.m.»Z:mp»..,n.,m»~.
_ . . » ` ‘ - \ yb _ . .‘E._... _ . "5` » f ’“Y~7°”"“"“"°”“*”‘"““
. wmlexplmnqzn. When we plly the
/°“““‘F““‘“‘?l‘a“{”“'9”{‘“° " Cm . _ fo /qw ' B-ma enjoy n ang., .me bui»~w.
//";°°l*-'°='=‘}{»f°¢~\==2|®f>n=~anm
" _ _ PPWS ~' °° 1* '|' ‘=' ‘é:.»\';£=~,' mf.
. .. ..-. pf
./ ~w1av.1f.\=»\°»¢f°r¢h¢u@gi\¢@Lfsmpu¢i¢
'wpim u wau u um f°\ma`~°;,j.M,_ Th, ,\,.
/ "“‘“*PT°“ ¢“°K'°“5|< ‘ ' Ve. 5.--. n “gmumaam~»am¢»u¢fm-mmgunmdfcr
“9'°f‘° "‘“'° “‘ "F ”‘51°'}i' °f » -ngAn . V vu, an look upon fm my umm, lornnly
.,/’./-~" ‘ f "`~\,
" ~-\ .\ ~
1
// #YHWNH -Ht hu/bw - .§,y=-‘Q ~- ' wloén'/,mmm umnfmblawmmpmfgnpmu. ki..
n
ff/ ‘_
/ __ , l_°¥_ |f°f°¥l~“*PI°:°“ -- 0- pomysn 'enjoy um my an mbigbaynnd reea.ll;uogm Wx, _
/I "";;9'§‘/"‘P°H‘°"'*l -~-°*°“°*%\ -> .gy ~ ¢ ' ina»r»w.»fmmmg=m.ayi¢»wum. `
/__ nm 4 _ . f" /I u,'f-u_mg,--m»g.»u»mmn¢°nm¢i»|u¢u; \
V . EW" 215 '»°»°‘M=r'::wu.»~a.~ |»v¢¢»='W"S.eea~ »».»¢= fc usmfss .eeom/es ofnwu memnf/$`»//»lv»fn»/»»/F
v nuns 17
D
~°' :iiiEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE
.. ::::::-:=:::::::::=::::::::::=::::::~--:::::::::::
m“m.». mu »f uw:-/~L,m~»¢u»f1 r¢\~1-»n|.»m»,: var-¢n,nn»/»~r L/wr r¢»» mr 1- ,a»¢~v/ Huhv/ »»¢-Jr 11. »m- :men
L M5
`1\
3;__
il
-'__ \
NV
‘
\ , ‘
`
V ‘ 5,’w
_; ,VN
~ w
.M
\
¢§`
'
My
_V
>4ef_<?-2--2
l _9L11
‘
U
?;i;T"i
1
,__,,__
"` V
v
~
1lNW
_F
A
\ \ ;f;f1f_;f-~=_- ~ Y v Y V-W
_ ‘ A , ` y ¢1 1
' W Tj ff," *" Tim'
‘- v ‘:N Q q \
:
\ ;ii-;;;;;i<;;_
""'
=iT;_,
‘ ‘ * ;§T2'f¥-f;i2f;;i 7'
,
\ '.I a_£;_:_:__;_,_
______,___
,
31
M | _=f1§>f'=f; »--»»- 1; ;_f-- ; ;f
\\ E
~\ >f;§-~;T ''
r f i»?»*'f§§fl
> ' ‘_ " \*-‘» ~`.»;`
’_“'2/ U.;`f;fi
aigff' jxi, ,Eg ,;<- `~';~_;>vQ>f;1 I
~'2§-if `\§Q{
1 *"'”'**---` `~\~.
v. Unis
1
VI
.91
fr' 1
‘U
!
\ L -E,
§:>
¥.
f
‘I
- L _ \ IJ L_.
_
l"_
Z §&§
A
1T_§@7A13'T7”
@%%%%9 M
4v /
-
/W /TZ]
@@@@%@
'H
IA
Ai 157%
EWWQ
4
'___ ,_,
?
»-wsu;
gwd .1119
4\K
ii T'
*I
_, - |.>_, -- "Q ~
'U
w 7' vu Y _. v?
I
53
FL >
¢§»
f 4 » l_,_¥_,
, ~
we
,V
Z' _Q »
|` i J\,P’-\ V
.
"D
“D f~
me ;,n@»»<,m mf ww we Y-4\€v<1:=-1 rv - MMM .ww H
\»1,D<»»/.mp Moawaruufw ww mn: @w~»~~>ngmwmn a,m¢.»_w\ H Nw W, \ H -~ .vw -. » ~<\\ ~»`~~>»~» N. r.m~.Uv~
Pawn-aamm c0\\»m<m m rm.-.m \ m mc m»f.m=»» aw M m~ w~\~»v Av \ W-»» >_<\~». y M, ~»<.»n~\ ,aw ' P ua \\..\ ; \\.~1m»,,
vwqmm m~@r\,N§-W vm rf,m~rw\ xw»»~» sm ,\v\.~\\,~\ vu A wg >~».<,~\ \
mu »~
mg T- r1qy"'\"'r~»¢-7 »<v1N5<»4»;-q\.¥|y
VI
v"é"$ég Q
wééix 'i§.Fi
‘»;"` Ji’ '- '
.@.'»e;.;¢»,~;‘»,_=.fi # A
:1m,=§1~~~&;s»,,; - gf
wi;
f1@sifm;.§*,»§@s._,, g. __ ;
*f J'
»1;g§=€§@ €§é=§ W
wggfim f
ak y fv
"Q~ f
,;@w»g;:;§
ir
‘ L; f?i;;
:J§#§§~
‘,W*§`§@“~¢;'~=n fgM
“~f¥,}_i§f&i‘g~i\~-
"; gf Wi?*-2.
"{""|_...
"Q 31:
;3;i
:Eu
viii*
H ` _ A P_~_,»4;» \" `f
E_ _*iff
sf;j/1
§; »2=@;
`-»l,-‘ ° 'i j
*~‘=~;
Ll/
_‘ill` J` 1g
1' ‘iw
'3€;?1f_t5`
7 4' u if l " _FA~
‘‘=*#Q W
In ffff
3 ¢\`{£f1>>»=~;<§ J‘5*,
fy/*Qi
\f¥i`~
*e j_ .. f Y, J A1
, 5*-_Ki--A
_,A W/
*_ €p17Ag“
Mi f f./‘
JJ \ *‘F
P;
=; 1
Q §
_.
»f._@__;,
A
s,
_;
Ya
M!
»
4-~
.»
,ii
f
-sw”
U.,
'5'
--=».a»
'5»..m».
_
Wu
§‘;
:.Z.
wr
f
nn: 'Iv
=
f
I 1» » v
uw'
im;
,pn “';§-.iiiv
_e gf,mu
14,,».:`
Agag..
._
un,
.ww
5
W Ji n~.”»`“~
.-
.1
_.i -,...__..,,, V, ,».,,,-,-
‘z:m;§;_1;'zn»m,~,..:s
.xv __»
1/ .5
.'-
saw;
“’¥é?i"¥2i';?";f$‘?
wma..
¢~vv,..v,
am,
“Q 4 5fi'
¥JE”E.‘.;,=
RF fp 1
-.‘I »1P55l'
J 1.'-png;--w
hw
~.»-f¢e_;13
` € *QI -*ri
$»,f¢;~,~¢&
;fizi'
5
5».v\\<»
2?
l ‘§»,
Aram?
»:z'
"S Fl’\»
\ ;<\¢»wx
‘
nvv. 4 .
. 4.1
»/.c, '_
>fa€:?:~
»'»a./2
w;~ 1-,w»,¢-vw; \v
_ Hug.
-fri-~»_».___v»»
:iv_.Y
‘_ M
"=»=‘
sum fa
vsw- “aim ~_»»
aznfxw
ll* rf i.;ik gm
'Ji._,.;,_
f__=,Zf3=
,_.,
~q.se_§®"v
~.ven.,i.»
".» ne'
rv ou’ =
u»;_‘€%\
,.<,
, 1=y<
7gv"'nh">.;43h?"-f___¢~<
mm. ' mv = 4
==' I -‘
» If
A .‘.~5°;‘w'-‘
~ _iv
~*n"" '<
"WJ
‘mgi
\‘»»*¢-
f..»r=°.e»
&“»\~%us¢,
;;¢,§§7;':§=_
qv-ge;
¢__
vȢ
~°
Qf_..»-NL§1-;:#~1./
-,gan
1 us* Q5' “"~»\1l¢ ‘¢,*;,;‘<
f _va ~‘¢» “&§4“`¢ vm A an* W
_ -_§mm=~'*
-§4~¢a\z;
~’;1 :;¢¢'g:.',a'<¢w§_\=§
*M-a
_ei ¢ _M-L ;=
_
A>`
'¢\°'f.‘e
R..bo,
_'QM
-Je?‘_._|s'Z~.s__
wi-g Q; u`
'F .
... .ww-¢=m;a.¢@-|;»=
5. ,_ mv, = ,_
--,J ,w'~:»':; .ww-_»--§-a=\=»@\a-=zf;»¢=
m;f.1~,_=';e~§:my;,_g W. __r, _
_ <'n=.;.
'Ax
.:;;>f25mf : m=1_.;-a;.=:f~ v_m¢.m==;
,¢
,4@;»;;¢»<_3'_<. ,~ez,:¢Qf,
__
:_ Z&"‘L».
> '.;_ 35.3
nmfva. -.
.E
_
€"3€~? .1§\”'5§
_ ~. _ LJ' ~ :=_»;`.-f - =m--=_=¢_z;;:-:'
Sé-»1
ggi*
_sm Q- _
fi; 1_4-T.
ig 3 _mf ;>;;~5;;y_»;;_%=~_¢
Im a"r/sy.:
“z .- ' ‘'Q-f
' " _ 'iwi v,
'.i*= '§P1:»m;i>::;
1q,,~»||=°_“i, \~._-;,“§ é $9 '»\ ‘_ ¢ Q __ w. » e ¢-‘
ew
‘_;<
»,
Q, _J
_ f;
»_ ,' »_=f;:r.- __ ww =
sms _ \~\xw‘~e=_§
¢= - -_
,a»_
,, _ »whmf;
112'
~ ~ ,.-ae,”
\»u§w»v°,a5<>
~mn-'<-
~=
,Q_ (>_4 _s-sqf»\‘,¢
5;m\\e:<1i-‘s=»§y-`.PP"1“~», 4 _,.-
= ==~__{.»s=j:§,'
° »..'£‘»
- ¢~a=f=~\°‘\»..'=..
_ ,__`_,_;_,@;= 1_;1__,§'y:.
-‘=m=
ssiawru
WH!!
~_ni*
_ `,.- »
\w95“3,,;"1 -11,,--'
Q_\§___.
rw;3'
.\iH<§$
~ss~»;'e..@»
\\=,u..,~
» Y-75-=:‘\¢-=1
_ ~ f
mr'
_¢¢'~,.~
_f _‘,mm
‘ j "‘1..-T41 __Lf
_ 4' no »,
.ffI»»
,c ._<;<>f» Q ..=~
@=¢us¥_;\F_v,»»§:u
nu n .
Aw”4
."I _ mia:
gg~»;§gmFg;;,‘;~a=
¢»
1 ‘L_
1 'I
»»
_ _W#
. ~@_=.~¢iQ3‘a»=e
~1= wiL',:‘;,~'~i»mr3sa>vii'
V1
*f
= 4'
nv* 4
1 ,avs 'I »,» » :; T.j',:'z@g.~;fn=§,e
'=_S'E,'3:?5_.““F‘f`-§’;f“"‘-*9¢E~‘
». 1= ,g3»`Y@,\`§|§|`,
|ZD;l|\-
~.
. »,, .»=,,»
‘
\'
sa;’;»;=57éfée:=:<
il Hr'
W~
i
v
. ' ~ I ` §~§*’~‘f ii! QE’ wiki V22-£2 1 ` %\: ‘aiu
» :mis " '_ ‘ £1w23§'*k£F
¢»¢=
'~"v‘
<
..§.5:,=£;_$.5:'é_@m; _ qs:==;!-,;g.=¢?,g;'s|;;_§~:
5 ,u s."___ _.__
,,_q»"\ ~¢`,~ 1
*lv
~w¢_;;_¢.;=¢»;5;§.,gyh,»§s§j'¢;1;~s;@1a_
5 ’i ~§ fa M »€.’w#=1@J
_
I; '=
/»’;: ‘wi 1151
> <>
v s5:¢. v.a:.;=.-@>.=..»w;$
.-M;
; 4,1,;f,;_¢;»;@f;;¢,~§q§q¢:¢~fq=Va!¥1ffaQ@@§?=»»¢;;¢zf:»n,~_¢r_.=5@
Q1 `° df va/
aiz-Wei W-_=:n=_§'=:.»'s~a,.»@sf~'='~
me-w»:m=;f.x=¢_é;'
Tl ,$“~'3»‘*I`.1*`f5f?~'s} °';?"‘§', .» »'1. “Z .= Q
x\§'\f.~f»- ,,,,r'wa-_§w~;~.e
\¢~;&¢___'M,,_1 5 0'w=-»»
1 4, ¢»5°fre*
‘I »~%»»’!¢. ». 1-.V »
_=~ *_ _'W 4 F; 52:1 ,=;.:;»‘ ;fr;¢'_;; »' »-,='~:~.;-'>_f;f»
*una* n 0 1 4
_ 2.19-ff f.; Q 5; w.='<#.¢vs¢~ww'-'°"-
1:‘¢-mf,
Ur
Q3 ~ _»:~~ '_,3§.,;-.__-wg.-1;
:;;;§ _';:;_..‘=1»*,_e_&~,s@_
' ~..J_»__ » (__, . _Qs# gig( .,-...
_,_ _;==é;f'-.~;
g`%‘;°”
uv ua. .\°‘
,._"1»l
J”
ax '_' ' .»:f>rg
."\ M-v'»\‘»
Av.
-:gg
.n
:@==1’.~
¢'r~'l'G~
:1‘,g»;_
_ff
1
*s ‘vw _~ 1 :~
., »
-pw =s;,-;'
< \|¢»
<».§;1.~£¢
..f‘=~':'1:_»<-
if .wzrg-=;__:_;»-5;=.,;;_=3=»<|»:§¢-,_;,E,,5,¢;_
»'.:.--»,»;~¢,..::"':=;@;=..a:-
__
1.
sf-
I
`A
1: :ag
1~»»vJ'_
(@s".»‘\.,&&=@<J
;f Q,gpm,:wwe-.;v.s'.:‘w'~5‘-=¢~n;<-:f.'1':.='-w=.»1
~z_ ».=;1.
=?§¢=,;,séf“§==gm-'mag-a=g
4|
e
,»
F-fiwibl " LI*5¢.iF: ""‘ '.ifF§'Ffil‘-§'3' ‘7f\V"w' @év¥'@'5i‘ *EfF“J= 'if ‘f -It -W$?~t'{'T-9
» .M
£32 -...ini . t~.‘f »2wZ;`2.' 3'L»1=!l» ”1»..» 1Flag’-.+55M12-*fem--¢:mtg.-§5=:.sa=;~:»s
\\ \\ :ui '21 2%
=¥.f"1F\~|. "»
»
v
a
ru=a:s‘e;=|=r:|s==::=}'v?;:1\\f;3,qfhii
,~ f -.,,.. ,. ..._-.~ ~~v-K, nm ,_-~.. .v .=.. _ :M ->f__ =~-.J W: <_<= S-w, . ~~ ,-vi. u ¢»--U, _ \\ ~_. W ==_ vnu-_
5% 2, ;:' I'i":=:§'?;1f`;?-z;;=_,:~s~§:
A
mg; =~|»!¢‘e;:;1= mi" :?=_;@!5;s:
i‘.:.:;:e_ '4 ;»!P :H 25:_:==
aa., 5%
us y,,$
h 4|
Ne 4‘ '4lh¢°
~1
v
gf., =-1,s_a,_~ §;= s=¥. 3fI'=._i-5 's}5;;,‘=__f:.‘E;}?-;
'5=~_;=;2;.1'=S9¥f
,~
u ». » »'iw ,#-N.?z?=%.2*Q_':F1sf=;2i’,§§2=f'f=f§'§”a§sF;.~¢s==;;:‘&_=f.'e3;»¢;-um~;>;~..;_;\
mu' ‘»'¢‘ »¢ ~»
_~
~
.~::s»:1 S1-*L
»` w; r| f.;_;w1@§~:ge;\e'.=»=a
Qfvggeq i=.fa.=zqg:=!"4§2:@@:sI@€:
iq;-.=v3-¢~5;.w1<»;m=
» _1:-Q-f~,¢@‘F2§;g;f¢»gi§'1_=¢n;-@~;;4¢is@;E;iaufgina'
N . 2=%Zi~2:f;.2i§§S_e
1
<4 \
q an
nw
»
1
<¢
45
4
~\ -re.; ..=:aL.:_ .. .us 1 ' _:gh -.ink-e r .Las-ds2‘.:;n.f,":.~%¢¢:Wnnenpv .mmiw $=i,.:¥:§2u:Zsa-f¢‘¢\»¢!s=,
au, , _»~,,»_,. .»»,
1- -4_`M¢»wo » »<1,..,..A,_
-i,..€~_"'1E#3‘ :gl-_ ‘F E 2%'f%‘§E\ji=‘l駑%§%€3.§,??§31£i<¢i§!=é-7:5
..,..*,,<.\s-,~;“'3,f.,
SEL._.%
j »`»_,f;" ,un
»-\»~
$597:$2'l;’f&`§~¢.'i~315"§Ti:a '53L4
fr v
_r
T’ ‘iilifgi §"GYA'E`fii
ma»'»fm _-f_._
'iff mea'
¢» \
A
~~
|
\
_qw-;Y:;>§v»g>_=.+*=§
<;,=';:.:.»=~r1=
»;»._5\q 1 »sg5_;-3
,mg ;-.yyf ffwif?
E. 25257 ‘_ '5 -€=;!¥’;'1L*|:' _ ;»i5i2=a'}Z~5;ffy.~hw>3
/,4_
\f},.<1v,'sV: .'2;1'3..$.§§. 4i~1'“a€1`3".*'.'”fw_> £231 .“f.:i.23
J '»"‘|,»¢
A
= __
.'.1._ai;¢w»::w'v;s1‘-a.mam:
,;':_a=_=; Yun
\1
%\w`=f” b<15?;!5_4,
Egfaitq ‘J.~='.-=:~‘»\\~
k.'1_-m;»5¢.gg,:!4'\=>a;,g~--,|:=';¢:~u.gd
4
::'..»rAs-'s
»~,
Fi#.Fu@i52'i'¥“@2<wa.">:am2;.!
»
_|
;!:!¥‘4E E.. = v. ‘__.Z.€_ :J "=.=1.€.. .-1:»'“Z' Q: ‘Q-‘Zvi J-.1 `= ,_.§`§!\>'Ha5‘w|L’45235%;€E'-:¢h.!|E"é§,}1%'}§';\'\'
74.“MbQ-.c;¢.:‘
_,_,. _. _~. =f-v wa a~w~=w‘:~=~==<
1' \r1f§_."`;; __ n \;~_|:" #ffm ~
.__ -"'__ _,-‘Q \_.,. ,~%€'
-_ .4 `».-1=.,
9we. » »e
f wr. 45
.;%?
Q*
°¢ » .~.'mga:%;g*igz.aa¢5ai.!&§».2:~:‘_'¥i5¥5.:i¢i“‘.
,Ir~T“'!§f~’,`1'-“FB” mv-E; »2-‘i'§4..z;
_ &i`%.5‘-71;"2'é?.
»
Ȣ -viz 'fraw
.»»=g~z»;
E Wa
,' 4. .€;€iiM
_,sf
»w;v».1;:r‘_a':
nf'
1
~»
1
' .1
.~
D1 '41-_;~x;_;;_r=i ,mf 2a=.:S‘~;*r ;.@Q5.Sv.=;=-.=_=__F=:iv_':;3>n~==,u»,u>'-?=;¢<:§'*~~:;?f Qfé-
.v wi 5
z g\'g=g1§=11|-a*,s1~=,§» a; §‘w,:§z§2;»~r.? 2,1-A£;l':*;¢
,.~
1 Nu. _==‘f“f»=»= 1 =~\ '=;~1=» 'Z-'E' -f3~f="- 1
1 »
v..¢¢| \=g<|Q;g-ag-€*:f;‘;3s'Z.s-.yaggmq
1'\-"\`- `““
'= '.,,=5,;-;:_<:
\=,;,» :,v-:;r==~~'=
_¢.e» =5_,-` =~ gggmc:
vf;isQffvj
;t'~~'=
;_;,,,-rg
¢.=f =»_:¢_ 3.3 .¢,-¢,». -_-_-»_5,_<: gq =. _-_ _ ~_
5.
er'-_ wx
f»-&"$~Ef*"E‘;f 2EF.£-""2}¥' 355°&¥1Kli?"l-?&fiW¢`:',‘i""52
,F
~
uE=1¢¢2@;»2_,mr¢;.¢;@=14{-@==;=s=§:¢e1f_.;=e@§1t:=;a;=-:f'=e.=:==;;=;»w=;.=@,5;vw:;>_in=s»¢-=-?fé=-e~@s@\2z?_~Lam?_?1;ea;;sffz. -g..»_5-‘_;f=g=_~~¢?:?;~v : 1' xii "C =’<¢‘f=; i.,e-,HECS
’2i=:2E_»€:z@;”e,'=s1'@‘L=!E"’~,2ff$2“é='€:@@;:#Q*=~‘"-‘#§";=f='e;'::`<;€3i\.!‘<§T<:5€2=~;f‘~_ ;5__.__ 2.2. 2 i? 5% aaa 5
-_ -W;‘,¢:s
=,;=;~»";;¢;:>,¢1: e1¢;=s';~~.,
§;»=_s;=y|_-;,@1.s\~1§=;
?!e*!F=f'#“~‘»-*QS
www
=‘i :.'~~'14
6 $155JF;hi|:?§‘2-'¢%='**`f'$.\wiil%.E
vm
; f
A v
ffm,
.€=?'u
1- ,
rr
'GI¥,',
-» “ -rn/;f‘:'~=*¢J "-1,'<Z' "~4'“ ?7|.'f»
.R _ ,_ .,... . ..___..5__ ,, W _ , .», ,wg-,,,..,.> _.._.,...,»_ ‘,.,.. , ,N-_4,- _ _ _»,,_, 5, ._ __4 ,_, f ._ _ _ . ¢._.,
\ §§°“~;\»__~5-.».mg_»;&v gggwfe in #r‘;<e§,._¢9 ,v 0. m
ov 'fu
,
;=2.=
»'
-' é-.3
|\ <15 g aw
ue4=<!,:=§-\t'_,,:§ wg.; g- ' 'fm-aa
A
~»@:5I»:NE=,;;:'f;_'g?4¥igi'j:;';j
51952, 1,7 .\`}>&'lf2*@‘&2
¢» `¢‘€.?'i$€N~.¢:$ii?Q1H4FQN52?4.QL‘iris37,H5Cali.§"`:“E»§`w:?1~?;$£-391“Phi
0 » ~. arf, Ima;'wmv-::.@~_.s=@s:;:@ _ ~ ¢»f»:;,=~:@;,..=<
,»;;.§-,:;~'¢s.=v.f.f .f;i-@'5
'!I'u:»1f`@|'§'
F:z.1'T%
1»
=:.;
"¢‘5¥5f
§a§,1Eé" H5
id"-'3v;\|i_.¥a.’¥
_
»
v
» 4| aa
=,5¢<..;:..‘i,.=
__<__~¢_=
‘_-S‘§~::`f_ -f==`f;_=.=J2;
‘e ~=:"~\; _-'.'-~-534-‘;.’-.¢n;.;_
>
|
1* ~'\ D. nufi' ‘i“a£|§If »F% ` `A LL%Fb‘r“`?»!A§'\“”\::‘l$ ‘f`?»:;u%‘¢‘Z'-i`3;*'Nii¥w;, 3' 27 i,"Lr?2‘,f$ 'HH-Eff ,"f$§»i~, .HV 3 .:£‘lIéwf£-Hal' 'Q 7,~\\Z»‘5-§"Z-T ‘[\f$’3`>T’5 1? .‘
,~>‘:‘\w. »»¢
w
=":'J 1.351
\
11 2:
Q-»
4_3
#gb 1; »@_ -jg .rggv
6¢1.§ :HI .¢.»..iL¢;'7.‘~ _'c-QL' _~_‘-v_»-. :‘g'g`@{< -j¢~‘-7§:;'~e'_g. Q __ .-3 _ .:;:._-;_;Q L_ .4551
ax, __
__ §_
gs"_“___
;_“':,}__s»¢_*“.; lf.
.. 1.~ u A., pi. fu .~
.;fu=:*Sif';§==v .1
:;v" '?* ;.‘5§?E¢%’:?E%f.\i§§f!§2*fi' £1255 $i3f"i£1?`?
.,\\.§_""“
_.
m
-mr: fs :,¢=-._f='~:p
\\..\p.~\1§1¢<»
_ `.!--
\ \=.wh
U.: \ '__u»
=.:1- ff’
_QL
L=,_~
¢ ~=,\ _:gf
vga!"
_ v¥>:\
_rpm 2:_
-_ML
..._
_qggfp
f '|fl?*l|5
-..-.I
‘-__¢’-r' _iz»-,r
. _._-,_ 2¢»-
wh_-Q inf
I -»,w
Ei?" \_ ’.¢_‘;w
wr,M uv. .2=.,`__
V; _.:~<¢,»_ '51 "“
.:?iEZ"‘xf'-156| ¥=:'.~....
gqgqg,
1: » aaa... _ \ A!--~r»-=.fv»e-E ¢~ ~r »1»‘~~n -V-W. m»,<=¢.=~..=;=,.,-»;- <9 .;~.-. ~=» ..~» ..~- ='-qw.
-“-‘QS wi ',;=;- .,_,»::-
=»
:vm 1J"l‘ | an a | a .
mn
“ ,,,,~.,~.,.,|,;,.»
___i,"5».;¢,_..»_.:: .;\i,.~-¢-,,=¢: ,,F@L‘i|;.
_».v~.\W.:|=-4-1,-.4
»_ wg;-=,»,-r:;:, _,-_ .»@s'<\'§=; ==s:._._f»;,-_f,»¢,,,,.,,f-f.;»,=:1...; .; Af-fw.-_;,;
1 n,
=-`f;f;'|,¢
s".,»..»¢1;,~-.ff
n
‘r,_},-
<4|l~- In _:.3.iF.'
' f.
Y., jf: Aff
;. _Mf ,nf/|V,»
- _-f.,~.» =- .__ \. _. , L :_ p
la
14-4
“A
H an
11| w,»//DW/m<; was vm
Bmw uenm L@u@r\ mv \ <»ff>»»
Ama Mamma Bofmmn my HJ,
§..w1jv“'¢|"f7rvsf ”g'f=r\" "w~'1
if, "
5.
'f
1
¥
ik
p.
*E
f'
Q,
H.
Q;
?€~°, ,
4
*f
T5
1?
9.
r
|\_- ~
2
i
U //* Aw V X ~{{
*W;XfA X ve _
` ' 4” ]”1 `
L M’ V
= 5 wg *; Yif;
H W Q; 12
f;'J2i>'1W f ` 'W U /ffvw' H* ‘Mg
"IL/ */ " “*” ff' I; Illigikflhil-’ §ff'17§§”7
K
1
//5
/\ / >I
//
\\
\
\_
M/
/\
&"“~=; ,_ _ X/ / ,1I,,,
//
/
1
§f
V/
//,!|_f_/ )
E ,` _///V " \\ V I
f\ l <7
f,
',,’\~_l
/f `
\,\
1,
\
_*Y \
|L
,/
\
\
/I fy
\
\
/'\
/
\
\
|\ _~-_|‘,,’f__V,/1\|/ fI/\>\\,.\\
\
\
.. or ;§_" "\-,I»-5
I/ ,
\ J ’~ ~~~,_
; ,T .~ ... , ,_ .__ _h w. _V 'rw \
u9,
~»\~_» `W,_,_,¢,._~\
‘ , »f», ’ af ,
~ , \s,,~\f _
_f ‘1-»;»=|",,~~;
» Mex,-, 4
‘a
»4§uQ E1
§
\
ns.
mpranfwawnumwmq,
snu¢Jury4,191s.|915
mn ana mnrn on pane( san rramism
Museum of ummm An. ta. wan"
ruunaacim fum Purcnasg
,'~.L¢..3 5: f_;»_
Qc
"Y
.,
5 ¢\ \ _
w/_” ,""
_/ / - \
, ` ~\ `T\ V V r |
\ ‘/ * _f ,~ ‘
\>~ ,<,/V » \ , if,
\ ///E" I \éi /f\Q%#
~ \ ;M ‘~ K
; // <
T k/
um
uv.
Ann; x. UN
-in-I
_
3/' /V6/;'
-QA
/'
/,_//4/g-_'/-~<- __,`_
7'f Eff/ jf*__<)ix`/.' 4/
','~., 1\
; /$7 V *fd
. _ _ ,y ~~
IX. LOCATION
1
A
w 'M
4
"\
11' i-*1fl \i
/ ._
‘zu .5
//X\
\~`
// \\
"», 1
\\ \\ /
// \\ /
/ \\
\
/ ,f
/
\ / %£
;\\\\
/
\/Q f
1
ok
~».~.
"`
,_ ww,
f%:
U
\
, M, f “
n
" ~ "Via
9-.hw - .W m.\/\ \)/\W/
,,,,`_;;,,,;*_% ‘_';;~.,,,:-PZ, _,uw V
' " ‘°"#-.,"‘~f>,"<f~V, `
.,<_,»f»».;;;1~n_ W. ~..,“;° I »
x
@ /'
»-2:'-»»~:~ '5°°“*~@ #~ ,T
B 'U nr -S4
<°~ »». ~¢,,~» ~=.. °V~rL;,‘2,"_j;‘<fZ'“
:§,;‘L7V~h=1;;=;,“§1’f~f~,,,‘ ~.° f~>=. ';:’, \ \
"~'14, " H
uw , ~,°“:;__<
¢»»’P~»~,,,=~~>»=>,.,,
ww ~ ~,., #19 "M » ~ W
=~=-Q",
¥.,'jf"°§,f,’
1>E§,"'r ng, ,
/llr "f ¢
:~f>:;v0,7=»,,~~,f~’;=»:§;;%.i ( i ~£,,€_w gf '
~»1., ~‘»¢..,, .Q cm ,6_____b >~.”?
2~""*P>1“,§f§5`f`
~ w '11-<,,~a “'»= r`~`
IZ* _y-
Q' 2 ‘U fm ‘<v~f”‘
<»,,,_,( lg.,
».£1‘,-§T17;_>$,."°#@~ _ _;».”"“>-~,a¢,,;3~"" " _
" f~“;‘;~», _ . , »°-,<=»~<..;~=»~=,,:~»-R,_;~=.,",
M J, /1. ' = ~»».,
_p<'-_;_<"~.,‘;‘_?~=.,Z‘~=»»..,‘;-;;>_,,"~»-,,,
mf E fmp _,IIn_B
,.-¥':;f Y" f;:=i~“‘=-. £2;.;-‘2;~-»~f‘*=-=~fiI:;~
~.., A
MM mf# »<,4;--'~=., 41; »~.,;»&=%; _
“'= Wf -ff *- ~»~.,,K_w
“Nw” "<».
"1 ~ ‘_
° “»i.¢,§°'=-§,,,:~>u¢,;'_;';>q- ~~.2;§;-2, ’;~J,,.,‘°f ~ \
//4' I \
"w,";;~f=<»“f = ~
,ww >~f»,,,, vm-`f,' ~.,_;_(=»\~. ""-~,,,‘f_,'-==<1
1 '°'4<;7`, V "I
'b
' l?,"`”i""“~':;~»
_ w-»=
M men.,"5'~,__'Z_';'».,MZ~u`:“'
/ ~.,¢,c»<,,wv»=
,kwa 'ww "“'~>.
”'<'~»-..,"~4»»“°'~»..
A* 5 '<°-r
‘"~`,, -..~
,N ,"°=-°§,”‘,;->+
,,;"'P><D,.
»~.,,, ”'~~/. `\\
f>~,,,,_4
” 1r
"'°wr
~¢¢‘°'wr,.,‘~r;,-
4»=»._,jfN~<q,w"~q=",_:w=,,,D}'f- :Q
/I \ ' ~=
'°‘»~= »~.,‘”~=»»Q”'f~»~ -~n,‘*-»"°‘--= “""==
_\`__\ \ A
`~\ , s '<
“-/~f »@,k.’°~m.,j;~~,2"‘“w2"*°'
/ “Q mmg """-1 1 ,,, ..,;~<»- .,,
\
T215 LOCAYKUN OF A LANE
I./una' Y
1
no.
,,_ . ._ 1
__-»~ ‘suvvw '
‘““2BT`“§
”$1ozmo\"
/
E
V-a
\
......¢..~.._...~-.~ . - -...».-...-...f
:_.-rg.;-.....--.::. ,.......- ....\
L".-'é'¢..-"“".R.'.-" -"»-"
.-..._ .....,~..-.-q :r:...;:::;-~_, §u1'...-.»-.:_=a
~....---..Zi
1I£~’1.'.'.27.'..T"..".L'='
--__--..........
»--f..».,..f...
,_-,-.............
='EE.1.-'......'°'.:.~
:""....""'......':."'....."'."',Q
"--'-.....____:¢___..
~ I-11 , f, ,,.,, ,
3fl'-'l1',,_-
7 _;:;:_;___
,.-~,M TA mn
f ». _- :__
._
A€°mwx,_i, ._~_ *_ ,<»' em
m.
__'::;
»= _' »-.»- I V" "‘
f§,,<e=»..
.='=,~.z»1r>
nz ` n
nw
Sol LeWitt
Wal/ Drawing # 232
A square, each side of which is equal to a tenth of the total Ienqth of three
lines, the first of which is drawn from a point halfway between the center of
the wall and a point halfway between the center of the wall and the upper left
corner and the midpoint of the left side to a point halfway between the center
of the wall and a point halfway between the center of the wall and the midpoint
of the bottom side; the second line is drawn from a point halfway between the
start of the first line and a point halfway between the center of the wall and
the upper right corner and the midpoint of the top side to the start of the first
line; the third line is drawn from a point halfway between a point equidistant
from the end of the first line, the start of the second line and a point halfway
between a point halfway between the center of the wall and the midpoint of the
riqht side and a point halfway between the center of the wall and the upper
riqht corner and the midpoint of the top side to the point where the first line
starts and the second line ends; the riqht side is located on the axis of, and
equidistant from two points, the first of which is located at a point halfway
between a point halfway between the center of the wall and the midpoint of the
right side and the lower right corner to a point halfway between a point
halfway between the midpoint of the top side and the upper right corner and
the start of the third line.
W rl D a q #1232 1975
Bla-:ku :ld c nl and black
Sv sq Lew ii Coll :con
< /
\
\\ \\
us
na.
ix;
\-WE;
%>a
. /~
I
§|{!|Y
‘,‘,-.-_--1
'A-__-:_-1
\li \-lI
vw
W »f,=M<
/X
ll '
1
,xi
-e
\1
| ;, "-24<
HH'
¢ ` ' §.~,‘
‘A |1f\~\ JY 1
’ ` _;_
l)'
. ‘_ ‘ _ _ W; ...,
. _ _ 4_5 > "J.¢!\e¢g§'.
' i
.41
. 2
' ‘|'|WWl*~ '
1f _'»z-¢';_`~,
v
ff ‘H ~> f m-vu oumow srmcrure, 1951.
convene. canuecmn Q1 New maxim
T., - F _,_
scare unwemxv, Las cruces.
f'"9_T"..,.
.` ¢_:- Q
' ',~,f` ¢".~
_'.o.»‘ .3
Ui* 145 wall Drawmq #335, 1980.
Wmle crayon nn black walls.
.' 5' .; - ~
..;1....~~`-5%
-Q A
_vs “'
.¢¢"‘. ~-~-- , We _ -. 5 :- J - - ‘ ~
. -v _ u vw; ..~ »:. _ , - *-__; .__ . _
Collecnon nl the me Gallery, Luna on.
M , nm-f~»m rows
As
me
,ii-`:' ~` " , T ~_
,./‘
7 ,»-
‘ ',;.;'~ _ ._;_"'
'J ..,»' '' -__
_, (»"_-gr V ` , , ;_ _ . J* ;` Y
141
me
fm mf Am,M<mm,~~<1 <m\¢>m;»<»fa~
Art (O\|m`\\ \Ma\(V7Hvq (}VaV1\\
me 150
151
M9 v ww, f we J
\f».»»»»1p¢>Lw.m \
1 /nj x M wugcf
,ww ~~,f¢~ ,H D wf. W
/ax»f~
15:
DPM;
|
|54
~,',;» » , ‘.3,;&-1?
, ‘ ‘ '’
wiaafmfg :;.<4 ,A ;.<. *
vs;
X Qwmumn mm;
‘ss
wh Gmmfwc rows
Y
um.
uaz.
@m~1f~»=\: rows
%
~|\,
F4
ms
ms
“ws
\\\\\\\\ \\\\\\\\ unwf ////f////7//.4
/ //W /.// `
sv
,_\\_\
.¢\¢Y `}`
,,,~, .1
we
vm
X 5 Mum cw <
wa. wan nfawmg #552 vsav
Cow mx wash cumesv of me a
nz-19|
x nfowvm rows
V »~~W
~ `»-rF-*ihr
-L,_ r
§
2 Q
a4
1 Unwff. E rg
1
§ 5`§\\ ji
'\ \ ,f\7!i'
V-ff‘iV*
§}i1\` 1; V,
é% _,;‘
‘ > ‘\s`‘ N
/Q.mv
'EAI
` ,\ §‘
J /', ` i`
5 \ i\ ,
E'
1 wt, ‘ /V
ws
v w'
mf?
V
, 1;§;-==f=é?~
~ |»‘7e '..,"_' "' '*_
` ""''
'°"
flf;
if
ig, :Q `
,rj fl
=. .e
fe'
IM.
P V;
Hg.
"{'
l,_If'
as, mu
lsamemf
<|n§¢a||anen
~?1` `
r|qmes_
vxewl.\9a\
ana penen nn eaper.
§‘ - venous muecuoni
fl "ff we mm Dem/ea from a cune, was.
` eekeu
1* .;_;_ enamel ofthe
CoHecl\un on slummum pane|_
un|vefe»\a|rmeaieen
lr.; < cemmm,ser\Tv|men,L»eqe,ae|q|um_
1'3we
U! ;
`‘i‘ wen
com me vfewmq
wash. asm, 19:39.
celleetinn oithe
,,
‘ Des Memes An Center (Colhn rme Arcs Fund), Des Mamas, mwa.
aumfm < ro ws
°-M. ?*:*==~>,
~ ~*>2~ Mr;
W, , 1
f\r
A F 0556
‘`frWS;
_ .»I _
»
,T
Ti*
:Y
S
?W
'gg ‘/
‘ge * ,_ " /
\
we
ws,
uw ww;
ana,
zm.
-- .
m. wa/r Dfawfnq #520, \9a9
cum mu wash Courtesy uv
me sms:
1. Ganmzrww rows ;u
if tv~.»`, .>
<~,, ‘
z.f
il#
1_
-4
Qi
Xs
*_
1
ms zm
me zo;
mv Pwarwa was
Gou.a<ne and uenm on paver
Lewm cm\e<\\0~
we Pwa/wa was
Guuashe on never Lewm Cmlmmn
/
N
ms Pvfam/m was
Gouache and perm an paper
zu W.;/r Drawmg M49 was
com vw wash coummn or the
Lewm cmmunn Mmsuere de Q <0mm\ma~\¢ |fan~;a\;e
Muses <1 an modems s\d`er\cor1\em
210, Pyfam/¢ was ummm de m we oe uéqg emqmm
emfne fm paw c@\\m»m» Q1 me
wmmev Museum of Amsman Arr, aa wa/r Dfawwq mei 1956
New YUYK, UUVCHESE, w\\V71u0dSY!0m Grav ana wmte mme couenmn
E me vammmq am smuuufe commmsg ol me Musée au weave Royal
andthe nfawmq comfwnee as m Monnme svussew
M
/
\\\\\\\“=
;,,
‘>in
L1
_' Qu
; H;
gi
5;
Q,
E
1
f ffwx ga
év /P" ~
#_ _, ;;f_.£.f1vg»-=,=~?f§
.fy
h"<~»,¢,
swag
as
iv i Xi
m
,/\ _\\&/,
/_,{_}> _
A \\;5,f _-li -'na
an ¢,,\\,,.1,\'~;uw~\V»@3
~»~» H. .Mn vw-\a\ wr-'»
D<\4=».1\==»,v-my .aw ,w- J' vw ,ww
\~ »,-f gm Mm »,~,~L,\ , ffwuf
me ,wsa,J,w@ nam ‘wa V -w am M \ _M-»»~, , _w~~»<,\»\
f1m\m»~a=w :»\\=-:~\o\»»r wp f Ga; nk »~mm»~m vw,-1\
v¢~\\~@/ »/W-..w ga mm ,w fm nw ;<» M, -~~,- v \nu¢¢< H
ww. vw pUm~@=» /»~>\nm§¢»~w c~~rf=n~»\ ,,\~ x\~m:~m» MW
rm mm: nq am swmwc ;~mfw»L :,,,»».1¢<»-n f`~\\ ‘vm <»»»~.~J wax
,>~¢\nez1fa.w~uiawmtx»= _ k\.\ »\;,»,\ >,,;
ULN
,_ n ___ _._T,.,_ _ ,
/AQ
El\E
w
EJ\E
l
Q
=_1Tf\E ji(/QE
M6 WA
4 Q »s <
DA UA
Qég 2/QE
z
aw. sms, |5157
Pamnea wean colmcuen or me
Dauas Museum nv An, qwl or the arm.
sums
zzu
L
wi, ,L
,Q ‘_
`
I
‘i
zzz
ua,
AVWSIQVGBM.
su
¥»I‘V`
1Iull. 1.
IM
r
Ill]
Aa..- ._ 1
A
»
viz,
, .g;;;@~
,,.¥\‘, `f
f- 5 ' ` ' iv
I ff. ‘
, , §;73f<
==‘.»?
,s_.‘v";
W' .V , 11. 4 \
Us 221
us
as \1a~i1\~~~¢;¢:3`8 '9B;
wma W gm we 5 vw Mgr
Co men 14 He-fm 5 nwmwx
wm\a<:n\u“\==
an
ma.
v!
c
4, .
QA
C)
»|
%/ zu
, @~\»,
»
\\
\\\
< Q;
.W
A K
/ ,» " ~ 4. \ :\ ~
/,,/' _I
/7”
C ; \,\ »\
f/ ~ \ § _ , M:
A* 7"T~f §",4 V# ‘ \: -\
0" /4f 's/5
, ` lg‘`\,,
_,
, ~
"~¥'_w<’ ` H ; ,
` "tp V 1
_ 1 .iff
zu
an
_
uA firé
4 pm/
wx ‘l\\\\\ "" “ 3 KWH? é"jI7L”v/,
1
A\f\
1 \\\\‘ 9
ff
\\-
‘x Y1\ ,`'A"
,\¥
\
. \;
\_
1\e
\\
\
J
Jw,
*Wm
Y \~ v@J3? ~f ~ r `=-=-i"%
\ » A- ~
'J '
14|
an
\< \ H
24. w.wc'.awm@ #452 mm
Bmw mu qw/ M hm
comes/ nr ~»» mm
zu.
zu
an
uf yvaf/1>/Mm sm mo
mnam tummy, U1
rf.m<Q; ummm mwqo
';\§q~ -» ;t. ,,~\¢v.n.;i1“
x|||.coN1'|r{ua
_....,__
P'-1 ~~a-an
i
%»i
.mg W; w-'
*X
ll*
I
\“\||\\
/ \\
Vgw' “\\\¢\w
:_ ; \\\E4§ 7§§
/\`
` \, \/7
W///N 9 /?»\
____ »~..__, '_ ,_
& “ ;.». .» ""
____ ._-_`
-~ “ f, ; J: ~
-1 xv”-f 1'j>~y11f~»g
gl _Q ‘___.-__.._.`,
'--~v\-°-
_.Aa _,gg ;-.___ *gag
3-
'w
-1- 1126 wwf; vu; <35-=;`;`V
,.. __
:_; 4.3.5.
-§ q;¢¢~¢__ ' _ W 7' » '°‘v=\¢,`_
,,a
` m mm
L mu L-.L\.n,.¢
¢
asa wa/1 D/awww a:52r, ms# asv my Pm .nw 5'.1»\,,»., re: wg/;
aww mu wash couenmn nv Amon ~», ww fu ww in »».v\~~ Q* :vw ;> , -.W
Leeuwamen me Nemeflanas :own mm mmf
XM cam Www mms ;v»<
P 'H
» ,Z L§"?'T,
* _ www "
‘5¢*'$ A M .E
"1 .v1§§ff”¢»_r;
I--32 fl '
}_
,Q »<§
,:_,.. ~
J My
`1,,, ,
,
Ef`¥"`$§t
i, W-5
»
&` £\@
,`l
. 'F
_.
-;°\ _.mx _~ %
V*
<i
»
\
P.
I3
N52 ‘
¥
I
n,
"_
‘kv
<.
H
~=
';f{"‘n
` y vall
¢ ><
_,n',‘2‘,;#
= 9 iii
N
__ _M
Lf?
vi
li
ig*
if f
\\
a \ 'if'
,g~=e,$
i
Q.
1
zu
Us :ww
an
><m.¢a>w~UoUsm»=Ms 1
@
\
ua
mm », N; ;»
us.
zss
cams
iw _
xw. semi!
\,
f
`~ ¢
¢
>f ‘
,
<§_
_ ;1 ’ ~ * ` f
an, ', "N‘
im * `
1
; \§
\
;\
7`
/V ug "‘V ` K
*__ _W
"";1<:_
,¢. _ 1 ~
~‘ ~f ,,\,-
V - - ' ;&“¥?..,
._* ,-~2f.:,_
-rms.
/;:~ » .. _'fm~- `¢\"P~‘
»-=,=~,.
:»~_ _ '
~»_<»_.~e~
_._. ..,,- \4\,r=\{¢-\~\~,»-vrf‘~-‘€~_ _;,»-,5_.\»..<i -._'?* '_ , \
.~=;-,\$ff=»-='=;;¢,~;, =f~f iw' -§'¢,Ms ~si% »_
x: ' 1 'jf~"'f»“'\:py.~f,_¢¢:Tun
,` '£~,.\,_QvE+'
~\
V A' . -5
~.~\,'fxg;:‘~’%’;@5‘:
_v ;»»,~. ~. __
\y'\\\\
gy; ,gg "_~,
26°
asv
\» MM
S, ,
A
?
ze;
am vL~wn~»~~.1 rx-Q15 vw
emu own mwzcsy UQ mf ay
fi?
i
1
'z
\" .li
'wr
26;
264
15. M Q N ~; ff yea;
;@\<~f \~~ ww @\\€\:\:~ Q' we we
w\=~\\, wx gp em MA »-aw
~:~@~»f Q nm nm;
as u.= rw ~¢ M6 mn,
tw M ,~» mm am z>- new
rm mmm-~ w Us Qgqsm J
LL.
/
266
nmmuw fm/»=
xv. onsu cn;
_ j§
av
a
Q 1 _. 3*
||f|| [lil
'la
41
_:__
f"I|i1||
I |f|lI
ellllIIllIIIIllllllllllllillllllllé E’ "' "
Ill" F!
1-
ln
',.~‘
_,E-~
"'
~j>
-» _ -I'
°
. I* "L : _
` U-
‘ ~* _s ’I __‘, I'_'...n'>_,_
-n' ._ '-_. \'- _.
‘,~|-I:
,, .
A( h;v"_ ," <
_~
¢'§
3 1
_<2.
=»
-l:;_
1-
_ .v._ 1 -.
Y¢,,-
l-.¢e§“-nz
. A gé
,<~_,_
>< ><
-_A .yn
*mn 1-~ I=|> \> < ><>
<l:*|5{)<)
;1»
,;:i;<
wits:
mm
.»»¢m\ f
mllug,
£§“
an
7 m
11.
,-\
»,.»~»,
zrz
zn.123454321Crassam1Tawer,
1954. Painted wood.CnI1ec\ion of me
vale University Ar! Gallery, New Haven,
the Janet ana Sameun Braguin Fund.
zu
zu 12 X 23 » 12 v99f»
Pamceu moon Dm/ate <o|\eck\on
as
., wr, W »
215
111
Mf
1 I`1 1
JJJJJJ
Us U, fv we*
>»m»..\1 ,-< M4 zmw ,L uw ,V
J Sw ww, W qw rw ` w,
\ 4.
*°5‘~.f$
J' gi?
5" _
.»\ ~
\, _U
: -,WW
\ \ \- _
r \,`;§x
L
»,,,
` `\\.`~Q ~K;..
"~~§‘\ ,\ '
*'~' - 1;3\
A_ ._ ` . ‘u _ .~ " `'>_~
='»~..~
'$.~ _ \_ .\_\
\|
f5
Q
1
V
,, ll
Y
1
my
an
W Swwofcn
XVII. CONCRETE
#H
»f
‘S
F
_i__,_.__._....____......._..Y..__...,..,m.__,.,.._,.,._§
lI 1
, . , _,.V_, ~,
ze;
gas
154 Ev » my
an my » nm »»f~~»,w:.»
sw wfm Jew wav
»~\~=n~»»»,v@\@ ww u ',u»q\f~»
2 ng cw 11=:uw\>~ »<,mwq'mf,»»,,
mfmv-, cu wzwcf or ~-1. mw ,fm
>fLw;¢s'anx -mfrxmu vJ\w~=~-uw:
I\
mv
1 vf; .. '~i ~~ W.
__ ...r "-_ 5 --?:Ԥg;'<,.. 3
' ‘->'_fY'¢§3¥‘
», ; 1,1 ~~.wg.x
_ ___. '.____
'@¥'»*~;§';‘ §'=,;a;;}`_
_._;__ ._ .gums _ &@1\., .;:\_,`=
_ -`_ -:-»‘,-.-
'_ 1 ..~_ ‘ 1:
‘ ' ,_
+ '_.¢,_.»,<»¢
.,_ ,»,_:_._, ‘
.__i_
~ +»"_‘.- _-_-,~:-'_' A ' __-V _ ~ ._ _ f
_(_ , _
@\
_ ,_.
1 '~ -4 ;.'__' I .__
_ ,.’~ "l~
_.~. _ __
_, --___
_ -H-\
.*`
1, ,‘
_.»
_
1.
f¢‘ .-
_J _, ~_ _
_. »
__ _"J, _j »_,, '1
-H' `.~.¢\ __¢f`1/.1"'
», w' ~- »
_ ; ,>_;,;<y'
/_ ~-V `\___
I. '_ V.; ‘ `
~.
I' , _ H X” ._, .
_ 4, (_
P/,» 'i
me
zen
m,r23:543Zr 1993
rowers mm Long :erm ww rmm me
.mm ao me vmsme snmpwn PM
Leeds, Enqma
vw;
_ _
,¥§‘T' "»l' i\,1 F I* , “";'
_
»
,- _ _, _Z ..-» ~ 7 -_ I
°: - ' 1,»_ =-' -' "F
FQQ _fl.
f.,
_ _ f , __ __~
- _~-_ _=<.
._A.
‘ t V; ~,
\
gyiaeq.
1 4_~ \'-z~
1
_»'
-\,_
af
_ ff Q
i?;'%‘|§ g:f4‘¢G‘@ ' f g _ U
_#__
' »‘;~=` f ',. »=
Q;»` 'vw
_A‘H ;‘E"
1 u '
,_l1-V`` `__'7?"Qi
Jlift?"
>;=3'f‘l
‘if‘f'*
.» _ ¢ U' ?= ig _ ,=' __~»~ ; ""‘“
's- ¢ "~ _ _
` ~*'Elf
V- ' AQ.
"` ‘
"‘_5'3
`*"”-:E ir ”
fjf J 5 q ._ 4 uf
s
92 f§§`§
`¢ _ » ¢
.._mq V ‘ *n W
. N.. _
lr Y
,A__
?\|~ _
_
‘Y a!'*T ' ‘f
~¢
.r~u.», »~ -f
~' uv: ‘ ' ` "
" "‘ I IIE..
ze;
aw n~»»,=-= 13°C
mwrpn <<~~n\@\e mmm Lo-u ww man
nom me must come \'vf»~<»» center
rw the \w;ua\ Am cmwmu< ow
-»--'
29; mms' Q95
£<>m@n= m<~<»< L¢m'\efm man
mm me arhs( ro mp Lunw\as\~L/fuer
_,,.-_ S<mor3v@<xsp\e\e LL/awqwuru
ocmww
an
ess
fn~f==m n
2%
uv
we
we rw mm mmm: wav
(umm nmw cm mmm fn nw
~;m=,)\ cm ff, m Av w@<_r\ nqvw
DC cm nr va :mam rw U mmm
an ww PV/dmv W;
fw»<»@\fmf» (~\w\¢f~rm
Emrwf,~w~~m@=.»~» »»4,|,\\~fn
mf. r,¢~~»m»n»
Us P»~a~».1,v: ww
cunwn u m c<f\»1-M M mf
»<».~,m»f vf M nm-» ;=a Hn.;
,(1 <|ax1‘iw. i » ~‘ L.. _ _ ,Q fg-,
,. |- '_ \.
f»
"°,..1‘
¢|~
»|, »\
._ .,¢
V; |1 \ ,n nf I -1; '», ' - f
1 z~, »> ' I . _ ,1 1 g:~,'- .L
(ni !VL .i ~' 4.
1
I 1’ :. '.'. »_ \.
` f' '°., ,,;
| , ‘ _ ‘_.` .' " I; . .__
- '.
“A; ' b I,~.iI;,\f§ I gg 14
_¢
1 A ;¢‘\ `;'~
1 _ ~=
Q * -I,
|1 ~ | -\g, ' ° A
-_
H '
f.
L
'‘ -_ . ,he 1, '..
i kg” 4?
‘u ,.
- ,_ I '. sf 1
L,
.F
Q
4 §1
Il :T *l 4:
!,‘.,;f
L.!'ffygs-gl
,' ‘ _. 'Q `:':""",
` - " -_ R 37 -'T 5
4 :.i_Vi
$
5%F ‘ fi'
.21 _|'
V4 H? " w'
W>,L?§|§. ; ~ ' _ Em;
§`E2’i‘§Q'f
!_ » D Q' ||
gf F " ffm;
sim I __ » ; -;,§ j1fmF*-ff
; Q K.: .4 _ ' fu' ’ ' “ 1
I __‘ ;., "“ '. J,
I If ' 1,
ll7*¢m
-, `z~
if,p~
~
'WW
. .»;;>;:»
\‘l ‘
~ QM"
": ff I A \
lv"
"` ‘I Q., '
m"~
*T* 'N 5`
_ (JY " QV," `
_L -..»4`
‘$~
Rn ~~
=M,,`\
€
:oc lm
au. m
\
am f~».;.,¢.ff ww Jo; ¢~@\:~w »>,,~J,M\@
Jun /f/www vfvq/~»>f@»: »»<»~;@~w ;»»»<»r: v<1<~v fm ma
www as 1995 n@~»-:5- umm Mm I.-fn my ‘ww :oz 'www Hvw mm. wp ~ .W ~, ww M 01 rn.
cmvumn num [num uw of was rw an Sm w :mv-H W .n wwe \.f»v\m1~~La§\ ww mv mxxu 3 ngm»-»m1.-vm-;\»~vpm; A
www/mmpu mr, Awpun spmn NM \m»,1<»~ r<»~<»-\5- ww If»|m~\\, nr \r»-A um m.,~<» mm ww;
W fnmafrf new
,¢¢
\ _i ‘vu
\
i\ /_\ `>/
:os
:ms
,.»
//Pi
Tf
.\
L_...
nov.
w1: -» » ' , _ §~' ,
fn; g ws-
4 (' I'
'ii&ij.*:,;;
° ' - V" . ‘ I' V' I ” .
L
»
»
_ I
>&4 2; ;¥l~z_' . fi féi- ~» .. » I
r
` W1 ai'
I
XVIII. CURVE5
A
>>`?
Q? A \ `\;_:`»
°>'e»l>~._` _
1 gil
1 41
4 _N_,‘}<~'~H`
E:
U5
, f`%v7~m=:
= _ L ‘gk
'
7`l
.33
mn
1"
> 4
,
}:‘d
*Q
If
\Q,
.»
115
( 'Z
‘r§`f\(»\
\£\‘~3£l@ Q
,W 'WW Y Q
"‘ '\.»,f< 5 ‘nw
.f
/" _-_ V
Jw
a
me
an
_ \ 'I
O_\
.U _4.__
"J
; qu# ~
y an
az; u 1
Um v W. M=\- F
\ naw 5\-.mm 1
12;
Xl ‘A ¢
ne
uw
ns
»
Fw, ,, _ ,
oauew New vm
an wa11of.gW1m; u91o11@1@qm\m>.w<1
w.;11u/awmq :¢9o9a<1<g1w1n111999
AW1-c nam: Cmmesv owne Mem
w1mm,amss@1§
an
,» 5 wwe
an
A\ I
Q,
Q*
--»-_
\1¢
Jas,
Us f. Lo
M,
Mgmlg
5, ` 5_1 n »
;»£'§;?
Lf\
If
Q
\
,~(`\ -J
\
l'Q
\, ~ xl
' , ff _ _
7,,-s d#-f-¥m»._-'
, ~;; ; F _=_» »
.11 L ' .' _,.~\»_,f-;,i
,-_:, 'F a 'f ®T5!’F'T. fi
I _ \ ,- .4 \h`*J'; W, ;\_».§’i_ _V _jf
J_ _ _Q _ + ,., \ __
_ “’,é,_»,fx);l£ » ,;(;'m'v‘ f J ¢;.
V3 , `»~l\i§{f ` H ' _r;|’,\- J-__\', 1 ,
.\ JeA PQ,‘-Hk-‘
_; .<I;¢ “‘3`A"
_ y J-~'¢.
~+-1~
.. ,_ »'_.'-,,.
»»» Q# .»
. .;_~
¢>~1'
_ ,. , _ `-Mm.-1 flufu,
iw
~' #L
5- `' ;-_ _,~. ' .'*_""_
1 iw-
2 =.~ `_ff-."“~*
_-.329 ;-. f.. <5
1-'»‘\f')'
\` ,_
. :;,,_,§»t-»_,;‘_=4='
' ~ 'fu " W " U
#fi» I'___ “__»; '_\_'= .‘ _7__*sf ‘Z f
_ '>.'¢*"}-1-'5
an
cam
(§
_-|-4.-.--:
, - -f-,, *_
0 0 on
MN
?Z°I°Z°Ii'Z€€°I°£v$ .Ill
IIIII
%Z°3~I~Z°I~I°}?Z€~?:é
IOIUIIIOIIOOIOOO
Y-IIIIIII
Illllllll
?.‘.'&°»'»'»'¢°!€§!€& IIIIIIIII
llllllll
?!&'!»‘~‘~'!~°!!!!&
UICOCOOOOOIOIIO ‘llllllil
-»- -1
PI-I°I'I°I~I~Z°I€€%?§
win:
YT
sssnssassaseigg
5
9
».|94 1* fl ,
a1. ,_ ZIEZ
_ `
3441. llllll
Q.
llilll
llllll
,.
3 ,EL w ;‘=
fi
,_
1¢’$5L 'If 'IIIIU
'CIO'
.,
4-- . ll`
,Z ~ . .sgasp
i. ll
,,.....
v ,'
4VV*
I* _
-2,
;;..::. Q-ffl”
J
M.; 5| =:f=a-v
| flllll IU it-=f=:: azz:1 J. \_.
aiéiilii Dui
| 2155251 ‘K .i L I” 1
fr.; Fas: anew -gggu
,190 ‘ 'A 1 \
'G
: =:§
szfifii
.....§- ._I~2.;'1===
L. ll ' , ._
.hr A!! hm.
‘H __ ma
is
. I. n 6? W
i
\ h rl/ -1|-|1;|=
I
1 ~_=__
..`
Q
, \r~1 ~.__
» ~, ». ‘Q r |r, '
:Sm-.kl`
V,\
wk »~
`
' )"`v\
Q1
\
S
1% ~f
$0
*J AW ~ .,
51 Hz
'J x,i';'$4|~;"
%
,,,.s| rg ~-»
;»-*ku
_iii
. _ 1Z-rv'S1, 4 >'f'1!`!f!
'....
_ f _ _ !;;
i'?fPGT@§°
i
'_J 2
W 'W '3
Q “ ‘4 ‘\.\
Q?‘ %,;_
nu/_*» .-.__
Ti§E.L.2l§~ gifzfa."
`.\
‘1 1!»~JL*
F_mg A 'Ewa
i\~ : "\ , as \~
Mfg
I I L 'I ' `3 .| 2: I Q 4 £3 <»
5% N
'
,Lf >
~ u-11,
I
_.ummm-ull!
’=
s1, `\
=
\
°iEf'§75¢}S]\\;
E' ` .nu
UUQll'l.
4i`
"gg 2;
_ 35%
‘ylllllmilih
lkI :\ 'udi
/. ~ ®
<@ .,
{‘
l“ Ext/
£5 f i \
fli,
\
1 1
#fl W
'
~ "zz ‘;~E:;, ; ` 1 ` “ 1 {
ffl A~': fl; ; if
.*_A I G °- T
21- Jf
_ "WL A -'
,Q ¢i;*§ W
uf. V AT _V_ _J
,, =
| v 'I
\f'>
il
jW 5 ' ?e , w é _ w/ M5
u v e ; \, A fE HX EHQ _'FIT/M ff A
‘ 7 r»
3 » 5=@ §""i"fff"“ ' = ,, A
j _:M ~ێ gi. ` ii
iég ééi ‘
» ~ U71 \\\ ' j
Q , » CQ §°¥§"§f“ '
F-Vvé E;-wi
f____‘ `& ff’ ; ~¢.¢'
f.'\"! ,
'
"Q fit- -‘iii
& §4
r“*1=-ff# ' A"+= ~ -“ » \ .1
_ `
» vi, L , I
\ ' li €'\ \ Y rv -1 \ l
,, ,
»
_V ,'‘I »§
`_
,
.,.
:ji
:
‘ ‘A».
" 'V _\_,,
_s , , _ _
5* " -'
`.. * ` ` 4' `
_
-_ H* .f ._,.. ,.._.--_
_Q
__ Y- , __
‘ 1|
» ~ f _rt! E
5 k , _,
@
/§‘
1 » °\‘;1» I \-_
f\ ‘vw \
} `\
ns;
fs
f».
\ll
t WW
#FHL
m,
L, 1
,*~
g 2_
‘ ` ` kv _ 1
N
"*. “ ,,P
Ql fx
“' 7' .~
` Y
1
»ff
- i»- /
fi , ' ¢45`
7,6 I 3 . -li; -f " ` 7
f| 1
iI `,` 1
L ,;,’ F
V.
4 1?
\_
,__
L
ass
155
umm mms
' HI
”FHHHF FF"
ln EF3gFF?“
I _A 4 M
¢ 1 .L ,
__,_.s.
¢””7”EFlE"
M”'T*H HE
ass ;V1».> was
Bm » am wma um\uqmw»~
wpw.a\e :m\e»\mn vw
;m~\f< s\ wmv 5 to nu
Sw ~\.wmm
'l'll!ll5lglllll1lllIlpl*‘F!|
lululugplullllllpll
~_ I __. FLIll!
L
\ 'FT' ~»IIII |
HKQQMH 3*
HH-§#nnr"M|
HH'1””F”M%|
gun-un-ul'l|'ll1l§|l'lvg,,!;i
I
#wvf'"nrq“!
'- ‘vii ‘
15
'
L
eh »\_~
;§_
‘n'\
V,
g -_
,_ -_.V ,__ 7 ==-1;
x -f=' '_ ' -_ ~ "
if u if T”
W
'H `
‘§¥
‘| ‘ “__ _ T1 i
w 4
‘ ' -_=
` _f
,Vi _
_-fi___
__ ‘ln
M
_ =`_,
\ » --`
.__ A
i --,_ 3;
~-»- -' -»
__--¢§'_
`_,-'
-;~
_ gi.
n, --3-fi.;
_
-ring
,T
_
‘ Y .i -
' - ,vi _ f , -;,-lr.; - ‘-' " 'Q -‘ ».
/‘ -¢» "M
» ‘?//
`¢_'\
, /,
=‘-/'F'
<_ .-
/,/_fdlii
-V '
, _,_-;»»'»;''
C 1
_K1;fy,
,_
¢r_'
, »¢.~ ~i:'»::.
,"'~<‘?//
`
) ,
'_,-
r 1, 1,,,¢,
_rf
_»-if
;j" ,_~.,}_
», ,4'
in
.Pr
,' ,‘/»
1"
‘[
4 1'
/ " - >- (L L' ,7 ’ "- H' I 1 ' AY fl/
v
,v§’:'~l,>;,.*n
“Hy /v’
.’/Y
,V-:'g/
’~,
/ff M,;:i'T
_A
'4_)__,
/ff ,'"""
y V, _,A
J 1 ff -AA"
'.,~‘ /ff
/S! -- <v'°" Q /"_ I 5 A51 .I,
I V. A*
"Q"-,Q
fi"/"4
/f/,{4¢'~"
,~
f"'<v,f;u/»,'
/
v\ l/ §,if
Q'
4, _ :;?;
if 4{?;”3°"§/
9//‘J
/(”/"
Q' ,~-_ f' fb
, ' f-‘~ ' _JQ,
'f.V»
'iff ,
ar, I_-,f _'' ',, .1
:¢_‘ ,~
- _ ,.- /5 .
fi,
'' ~/'71!.jl{'»yA
/
4’0 '
.r/321
/. /
- _.:_
_ I .'.'_4.
`H:,5f/fr;/_
yv/‘fWV;”"'»7f// '
4°
,OV/'
/; ‘ ,
_J
V/
`/ 'if/Tw »/' ”‘ qv* 'cm fi ~”» ..54‘f
.~I,f‘\v, K' ` 01% _ ‘
~Nu M;5 xc/
'/ 7| /. AI ,rérzliz
/,¢- 'Ay ," ,_ l;l,
f1;flf:
_ 1¥
4/// // ,/A.\\\
//7“
2'
/tif’I /////
»/.fj-,a
7é‘>
f/
/ \ \ \_\
, fy-
3Ti/Q /f", %
"¢f,14y,/yf
»
7/
, , ,/ //.//V,
,f-'ff
»
f ,,'.,/-(,'f;,¢1'
» Ji
fy' ,~)
/
\\
~_
/2;
_rf __,),_.4;
/
/," ,J
\\\
Q \ \ \\\`\ \
5 //,///54% \¥\ \\_\ ~\§\.\\\
'Q .' {?1./ "./// ` \j\\‘ \ \ \"§\\§ _Q \\
é §\\\,\\\
~/if/,ff/47
'<
>
\,
A `¥f§~ <\“_§ "\ X
4* / f//Q17/75472/\
x/ /.> '\\\~
`\@\\
_f '27
Y,-//_
»/ / /fl/f ay ‘ ';-,gif <\\
V/ _,__|.>-
\
’,¢{%/ \ »\$i\\`\\§\`\ *Q \\\S_l` \`.
,;_,, ’_~
,‘~/»'
'ff!
’/" ';/QW
/' 5 // 1,
f'; V/Q/’
\ §&\
A Y, -, fI, 35/,/(;/_;'
/ //' 2'3" f- \\»,
» I/ /~/,A
, / f¢12/I
}+;1<"_;§_
Z7-"`
»,j/,»-:.'
\.
H T/'ful/I.=,.;>f~\
_ ?“_*,,,_;-;,-
»f. 7`/'H
' -F ' /, 'f '.‘
¢¢,f`»»’_
f/¢'1~`
?¥1\&`
I ~&-~.~\i§~L
/Z/Zfzffg;/ff,,7if'W
,_ ~
//
1' ‘ ` Q?¥*¥~'§=f‘
p nk 4\
" "`\
_ \\§` `
__,. ` ._
~\~\\\Q
‘ _"
, 1- fzgf /, ; 1 /5 '/22' /_/fl,”-1';\ \ J -;:.1`¢,`
f, ,f1/1 ,, fy ~,.
§.`1\
\
~' ~ ~» \‘\\
~ 7~`\
1, » / , , ;,< /,= ,__- 1 1 /» _V /_ ,___ ’ _ ~ 1 l‘\ \»
;_\'.~_,_-/
5 iw ° 1///Qr'?'»~cf ,
16;
Lwnf <,oU»<><f;
7
ass
N
asa
Swww 5
.,< rw ~~ nw
no
Qlqw gig”
/%§g?,%;\(?@(> Kgéq
m. w»@.n/W am Q90
5Qm».r»¢ of ,wer Come wow
Jung w r\<@\:\m;\, sam)
m w=u;maf G~.1,vQ99
i3\»u@mc on capwr L=-Wm mm ru
,V
\|13}| 1
Y
N_
\
H
>i
V
A
|,LI _`Vfy,
5.`
5
..~£1
\I''1
xi "'*¥i‘.l*,af
’5
V _ . 1
,V'Q»3' 1\
‘ "ff
\
,_
315.
mum; 5 vusmws
gn; ‘y
,__ M
,W no
.|||||,
V5 ,.
as
_
af' _
IE :vi
"i l_'|
_i ` I ._:-.--‘
iv
(P
-<~;'2F'1'
osn<ssosL u
U|M1\Hl>/li| _
»BI_
lmzmlnmi &%
m;
@nnu|1s |
IIIIIIIIII
:alll Muni
Aussmz Qllllill
-lslllalnlusn-n
Us
§»¢@l
'mm \§g¢\`
WESERBURG
nv 'mn
cunss
ca
B NLE
BREMEN VIA l I0 I I0 N
SE
SOL LEWITT M UNIIULN CENTEWS MOSTLY MUZART FESTIVAL
WALLDRAWIHGS
STEDELIJK MUSEUM
AMSTERDAM
2.5 T/M 25.4. 1984
STBUGTUBES
\NI
_ \\
VAN ABBEMU UM
EIHDHOVEN
5.3 T/M 15.4. 1984
APPENDIX: THE WRITINGS OF SOL LEWITT
,F,-,_
PARAGRAPHS on couczrrukl. ART
The editor has written me that he is in favor of avoidinq "the because they seem inevitable. In terms of Idea the artist ls free
notion that the artlst is a kind oi ape that has to be explained even to surprlse hlrnsell. ideas are discovered by lntultlon.
by the Civililed critic." This should be good news to both artists
‘ Some ideas are logical in conception and illogical perceptually
and apes. With trlls assurance I hope to tustily his confidence. To
continue a baseball metaotlor (one artist wanted to hit the Dall out
of the park, another to Stay loose at the Dlate and hit the ball What the work of art looks like isn‘t too important. It has to look
where it was pitched), I am grateful for the opportunity to strike like something if it has physical form. No matter what form it may
out for myself. finally have it must oegrn with an idea. lt is the process of concepc
tion and realization with which the artist is concerned. once given
lwill refer to the kind ol art in which I am involved as Conceptual art. physical reality bythe artist the work is open to the perception of
In conceptual art the idea ur Concept ls the most Important aspect all, including the artist. tl use the word "perception" to mean the
ol the work.' When an artist uses a conceptual forrn of art, It apprehension of the sense data, the objective understanding of
means that all of the planning and decisions are made beforehand the idea and simultaneously a supyective interpretation ol both.)
and the execution is a perfunctory affair. The idea becomes a The work of art can only be perceived after It is completed.
machine that makes the art. This kind of art is not theoretical or
illustrative of theories: it is intuitive, it is Involved with all types of Art that is meant for the sensation ofthe eye primarily would be
mental processes and it is purposeloss. It is usually lree from the called perceptual rather than conceptual. This would include most
dependence on the Sklll of the artist as a Craftsman. lt is the objec' optical, kinetic, light, and color art.
tive ofthe artist who is concerned with conceptual art tn make his
work mentally interestinq to the spectélton arid therefore usually Since the functions of conception and perception are contradictory
he would want it to become emotionally dry. There is no reason to lone prec, the other postcfact) the artist would mitigate his idea hy
suppose however, that the conceptual artist is out to oore the applying suoyochvo yudgment to it. ll the artist wishes to explore
viewen It ls only the expectation of an emotlonal kick, to which one his idea thoroughly, then arortrary or chance decisions would pe
conditioned to expressiorlist art ls accustomed, that would deter kept to a minlmurn, while caprice, taste and other whimsies would
the viewer from perceiving this art. pe eliminated from the making ofthe art, The work does not necc
essarily have to he rejected if it does not look well, Sometimes
~in other lorms dl art the concept may be changed in the process ol execution.
what is initially thought to be awkward will eventually be visually
pleasing.
Conceptual art is not necessarily logical. The logic of a piece or
series of pieces is a device that is used at times only to be ruined. To work with a plan that rs pre-set is one way of avoiding
Logic may be used to camouflage the real intent of the artist, to suorectivity. it also ooviates the necessity of designing each work
lull the viewer into the belief that he understands the work, or to in turn. The plan would design the work. some plans would require
infer a paradoxical situation (such as logic vs. llloqicl-' The Ideas millions of variations, and some a limited numoer, out ootn are
need not be complex. Most ideas that are successful are ludicrously unite. Other plans imply infinity. ln each case howevec the artist
simple. Successful ideas generally have the alwearance of simplicity would Select the basic lol‘lTl and rules that would qoverh the Solutlon
sul Lewin
New materials are one oi the great atflictions oi contemporary art. dimensions. Ideas may also be stated with numbers, photographs,
some artists confuse new materials with new ideas. There ls nothf or words or any way the artist chooses, the form being unimportant.
ing worse than seeing art that wallows in gaudy baubles. By and
large most artists who are attracted to these materials are the These paragraphs are not intended as categorical imperatives hut
ones who lack the stringency of mind that would enable them to the ideas stated are as Close as possible to my thinking at this
use the materials well. It takes a good artist to use new materials tlme.‘ These ideas are the result or my work as an artist and are
and make them into a work ol art. The danger ls, I think, in making sublect to change as my experience changes. I have tried to state
the phvsicality ol the materials so important that it becomes the them with as much clarity as possible. If the statements l make are
idea ofthe work (another kind of expressionlsm). unclear rt may mean the thrnkrno rs unclear. Even while wrrtrnq
these ideas there seemed to be obvious inconsistencies (which l
rhreealmensional art or any krno is s physical lact. This physicall have tried to correct, out others will propaply slip byl. l do not
ty is its most obvious and expressive content. Conceptual art advocate a Conceptual lorrn oi art for all artists. I have found that
is made to engage the mind or the viewer rather than hls eye or it has worked well for me while other ways have not. It ls one
emotions. The Dnysicallty of a threerdirnensional object then way ol making art; other ways suit other artists. Nor do l think all
becomes a contradiction to its non-emotive intent. Color, surface, conceptual art ments the viewers attention Conceptual art rs
texture, and shape only emohasile the physical aspects of the good only when the roes ls good.
work. Anything that calls attention to and Interests the viewer ln
-l dislike the term “work ol art“ lsecauso l am not rn lavor ol work and the terrn
this physicaltty is a deterrent to our understanding or the idea and sounds pretentious aut l non t know what olner terrn to use
is used as an expressive device. The conceptual artist would want
to ameliorate this emphasis orl rnateriality as much as possible or
to use lt In a paradoxical way. (To convert it into an idea.) This kind
or art then, should be stated with the most economy or means. Any
idea that is better stated in two dimensions should not be in three Reprinted from Artforum, 5 no. 10 (June l967li 79-83.
1. Conceptual Artists are rnystlcs rather than ratlonalrsts 6. If the artist changes his mind midway through the execution
rney leap to conclusions that logic cannot reach. or the piece he compromises the result and repeats past results,
2. Rational judgments repeat rational iudgments, 7. The artlst‘s will is secondary to the process he initiates
from idea to completion. His wilfulness may only he ego.
3. illogical judgments lead to new experience.
S. When words such as Dalntlnq and sculpture are Used. they
4, Formal Art is essentially rational. connote a whole tradition and imply a consequent acceptance
of this tradition, thus Dlaclnq Iirnltatlons onthe artlst who would
5, Irrational thoughts should he followed absolutely and logically. be reluctant to make art that goes beyond the limitations.
12. For each work of art that becomes physical there are many 25, Ah artist may perceive the art of others better than his own
variations that do not.
27. The concept of a work ol art may involve the matter ofthe
13. A work of art may be understood as a conductor from the piece or the process in which it is made.
art|st's m|nd to the viewers. But it may never reach the viewen
or It may never leave the artlSt'5 rnlnd. 28. Once the idea ofthe piece is established in the artists mind
and the final form is decided. the process is carried out blindly.
14. rne words df one artist td another may induce an ideas chain, There are many side-eflects that the artist cannot imagine,
rl they snare ine same concept, These may be used as ideas lor new works.
15. Since no form is intrinsically Superior to another, the artist 29. The process is mechanical and should not be tampered with.
may use any form, from an expression of words, (written or It should run its course.
spoken) to physical reality, equally.
30. There are many elements involved in a work of art.
16, ir words are used, and iney proceed from ideas about art. The most important are the most obvious.
then they are art and not literature, numbers are not mathematics,
31. ll an artist uses the same lorm in a group of works, and
17. All ideas are art il they are concerned with art and fall within changes the material. one would assume the artist's concept
the conventions of art. involved the material.
le. one usually understands ure art dv the past by applying 32. Banal ideas cannot be rescued by beautiful execution.
the conventions ot the present thus misunderstanding the art
of the Dast. 33. It is difficult to bungle a good idea.
19. The conventions ol art are altered by works ol art. 34. When an artist learns his cralt too well he makes slick art.
20. Successful art changes our understanding of the conventions 35. These sentences comment on art, but are not art_
by altering our perceptions.
21. Perception ol ideas leads to new ideas. Reprinted from Art~Lanquage 1, no. 1 (May 1969): ll-13.
sal Lewin
SERIAL PROJECT NO. I
Serial compositions are multipart pieces with regulated chanqes. The premise qovernlnq tnis series ls: to place one lorm wlthln
The differences between the parts are the subject of the cumposl another and lnclude all major varlatlons ln two and three dlmenr
tion. ll some parts remain constant lt ls to punctuate the changes. sions. This ls to be done ln the most succlnct manneh using the
The entire work would contain subdivisions which Could oe auton‘ fewest measurements, It would be a flrllte series uslnq the square
omous but which Eomprlse the whole. The autonomous parts are and cube as its syntax. A more complex lorm would be too lnter
units, rows, sets or any loqitjal division that would he read as a estinq In ltsell and obstruct the meanlnq ol the whole. There ls no
Covrlolete thouqht. The serles would he read by the vlewer ln a linear need to lnvent new forms. The square and cube are eiliclent and
ornarrativervlannerllZ345;ABBCCC;l23,312,Z31,l32, symmetrical In order to free a square wlthlrl a Iarqer square, the
213.3 2 1) even though ln its llnal lorm many oi these sets would larger square ls ulvluea into mne equal parts. The center square
be operatlng simultaneously, making comprehension dlnlcult, The would be equally alstant lram me outer square arm exactly cen'
aim 0| the artist would not be to lnstruct the vlewer but to give hlm tered. A slnqle measurement ls used as the basis lor the serles.
Information. Whether the vlewer understands this inlormation ls There rs a large verslarl and a small verslan. ln the larger, ma basic
incidental to the artist; he cannot foresee the understandlno of all measure is 28" (A 28" tube can be made ln one Dlece to llt through
his viewers. He would follow his predetermined premise to its con' the Smallest doorf3D"). The outer measure was formed by multl'
cluslon avoiding sublectivity. Chance, taste, or unconsciously remem plying za" ny 3 and suotractlno the wrath ol the material <1 Val'
bered lorms would play no part in the outcome. The serial artist the pieces were constructed oi l ‘/z" square alumlnurn tublnq) 25"
does not attempt to produce a beautiful or mysterious nhlect but X 3 = B4 - (1 l/2 + 'l ‘/2) = Bl". The two measurements for the large
funetlans merely as a clerk Cataloqtnq the results ot his premise. set are 28" and Bl", All ul the pleces in the series Contain these
measurements (The tlrst pleces are 1 '/1" high because that is the
height ofthe metal). The two measurements in the smaller set are
I3 3/B and 4 I/B",
M..
the scope oi the lirst premise. The lirst variation is a square within variations on open or closed forms,
a square. The other variations lollow: a cube within a square, a
square within a cube, an outer form raised to the height of the closed inside eve" Oulilde
inner cube, the inner cube raised to the height ol the outen larger closed outside f|°5f° °Uf5“1E
cube, a cube within a cube and all cross-matching of these lorms. closed inside
open inside
The first set contains mne pieces. These pieces are laid out on a noen outside open outsioe
grid. The grid equalizes the spacing and makes all ol the pieces
and spaces between ol equal importance. The individual pieces are
arranged in three rows of three iorms each. In each row there are In cases in which the same plane is occupied bv both the inside
three ditierenl parts and three parts that are the same. The inner and outside forms, the inside plane takes precedence, This is done
forms oi one row ol three are read in sequence, as are the outer so that there is more information given the viewec lf it were the
forms. The possible permutations ot these rows are: 1 2 3, 4 5 6, obverse more forms would he invisible, impeding the viewers
7B9,l47,258,369,l5'9.357. understanding oi the whole set. When the larger form is closed and
the too ol the smaller form is not on the same plane as the larger
but Iowerfthe smaller form is placed inside, It the viewer cannot
The measurements lor the large set are: see the interior lorm he may believe it is there or not but he knows
which form he believes is there or not there. The evidence given
him bythe other pieces in the set. and by reference to other sets
i mine 2a“ 1 Za" 2 inside 25" 1 2a“ 1 za" 3 inside 2s“ 1 2a“ 1 av*
Ooisioe au 1 av* outside av* 1 av* outside an 1 ev*
will inlorm him as to what should he there. The sets are grouped in
the most symmetrical way possible. Each set mirrors the others,
4 inside za* 1 2a“ 5 inside za" 1 25" 1 25" 6 inside za“ 1 2a“ 1 si"
with the higher pieces concentrated in the center, The grouping of
Outside ei" 1 si" 1 ze" outside av* 1 av* 1 2a“ Outside av* 1 av* 1 23"
sets allows additional sets to become obvious such as: A9, E9, (29,
1 inside 25“ 1 2a“ B. lnsine 23" 1 25" 1 25" 9 Inside ze" 1 25" 1 an
D9, or AZSBBZEB,
Outside si" 1 ai" 1 ai" Uulside av* 1 ai" 1 ai" Outside ai" 1 ei" 1 ai"
D C
for the small set sonstliuie 13 ’/1" lm ai" and 4 5/5" for 2a“ Reprinted lrom Aspen Magazine, section 17, nos. 5~6,1966,r\.p.
`123321
789 456654
456 789987
7B9987
123 456654
123321
sol Lewin
AB
WALL DRAWINGS
l wanted to do a work of art that was as two-dimensional Dlllerent draftsmen produce lines darker or lighter and closer
as possible. or fartner apart. As long as they are consistent there is no
prelerence.
It seems more natural to work directly on walls than to make
a construction, to work on that, and then out the construction Various combinations of olack lines produce dillerent tonalitlesi
on the wall. combinations of colored lines produce dlllerent colors.
The physical properties or the wall: height, length, color, material, The lour basic ltmds of straight lines used are vertical, horizontal
architectural conditions and intrusions, are a necessary part ol 45° diagonal tell to rignt, and 45° diagonal right to left,
the wall drawings.
When color drawings are done, a flat white wall ls preferable.
Different kinds 0| walls make for different kinds of drawings. The colors are yellow, red, blue, and black, tne colors used
in printing.
lmperfectlons on the wall surlace are occasionally apparent alter
the drawinq iS comoleted, These should he considered a part of When a drawing is done uslnq Only hiack |lneS, the Same tonallty
the wall drawing, should he maintained throughout the plane ln order t0 maintain
the integrity ol the watl surface.
The best surface to draw on is plasten the worst is brick,
hut both have been used. An ink drawing on paper accompanies tne wall drawing.
It is rendered ny the artist while the wall drawing is rendered
Most walls have holes. cracks. Dumos. qrease marks. are not oy assistants.
level or Square, and have Various architectural ecrjentrlrjltles.
rne ink drawing is a plan for out not a reproduction ol the
The handicap in using walls is tnat the artist is at tne mercy wall drawing; the wall drawing is not a reproduction ol the
of the architect. ink drawing. Each is equally important.
The drawing is done rather lightly, using nard graphite so It I5 posslhie to think ofthe Sides of Simple three'dlrTlenSiOna|
that the lines become, BS much as possible, a part of the wall objects as walls and draw on them.
surface, visually.
rne wall drawing is a permanent installation, until destroyed.
Either the entire wall or a portion Is used, but the dimensions Once something is done, it cannot be undone.
ofthe wall and its surface have a Conslderabie effect on
the outcome.
When large walls are used the viewer would see the drawings Reprinted from SOILEWIII (New York: The Museum ol
in sections sequentially, and not the wall as a whole. Modern Art, 1978), p. 169.
The artist conceives and plans the wall drawing. lt is realized hy Neither lines nor words are ideas, they are the means by which
drattsmen, (the artist can act as his own draltsman). the plan ideas are conveyed.
The best that can be said tor either the square or the cube is that devices from which the work may proceed. The use of a square or
they are relatively uninteresting in themselves. Being basic repre' cube obviates the necessity of inventing other lorms and reserves
Sentations ol two- and three>dimensional lorm, they lack the their use for invention.
expressive lorce of other more interesting forms and shapes. They
are standard and universally recognized, no initiation being
required of the viewer; it is immediately evident that a square is a Reprinted from Lucy R. Lippard et al., "Homage to the Square,"
square and a cube, a cube. Released lrom the necessity ol being Art in America 55. no. 4 (July-August l96`I): 54.
significant in themselves, they can be better used as grammatical [LeWitt's contribution was originally untitled]
1 A sol Lewin
ZIGGURATS
The most common type of office building seen in midtown when seen from the upper floors of other buildings, are especially
Manhattan is built in the zlogurat style with multiple set-backs, impressive. The new zoning code allows slabstype oulldings, and
This design was to conform with the New York Zoning Code of 1916 also stipulates tnat a certain amount of plaza space must also ne
to 1963. The original purpose ofthe Set'baCks was to allow Sunlight allotted. Tnls will permit more flexibility in site planning and more
into the street and free Circulation bf aili ln 1915 this was feasible, space on the ground level.
but as the buildings became higher the regulations became Ubsulete. Besides oelng impressive in design, tne ztggurat allowed flexi
Howeveli since they were in effect during the postwar building bility to the renting agent who could offer higher floors with less
boom. tne result is a unique group of ouildlngs that give the area a floor sbaee to Cgrrlllanles that desired the prestige bf nelgnt and
distinctive l0Ok. did not want to share the floor with another Organization. This
The zoning code pre-conceived the design ofthe ziggurats, just design also made available more terraces and more sunlight,
as an idea might give any work oi art its outer boundaries and The ziggurats were mostly built in tne fifties as part of the
remove arbitrary and capricious decisions. In many cases this is a business expansion following World War ll. They were built guicnly.
liberating rather lnan a confining form. The ziggurat buildings con eneaply, and not very well, reflecting a desire for an immediate
form to the code. yet no two are alike; the slab-type buildings return on tne investment and a sufficient supply of floor-space.
which now are being built seem more unlfbrrn. Now architects do not tninu very highly of the ziggurat bulld
The Zoning code established a deslqrl that has much intrinsic ings. since they are no longer forced by the zoning code to provide
value. The ziggurat buildings are heavy looking, stable, inert and set-backs, they will probably no longer build them. ironically, the
eartnoound. There is noltnng graceful or lignt-weignted here as in new Whitney Museum is an upside down ziggurat and is considered
the slab buildings. There is also El Ioqic in the continually smaller high-style, while the office buildings are not thought to be very
set-backs, which allow for intricate geometric patterns. Ey having classy. ln view of this obvious suspension of iudqment it might be
to conform to this rather rigid code, aestheticism was avoided, but time to take a new look at the ziggurats. Many will be seen to be
tne code was flexible enougn to allow great originality of design. valuable works of art.
New materials were not necessary. The earlier brick buildings were
some of the most successful of the genre, they are particularly
opaque and homely. The slain-type buildings on the other nand,
established by the rules of taste and aesthetlclsrn, require new
materials for variety. The ziggurat buildings are most satisfying
when seen from a little distance (two or three blocks) so that the
massive deslqll ls seen. This is difficult in New York, but the Zlgguratsr Reprinted from Arts Magazine 41, l'lu.1 (November 1966): 24-25.
aff/ A `
\»_._~A_
‘V
"‘&=~. '
WU 2
BIBLIOGRAPHY
amprfur publications hy an urrur, this durumuun The Lururum ufsrnughr, Nnl-Slmzghr und snr/rru s.»1Lrwm. Fnrnu znrrrwdfrum u Curr, rum
W Y¢n1s|977 rv 1999. For :he yznrs 1965 101976, Lim and AH mfr Combinations, New vnrur Vxenna: uuluriu Pnkurrh, russ um by
Sze Ahdn Legg et aL, Sol LeWitl (New York: luhn wnbnr Gall:ry.1976. Fdrdrnuud Schmatz; phuurgrnpnr by Vrbligang
'rm Museum ufmudrrn An, ws). Modular urnwrugs. Geneva: Adelanrr run wuessnm
rurmnbnrg, me. Wrxanans rm 1 run snr: /uurr. Un Kuwuru Flurrnrr
Brick wuu. New vur1<= Tanglewood Frm. |977 Exempla Br Fxil sr Zona Ardum, was.
Publltalions hy KhE Artist cuzur Gndn New York; Mu1nples,1g77. Lrnur 6 furmrr. Pans; crnldne Yvon Lurnburr,
Five cum on rwmryrrirr Squares, Bari, Italy ruse
Artist Books Gallrnz Mzrilcna Bonomn, rm. cube; A cubf Pnurngmplrrd hy cum: llurbnrr
Fuur sruzr Krnd; dfuurr und cdldur London und Using Nrnr Lrghr suurrrr und AN mu
sn u/1-14 A. Los Ang¢1¢§¢ Aa Gnunry, rgss. New vurln Lurun Gallery, Studxo 1n¢¢rnnnunn|, cunrlnnauunr New\/nrk, R<1me,and culugnn
Four Basic [Gust nfSrmighl Lines, London: und Paul Davxd Prusr, 1977. Jann Vskbcr Gzl|:ry,Ed|z|un1Marin vzururu,
Studio International, wsu Phn1oGrids,New York: Paul nu/id Prm. |977 and wnldrer xnnag, |990
49 Thru-Parr vnrumunr Using nm Dlffuznr Gnmrrrrrr rrgurrr and curry. New York: Blnrlr cuunrhen Pans- Nouvelles ddiriunr segurer,
[Grub ufcuurr, 1967-reed. zurarru Bruno Harry N. Abrams, rm. rm.
Bisrhdfbugur, msg. open cfumerrrr srrufrumf run srumerrrr sul Lewin. ruur fiuzurr und AH Then curnbrnuurnu
Four Bas: Calnurx and Their Cr/mhimzrians. Strurtures and Thur Combxnutxnns. London: 1994.Pans: Paul arnndunr and Galerie Toner,
1unddu= Lisson Publirnrrunr. 1971. Nadruxns und Fiona Lugsdnn, Lurun Gallcry, |9941
Arcs, Circlrei, and Gmiv. Bern znd Paris: |979 szurzr squurrr. Purin Arurrr Book Inmnnuunal.
Kunsthalle Bern and Paul Bianchini. \971. /xu ruurrnrr cunrbrnnuunr ufsdr Grmnfrnr 1995,
anus rs Lignrs. Paris; Galerie Yvon Lnnrbur, rm. ngurun Tokyu: cnlnru wurura. wad. um cubrrosrnldnrn.:;¢rnnnnyrc.rnr1,ru9u.
sir WullDvaw1ngs:A1r.< wrrh srmighr Lim. Auruurugrupm New York und Boston* Mump1¢r sul Lei/An: Flat and Ginny squurrr Qhunr,
Nat-Straight Lines and Bmkm Lines. Houston: and Land M_K.1°<>rf.rgsd. Be1gxum:Imschoo\,1998.
cumk anuery, 1973. curlr righr num, Nw Yurxn Rmulr and Hunan ufridrur. murugru Museum of
Wall Drawings: Seventzen Squares uffrghr Peer Muluples. wsu. Comemporary Arr, 1999.
with Sixteen Lines and One An. Portland: sdr Gzamnrir rfgurur und Au Thexr Double
Portland Center for the Visual Arts, \973. Cambinarxorm Pnru. Gnlrru vvnn Lambert,
Other Artworks Published bythe Ar\i5!
(llzlim Edition: Diaussene quadmn mn stdin \9B0.
una gd un nrrn. Munn; Galleria Tosclli, 1974), sunruf und sururr ur Prawn. Nw York; nurnla
"Serial vrdiufr Nu. rf' /fuprn Mugnzxnc, secnon ry,
AVIS and Linei. Lausanne and Paris: Edilxuns des und Mulupks, wsu.
uns sw. 1966. n,p.
Mzssons znd Galen: Yvon Lambert, l974~ Three srrufmrun Wd-ryan. zurrdu ».nn¢rnnne
“Lmcs and curnbrnnuunr ufunnr," Arr <» Prnurr.
Dr/1wing.S`:|'izsL IL III, IIIIA and B. Tunn and vurnn, rgsr.
buurrur rs, wsu.
Dussrldorh Galleria Sperone and Galerie znwurrir nruwrngs. New York: Pnuln Cooper
“funded Bu11eran."Ar¢ an Pn1)err,bu1le\in 43, um.
Konrad Fischer, 1974. Gallrry und Iohn Weber Gallery, um. "Ten Thousand Lrnnr/sur 'rhnusnnd Two
Incamplae opun cum. Ncw York: luhn web" vrnn pmnr derxvure du un rung. norm- ugu
Hundred and Fafryrvave Lines." Arr <<> Pmrm,
Ga.ll*f% 1974, Ferranti, msn.
bullenn 32, ran.
The Lnumun ufzighr P.>iuu_ wurhingrdn, D.c.= Lrgm en qunrrr drrmfunr ex ruurur leurs murin
“Lrn=§ and Lands, Arcs and /urs. and Lands and
Max Prdrurnh cnunry, rm. nrunmr, sdrdunuur. France. cnc Mum dnrr
Arcs." Arr d~ Prrum, bullenn 6n,197z.
The Lamtinn ufungu. London: Lrmn comrmpuram. \9B3,
“1_unngrnpn§ und wnu Drawing." Nova scum
Publimxions, 1974. From Munrururu ro spulrru. nrrernzner rm,
College ufAr\ and Design. Hal\fax.197z.
Ld Pusizium di nu jigure gwmmirhe/nu Lunmun Eandnuvnn and wasp. du Nnhrrlnndn
sul Lrvmf, Bun. I\aly: Gallena Murdcnu Bonomur
afThr:: G¢um¢mr Frgurur. Turin: Gallena sudelijlr van Abbernurrurn und Opcnbaar
|973
sp¢ruu=, rum. K|1l‘|5Kb¢Zi!. 1984.
~‘vrer Muurrrkdnrngrn/Quurru owns murauri'
Squares with Skies and Camus 771m Off Brussels: surzrmn. Chagny. Pram: Au fond de In ruur
Arr <9 Pmrm. Brumlu Gnlenn MTL, um.
Galerie MTL, 1974 A drmle,1984.
“Locanon of Thru G=drn=rrrr Fugurur." Brussels.
Grids. Brussels: Pour retire la libené, 1975. Pyrurniden. Vienna: Galerie mer Pnkrrrn, ruse,
sofrdré du dxpdsuiuns, Palais des bdnur nm,
Linzs and Cnlur. Zurich, Basrl, and Bari, Italy: fuur culurr und All Their Combinarxonx. vnu.
|974
Annemarie Vrma. Rolf Preing, and Galleria Musée d`an ruudrrne d¢ In vulle de Paris. rw.
“wnu nrnwrngs and srrurruren The Locatmn uf
Marilrna sdnurnn. 1975. Grkzpprf Furmrn Munsrer, c¢ruurny=
sur Gwrudrrrr Figures/Variatxons of lnrnnrplere
Rtd, Blue, and Ytllow Linesfam Sides, Cvmfri. Wzstfilischer Kunsn/man, rdsy,
open Cubes." New rnrxd lohn web" Galleryr
und rhe cm" u/rm Pngr to Purnu du u and. $ulLcVhr1. Pam; Mum d’art rnud¢rn¢ de ln
1974.
1¢ru§n1<rn= Israel Museum, ms vane de Paras, rguy.
Gruphrk. and und Bun; Kunslhalle Buren and
Geamztfir Figurn Within Gcnmetvir Figures. Lrnrr rn Two nzrrfnuru und rn my Colors
Knrnfdld und cur., rm.
Boulder: Department of Fine Ans, University wrnr Au mir Combinations. Minneapolis:
"Incumpletc opnn Cubes." Arr ef Prruffr,
of Culorado, 1975. Walker Arr cenrnr, ryan.
bulletin ss, rm.
579
"Sol LeWlt!," Extra (Cologne), no. 3 llanuary 1975) Elthibitinn CBKBIUHIIES Hoet, lan. Chambres d’amis. Ghent. Belgium:
Frye srrurirrrea Hammaralridld Plaza sr11lpn1re Museum van Heddandaagxe Kunst. 1956
Garden. New Yotkr lnhn Weber Gallery, 1g76. Arpelrre der Baer /alira Aus der Sammlung Lewiarrn. leremy. srl Levwrn Prima 1971>-rs.
"The Location of Six Geometric Figures." Dauble Reinhard Onnasrh. Berlin: Nationalgalerie, I978. la111d41n= Tate Galleryq 19116.
Page, no, 1, lanuary 1976, Zurich: Annemarie Legg, Alicia et al. Sul LeWltt. New York: The singen11a11, Howard et al. lndiyrairiata A Selected
Verna. Museum of Modem Art, 19711. Hixmry afCvnr¢mparary Art, 1945-1936
"On The Walls ofthe Lower East Side." Arrjhrum Mayl1a1l, Dorothy el al. The Minimal Tradlrian. Los Angeles and New vnrle M11»eun1 uf
rs, no, 4 lneremlaer 19791; 4<f51. Ridgeneld, Conn; Aldrich Museum of Gmnempnrary an and /11>1»eyi11e Pras, ues.
“A Pro|ect by Sul LeWitt." Arljbrum au, nu. 1 Contemporary Art, 1979 Starr, Ruben. The Purist Image. Philadelpllia:
(October 1914111 edyer, 5943. Glnzer. Laszlo. Westklmst, Cologne: DuMont Marian lacks Gallery. 1916.
"Geometric Forms ln Black and White and liuelayerlag, iam. Trini, Tomassn el al, Maier dulaksirna. Sirac\|s¢1
Color."A E l U O, December 1982. New warlrr of Contemporary Arr and Marie. Italy: Cltiesa dei (hvalieri di Malta. 1936.
Borges, lorge 11115. F11r1anrs,w1tl1 511lrreree11 Edinburgh: Graeme Murray Gallery, 19111. srduwen Mar-ia1111e et al. Skulptur Pwjehe in
1llurrrar1a115 by Sol Lewm (printed by lu Rice. Shelley, Srhemex: A Dread: of lnstallatinn Manner 1,1a7.o1|11g11e1 uulunnr, 15117.
waianabel. New York: Limited Edirir1n5, 1914. ofawingr. New York: nire Meyer Gallery 1911. Gnra, nn1111>. sal umm wau Drawing lad:
12111111111 of 151111. Carey, rra11ee5, sig Prmrr. 111111111111 Arts muncil Sal: sir Paifrrirrgr/11u1aa1lari.1»1. Pemgia, Italy:
"Ltnes 1n Four Colors and Four Directions." of Great Britain, 1981. Own. 198%
Tema celesre, s1rar115e, Italy. oeraber 1914. Amerrran An srnee 19711. New vnrlu w11ir11ey Fence. Ian. lnsni: 0uts1H¢:An Aspen of
P1y11m1d1. 111 foldout pager, signed and numbered. Museum of American Art, 1984. canrernparary S¢~ulprure,Antwe1-p, Belgium:
Turin: Marco Nolre editore, 1956. Edition of 400. Galleria Pietoni. Alighiero P Buettlr n17veml7re1g8J1 Museum yan uedendaagae l<111154. 19117.
Prramai. e foldout page. Edition of 1511. r11r1111 sal Levwri. disegni di parm. cailm Paaulini, FranL Erich e1 al. Intuit: des Bilda: Barry
lvlareu Naire edrmre, 1915. /zusses runfidences, llnme: Erdiaiunl Pierdni, mea zevwm Mangold. Tania the nmriry and
‘~l.11l1<1grap11ie§ lrlar-'rap Pyramids)."No1se. nn, 7. Gra11a¢l1,olle et al. Flylrfpunlrurf Vanishing Pimrrr. Herbert Vogel Collxtiarl, New York, Bielefeld.
19147. Maeght edneur, Paria. pp, ami. Edition Stockholm: Modema Museet,19B4. Germany; 1<nn5r11al1e, 151117.
afaaaa, plus 1111 signed and numbered. K/ent. Ann et al. Viewpoint: The Artist as Hall, Dundas. ed. airnburgrr lnnemarianal:
“A nrawmg Page c111>e5¢ 41 Praieri for Arr/arum Pharagraphm Summit. NJ.: Summit An Rzasan and £»1wrr»11 in Cant:n1poraryArt.
by sal Lewin." ,11-rfarrrm aa, nd 9 (May 199111 Center. 1984. Edinburgh: s<411r1511 /1111 Gaum-il, 19117,
1dr-a. Millet-Keller, Andrea et al, From the Cvllettian nf Hinson, Tom E. Sol I1Mh`l‘t. Cleveland:
S111 Lel/Wrt. New York: Independent Curators 1'l1e Cleveland Museum nfm. 19117.
Incorporated, 19114. Howard. lan. Drawing Nw sal LeWirt.
Writings by the Artist
Sauer. Christel. ed. Internationale Neue Kunst Baltimore 'n1e aalrirmare 1411151111111 nfAn, 1957.
14145 der Sammlung der Migraa Ganrrramrhafre. Kaiaer. Prana Melnevn: wnrrr in Pragma. Oinm,
“z1ggurara."An1.wr1gr1rine 41. 1111. 1 (November
sander. z111iel1= l<11nrrl1a115, 19114, France: Chateau d'Oiro|1. 1937.
19651; 14-25.
Singer. Susanna et al. Sul le\'Wt1 Wall Drawings l.1eWitt, Sol, Danld Buren/Sal lzWitf: Centre
“Paragraphs dn Caaneepnual Arr,” /afrfafum 5, nn.
196544. Amsterdam: Stedelijk Museum, 1984. ,111m111a1 111111 aanrernparain. Gre11ul>le, rranae
10 (Iune 1967): 79-33.
Wilde, Edy de. La Grande Parade: Highlights Magasin. 1987.
l“Tl1e Square and the Cubefl In Lucy R. Lippard
in Painring A/rar 1940. Amsterdam: sredelnlr Pak/:sd1, Peter et al. Malerei- Wandmalerei. GRI,
er al. “Homage to the Square." Arr in America
Museum, 19114. Austria: Grarer Kunsw¢1ein.19!7,
55, na. 4 rluly-111151151 19671; 54.
V\1%ber,Anna Nosel, and Otto Hahn, eds. “La Snda snr, Sasltia et al. camegre lnrmrananal. Pin511ur11,111 Paley Maureen. wall Wnrlrs. Manchester, United
1/1115e11m of Art. Carnegie lnarlrure. 1as5. Kingdom: Gurnerlrnuee, 19s7.
del S1s1ema."Mm1> nr1,14(lune19s8):34-71,
Fromenl, lean l/nuts. Art minimal I. Bordeaux. Rosenzwdg, Phyllis. “snl levnn wnrka
essay by sul Lewin pp. 44-45.
France: GAPG. Musée d'arr contemporain, 1915. Interview with Sol I:VlHt!f' Washington, D.C.:
"Drawing Series 1§58 (F0ur§|." Studio Internatmnal
Garda. Aurora. Italia aprrra. Madrid: Pundaeinn Hirelrlmrn Museum and Sculpture Garden, 1,117
177, nd. 910 (April 1q1<1gl¢ 159.
Caja De Pen51une5. 1915. Stockebrand, Marianne. Sol lzWitt Flin!
“se11re11<e5 5111 Conceptual /tri." An~L1111gu11ge 1,
Marla Merz-Sul L¢Wir1. Rome: Edilinni Piemni, rinrna/w111l Drawings. Munsner. Germanyq
na. 1 <May 195911 11-13.
ross. Westlalisicher l<1111=r-yerein, 19117.
"l Am Still Allve, On Kawara." Studio International
Pallhas. Roger et al. New York/New An Nnw. Alnanshauser, Hildegund et al, Sol L¢Witt,
rad, nu. 914 lluly/Augun 197r1;; 17.
"Ruth Vullmer: Mathematical Forms." Studio Marseille, France: /1l1c,1, 1915. Wall Drawings: Continuous Farms with Calor
International 11111, nn, qz8 (December 11171111
Price. Aimee Brown et al. D1versiryfNew Ynrk and Gouache supen»1p.1r¢d.\nenna vlnener
156-57. Anim. Kingston, R.I.: University of Rhode Seoession, 1988.
Island Fine /1115 Gemer, 1515.
["wall nrawingfl ln Gregory Battcock, ed, Beecher, Pamela. Pram me Collatian ufnamrrry
“ t>ueumen1a11d11 in Cu11<epr11alAr1."Anr
A Sefand Talent: Painters and Sculptors Who Are and Herbert Vogel. Kansas City Mn.: Mid»
Magarrnr 44, nn. n (April 1571111 45.
Aim Pha/npaphrrr. Ridgeneld, Conn.: Aldrich America Am Alliance, 191111.
Doing Wall I]raw1ngs."Art Now’ New Yorlr 3, Museum of f,11n1emp11rary Arr, 19115. Bright, Betty Pitk Up the Bunk. Turn the Page,
Bourel, Michel et al. An minimal ll. Bordeaux. and enrev me synem: spain by Sol revwrn
no. a rlune 197111 n.p.
‘All Wall Drawings."/ma Magazine 45. 110. 4 France; CAPC, Musée d'ar1 eunrempdrain, 19%. Minneapolis: Minnesota Center for Book
(February 1972): cover, 39-44. Day. l-ldlliday T. et al. Pninrrng and Sculpture Ana. 191111.
‘snl l.ewirr" Flash Arr, no, 41 ll1111e 1971): 1. Today. lndianapolis: Indianapolis Museum of Danolf l. Michael et al. nmra neaideap
Arr, 19136.
‘Bonki."Arr Rue, no.14 (Wlntet\976/77):1o. The oliyereupyyrnann callaaian. cl1iragr»=
While ln Art ls White," Print C17Ilertur3 longs. Pier de, ed. eye Level: oaghpagre. Museum df ounrempnrary An, 19115.
Nawslerler S. no. 1 (March/April 1977): 1. Eindnnyen, the Netherlands: Stedeliik van
Abbemuseum, 1986.
o alarlaeluwy
Felslrin, Nina. The Presente rr/Abrenees New Weinberg-sraber_ lvlargii er al. are Frrrbrn da Haan-r Brown,F|i1al>e|h A. "The Lryrng objeer " lin
rnerrrllarirrne. New York: lndependenr Curators on rnnn zrrrielrs srrfrrrng frrr konsiruktive nnd Arr cnllrerrnn nfellen H /rrlrnrnn. oberlrrr,
Incorporated, rgxx. korikrele Kirnsi, 1989, olrrrrr Allen irlernrrrral hrr Mrrsennr, oberlrn
l-laenlein, Carl. sal Levnn Wall Drawrngr Baker, Kerrnerlr. The Fryrrrre ofrhe obyerw A College, rare,
l-lanndyer, Gerrrranye l<esrner-Gesellselrafr, ress. Selection nfeirnerrran Arr; Mrnrnrrrlrrnr and A/ref. l<ellein, Tlrnnrrs el al. Plnrayer/nlrrrrrrg rngaerrrnr
l~lrrnrer, sarrr. Black and whrre. New York: Marisa Antwerp: Galerie Ronny Van de Velde,199u. Stuttgart Carrlz, waz,
del lze Gallery. ren. Bcnezra, Neal, ed, Aflinities and Intl4illurl$: Thr Laml1erl.Yvl>n. ryrrrr Larnhen r-nllerrrrrnrrr-_
l<rrspir, Dnnald. Sightings: Drawings wrrh cnlan Gerald s. Ellrrnr crrlleerrnn of cnnrenrpnrary An. vrllenerrye duxseqr Musée d'arr rnnderne de
New York: i>ran lnsrirrrre, raaa. Chicago and New York: Arr lnriirrrie of clrreagn la enrnrnrrnarrre rrrlraine de Lillc,\g91
Marrin, Henry. virrggrn rn lrrrlrra lzayenna, lralyr and Tlrarnes and nrrdsrsn, rears, Rose, serniee. ,illegnnra rflwaderrrrrnr
vinaenreea cnrnrrnale, raid. Bnurel. Michel el al. Chrxsllun Ballunxkl. Daniel cnnrernpanary vrnwrrrg. New irlrrles Tire Muxeum
ii/lnrrs, l-lrrrrb er al. Her Merabei wrheeld Buren, Gllben und George, lunnis Kalmrllxr, Sol of Modern Arr, rage.
Frrrnrnrre as Arr. imrsrrerdarns Mrrserrrrr lanyrnans Lellml, Rithard Lang. Muna Merz, Bordeaux, Singer. srrsanna. ed $ulLe\1T1l l1Llll[7ruwirlgs
van-serrrringen, rear, Praneee CAPG, Mrrsee dan ednrernpdrain, idea. rgsa-rage. Bern, swrraerlands xnnsrballe
selrieldalrl, Perer, einrerrlrlralarara nylryrrnuerraf Dion, Arthur er al. Visual, Tatrlle, und Furlrtlamzl Bern, idea.
crrnrenrpanary Anrenean Arr, Tarnpere, rinlands Cbnlenrprrnrry fnrnrrrrre rn Easton Gnllenea. Singer, Susanna er al. sal Lewrrr Drawing;
sara Hildenin Taidemuseo, rear. Boston: lelarerrs Gallery, rgqn. rger-nigga. The lelagnes l-laags Gerneenrenrrrserrrrr,
srariene; ron Dayx of Contemporary Arr rn Gianelll. Ida e\ al, Arte ¢/hte, Turin: Castello dl 1992,
Mnnneal_ Mnnrrealr Centre inrernarinrral d'arr Rlvoll. l99u. Tnrnrfdrnr Brldolrye/nslrrrlprnr nn an. /rrhrhrrrrdrn
wrrremporairr. iqlla. Krrsnrlr. loseph et al. lcepradrrred ainrhenrie. Arr lsasel» l<rrnsrrrrnsenrn rrnd l<nnsrlralle Basel, rage.
saeernann, l-larald er al. zerrlea lvlrrnrelrr Presrel Errhrbrrrnn an rhe oerdrrnn ofthe opening af laarelrelnr_ David er al, sal Leiwn, srnrrrnrer
verlag, rnaa, Bnrneya New Yank. Rzkyo. /npnn. Tdleyns Galerie rrseerm. orinrd- lr/lrraerrrrr nf ivinderrr Arl,
Tbnrienrann, Felix el al, Rin, Gelb, sian. serrngarr Via Eight at laarney‘s New York, rggn. |995
and renfens G, Marie and A. Nlgg1l,\9BB. Lauter, Rolf el al. Ausrtelllmg im Eerelrh Dom errraregra del senndns Georg Herald, /aseph
wiesler, Hermann. Pynanrrden. rreelrendraelrern, Ranrer- zerrgendrsreehe Knnei rnr rrndrrerhen xrnrrrh, Sal Lnlwrr, Marlene orhlerr. Giidn, Spain:
Gerrnanys Galerie lule Kewenrg, rear. Raurn. Frankfurt Der Verexhn, 1990. Palaern lzeyrllagrgedrr. cenrrn rnrernaeinnal de
Bannard, walrer Darby er al, Made rn hnrerrera Oliva, Achillc Bonita et al. Sul Lel/Hn: Opeve arre, i993.
virginia laeaeirr virginia Beach Center fer rlre yer-enn, pyranridr, ennrpler /arms, e fralding Landau, Ellen G. er al. as Years: A Rerrrrspeerrye,
Arrs, rain. srreens, Perugia, llaly: Elccla, Fdilori Umbri cleveland. Cleveland Cenrer for orsnrenrpdrary
Bourriaud, Nicholas, srrnerrnes iderales Genera; Assneiaii. 1990/1991. Ari. r99;.
Galerie Pierre Huber, read. sal Lemhrr Banks rynarrrrr, cnlngner walrlrer Mrllerexeller, hndrea er al. sal Lewin Twenryefrye
lceseier, lane et al. Under Presrrrrer Western Knnrg, reed. renn nf wall nnawrnga. 1968-1y93.Andover,
Pnnrmnkingfrbm rhe |5rh cennrry in rhe eresenr. Soi LWWII. Recent Works, Toyko: Tonka Museum Mass.; Addrsnn Gallery df Arnerrean Arr,
Vero Beach, Fla.: Center for rlre hrrs. raw. of Contemporary Arr, reed, Phillips Aeadenry, rnga.
Kirshner, lrrdirlr lznssi. Enennrrass Panrgrresee Adams. Dennis et al. The Political Arm New York: Arrprng, Michael. Drawing izrrrrnrrr lnnarhan
/anrerirrrn Meerings nn canrernparary /in. Iohrr Weber Gallery, 1991, iznrnfelen Sal Levhrr, lzrehrrni serna l=r>rr viirrrlr,
Lisbon: Fundacao calnrrsre Gulbenkian, read. hinardr-Argenee, Dnlene Lu Revunrhe de l'nnrage_ Tex.: lvlrrdern hrr Museum nf Farr wnrrlr, rem.
Marshall, lzrelrard. lrnnrrrrenal Olyecrs: wrrrlrs Geneva; Galerie Pierre Huber, war. Grll. larendan et al. an Wars-Art rn the Presevxr
/nrnr rhe Pernranenr calleerinn afrhe whrrney Collins, Tricia el al. Who Framed Modern Arr, Tense: The Aldrreha Curamrial Hrrrrary
Museum nfrirnerirrrh Arr. New York: wlrirney an The Qynnrrrrarrye LW ef Roger Rabbit. rgraergea, izidgeneld, Gnnnn nldrielr Mrrserrrn
lvlrreenrn of American Arr.1989. New Ynrlrs srdney lanrs Gallery, rear, of Gnnrenrpnrary Arr, rm.
Miller-Keller, Andrea. Sol Levlhrr. Charleston, S.(I.: Kessler, Ianc el al. Lemhrr. Trngrrely Penn; Parrlenr. lnlrn T. el al. From Mrnnnal rn caneeprnral
Gibbes An Gallery, raise. Cuunrerbnlanfe (Charlotte, N.C.: The Hans ,ans wnrlra frnrn the Dnnarhy and Herlrerr Vogel
Mollandeu Lo. Modern Mneren 'sn l-lelsinieis and Waller seelrrler Gallery, rgnri. cnlleerrnn. Washingron, uc.: Narrdnal Gallery
l-lelsrngin Taidelralli, rang. lvlensrnger. Ingrid. snl Lewin Complex Ferrnr, wall df Arr, rqrra,
(kuvrex rhnrsree Paris: Galerie Enrico Navarrar Drrawrngr, Frankfurt: Gerrelrrsgebarrde F, rear. Trn ani yarn Alrrnlaren-nreranr nfrlre /ibanlnre.
1959, lzesrarry, Pierre. Illérne lrrennnle de srnlprwe Basel: Galerie lzeyeler. rw.
Page, srrranne et al. erin ennreprrrel, rrrre persper Mnnre crrrla, rggr. New Ynrlrs Marisa del Re lzannre, Nielrdlas. From chnare and /eanne-Grande
riye. Paris: Mrrsee d'arK rrrnderne de la ville de Gallery. rear. to /eff Koons: /ahh Knldar An Prajeers and
Paris. 1989. Reynolds. lnelr. /imenerah Alrsinreirnn ai the Galleerrrrn. sydney: Mrrserrrrr nfcnnrenrpnrary
Rein, Ingrid. Sal L¢\'Wtt. Munich: Galerie Tanlt. Addxsnn, Anduver. Mass.: The Addison Gallery AH, \99S,
1989, nrhrneriean Arr, Phillips headerny, rear. Gnldsrern. Ann el al. Reennrrdenng rhe olsjerr of
Rnsenzweig, Phyllis et al. Walks 88: Sal LeWirr. Sheldon, lames L. er al. Marian and Dacumenr, Arr;l965-1975. Lds Angeles and carrrbridge.
waslrirrgrnn, uc.; l-lirslrberrn Mrrserrrrr and Sequenre and Timer eradwearrl Mnyhrrdge and lr/laesn Mrreerrrn drcnnrenrpdrary Arr and MIT
Sculpture Garden, rm. canrenrprrnary Arneneran Phrnngnrphy. Andnyer, PYESS. 1995.
Singer, Susanna et al. sal Lelinn Wall Dnawingr Mass.: The Addison Gallery of American An. lylieleenberg, Dayrd er al. Prinrrrralrrng rn hrnenea:
reiir-rgss. nern, Switzerland: l<rrnsrlralle Phillips Aeadenry, rear. Cnllnlmrarive Prrnre and Presses lynn-wars.
Bern,19B9. EI srrenri de Egrprrr; Ln lnflrrenrrn del nrre Ewen; New Ydrle Harry N. /ibrarns, rags.
saenrrann, l-larald et al. srnierrehrenr Willr en el arre ennrenrpenrneri. Married crrys Genrrn rn wandrnralerer- Wall Drawings and wall
Varstel and sinrrrl in HH. l-larrrbnrrr, Gerrnanyr Cultural/Arte Cnrrrerrrpnranen. war, Prrrnrrngs. lvlrrnielrr Kunstlerwerkslatr
Deiebrarlrallen, rare, Lothringcr srrasse, rage.
einerdebaeny gill
singer, Susanna el al. sal Lel/Wir: Working Fuchs, B.H, er al. Alxgo$lad up her stand-Ad Bearry Franees, “sal Lewin at MaMA7 An/World
Dekkers in zgn ind; Waves Breaking an rne (Felm1ary1979)i +
Drawings. New liurlee lulrn Weber Gallery, 1999.
Shure-Ad Dekkers in his lime. Amsterdam: Bell, Tiiany. "Sol LeWin."Ar¢s Magazine 52, na. B
Waysun, Anne et al. srsenee and Persaasran: Tire
Power oflflnrk and White. Buffalo, New York: Siedeliik Museum,1998, (April 1975): as.
Lau£ Cornelia et al. Arlisr/Aulhar: Conicmpurory Dunbar, Ii|1.“I.eWitt: Minimal Maxirnris.” villager.
Anderson Gallery, 1995
de Corral, Lnrena M.. ed. Sol Lrlwrr. Urbuyos Arllsrs' Books, New York: American Federation 9 February 1978.
mumles, Wall Drawings. Madrid: Sala de las of Arts and D.A.ll \99B. Flynn, Barbara. Arrfnrrarn rs, 1111.8 (April 197s):s1.
Sauer, Chrlstel. Mrnirrral Arr: Carl Andre, Dan Glueck, Grace. New Yarlr Times, 13 lanuary 1975»
All1a,as,199b_
Flavin, Donald Iudd, Sal LeWiI1, Rol7zr1Ml7rris. Glueck. Graze. “Sol LeWitt's 'I11n§e Gym for the
Dargaud,Mnn1que er al, rrairs renrilrles. Macon.
France: Musee de Macon. \§9é. Brussels: Bank Brussels Lambert, 1998. Mind." New York Times, 20 ll“\-“YY 1975
Davies, Hugli M ei al. lilarring ilie Bnandarres: srrrnger, lulrn. Material Per/eriian: Minimal An' Hess, Thomas. “Sol LeWitt and the Bliuard of
lnsrallarran Arrl96¢1996. san Dregar Museum and Irs Afiermarh: Srlmed from :he Kerry Smkes Cubes." New York Magazine, 27 February 1978.
of Contemporary Arr, 1996. Cullertlan. Perth: Lawrence Wilson Art Galleryn Kingsley, April, “Minirrral Ari Goes Marrinralr
Drucker, lnhanna. Arr at the End ofthe zarh Universily of Western /lusrralia. 11911. wllare Volke,;1.7 February 19711,
Century' Selenium; from :he Whrmey Museum uf Bortlle, Rolf et al. Die Sammlung Paul Maenz. Kuspit, Donald. “Sol LeVlHlt: The Wit.” Arts
Arnerrran Arr. New York: Whitney Museum uf Weimar and Osfilden, Germany: Neues Magazine 51,1111 s (April 1978): 11s.
American Arr, 1996, Museum Weimar and Canrz, 1999. Marwrati, Gerald, "I:Wit1 Brings Minimalism
Frankel, David, ed. Snlpefs Nes1:Art that Has Burler, carnelia H. Afrenrnage: Drawing In MuMl\." The Trib. 31 la|1uary197B.
Liyed wrrn luey lippard. nnnandaleeane Through Process. Los Angeles and Cambridge. Maslieelu iaseplr. “Hard-Cure Paintingf' Arrfaraen
Hudson, New York: Center for Curatorial Mass: Museum afcanrernpisrary Arr and rrr, 1111. B (April 197s): 4655.
Studies and Arr in Contemporary Culture, MIT Press, 1999. Muchnic, Su1anne.“‘Poetry of Systems' at Cal
Bard College,199f1. camniiaer, i_u1s er al. Glalral caneepraalisrnr Teen.” las Angzks Times. 14 Mareli 19711,
Miller-Keller, Andrea et al. Sabre o sal e as esrrellas Parnrs offlrigin. 1950s-19sas. New varlr: Perreauli. 1ul1r1.“la11r,ieal Beauryf Saha Weekly
Derennas de parede de sul Lewin/ofsan and Queens Museum ofAr1. 1999 News, 9 February 197s.
Stars: Sal LAW!! Wall Drawings, Hartford, Praenlrel, Jeffrey, ed. anrwenry, san Franaisear Pincus-Vlhttell, Robert. “Strategies Worth
Conn.: Wadsworth Atheneum. 1996, Praenleel Gallery, 1999. Pander-ing; Boeliner, slrapim. Reise, lavinnf
Mnssrnger, lngrrd et al. sal Lewin- Wall Drawings, Phillips, Lisa et al. The Arnzrlron Cenlury: Arr Ar-rs Magazin: sr. 110.8 (April 197s): raa.
sryrnfnarn wall Pieees, rawer, ludwigsburg, and Culiure, 1950-2000. New York: Whitney kubrn, David. “Poetry of sysrerns." Arrweek,
Germany: ludwigsburger Schlossfespiele Museum of American Art and W.W. Norton is Marelr 1971.
1<unsryere1n ludwrgsburg. 1995. and Co., 1999. nubinsnein. loel. “rlre Poetry of Systems.”
sal Lewin Drawings. wareryrlle. Maine: Colby Schellman, liirg. Wall Works. New Yorlc Paula Calmrmia TECH. lo March 1978.
Gallege Museum of Art, 1996. Cooper Gallery and Bdrrinns selrellnran, 1999. Russell, lohn. “After Céunne at the Modem."
Bussmann, Klaus e1al.Skl4lplur Preielrre in Schick, Ulrike. Sol Lel/Wil Wall Drawing. New York Timer, 3 February 1973.
Mansrer 1997 Munsrer, Germany; Gerd Harie, Otterndolf Germany: Museum muderner Senie, Harrier. New Yaris Pass. 11 1=ebr11ary 19711,
Westfalisches Landesmuseum, 1997, Kunst Landkreis Cuxl-raven, 1999. Stevens. Mark. "Mind Over Matter." Newsweek,
Breuer, Karin er al. Tlrrrry-Frye years at Crown 19 February 1971, 13-sa,
Pnrnr Press Making Prrnrs, Darng Arr. Berkeley Tallmer, ltrryh “Minimal Lines, S!1|l`fofSports, and
Selected BOOKS and Articles Since 1975
and San Francisco: Flne Arts Museums nf Sknd-lbooks.” New York Post, rs lanunry 1975.
san rranersea and University of California weasrer. /inn-sargenu “ieinnrr Goes to seliarrlr
"Donald ludd and Sul LeWitt: Struc1ures.”Art
Press. 1997 Arr in Arnenca 16. no. 3 (May/lune 1971): sa-sa.
inrernannnal ar lMarel1mpril1977)= ia.
iles. clirissre er al. In visible Llgnr Pnnragrapny Anner, Alan G. “MCKS Exhibit Showcases Sol
Dunbar, lill, "The Decline and Fall of Conceptual
and Classdicarion in Ari. Srrence. and the LeWitt’s Aehieveinents.” Chlkaga Tribune.
Arr," Vx/lager, ei Nuyernlser 1977.
eyeryday, orfardr Museum i1fMi1dern nrr. 17 lune 1979.
Harvey, Mrelrael. Notes on ine Wall Drawings afsal
1997 Baker, Kenneth. “Less is Less." Boston Phoenix,
Lewin. Geneva: Adelina yan Furs1enherg.1g77.
Lee, Pamela. Drawing ls Anarrrer Krnd af 27 March 1979.
Kuspil, Donald B. "Kus}1lt/Masheck lcont.|."Art in
Language' Keren!/imerxcan Drawings from a Barkley Alan. “iaelrie vrnnsar and Pasre
Arnrrrfa ns, nr1.l (lanuary/February 1977): 577.
New Yark Prrynre cellerrien. Cambridge. Mass.; Minirnalisnr.” Vanguard s, nu. 7 (September
Lubell. Ellen. Arts Magazine 51. no. 9 (May1977}:37.
Harvard llnryersrly Art Museurns, 1997. 1979): re-17.
Masliey, loseph. "crue1fr1rmal1ly_" nrrfnrurrr rs.
Oetker, Brigitte el al. Realrsariarr: Kunst rn der Blistene. Bernard. “Sol lAWitt, Niele Tomni
nu. ra lsurnmer 1977): ea.
Lerprlger Messe/Arr or the Leipzrger Messe. Galerie ryan 1.amber\." Flash Arr, nos. 91-93
Miller. Donald. "Stars nf Minimal Art Shine
Cologne: Oktagon,1997. ioeraber/Nayerrrber 1979): 59.
Here." Prrrslaurglr Pasl Gaeerie, 1 October 1977,
Bunnell, Prrer er al. Pnnreyrapny nl Prrneernnr Dunning, lennifen “An A1anr»c.arde rlireesarrre in
Perreault, lnhn, "Patterns nf Thought.” Soho
Celebrating as Years nf calleering and Teaelnny B1'ook1yn."New York nrner, as November 1979.
Weekly News, in March 1977.
ine Hrrrary of Pnaragrapr1y_ Princeton: Frank, Peter. "Geometric Figures and oulars"
Wull Drawings in nasrrnlia. sydney: lulrn lcaldar.
Prrneeran unryersrry Press, 19921. village vaiee. 3 September 1979.
1977
Cnra, Bruno el a|,SnlLe\1/mln Irulln. Perugia, Garret. Robert. "Take it or Leave it... Minimal Art
“Wl-lite ln Art is White?" Print Callecrork Newsletter
lraly. (LERP lcenrru lzspusurya della liaeea
ll, nu. 1 (March/April 1977): 1~4. Still a Child of its Time? Boston Sunday Herald
Paulina), 19911.
1 April 1979.
Wooster, Arrrr-Sargent. ARTnrws 76, rid. 5
Cortenova, Grargiu er al. sal Lewin, verarra, italy: loselit, David. “Par Minirnalisrs, the An is the
(May1977): ran.
Galleria d'arte Mbderna e Contemporanea obieerf' Boston Ledger, aa-an March 1979.
Palazzo l-ur1l,l99B. Baker, Kenneth. "Energy as Form." Arr in America
aa,nrr_3<May/lune197rs):7a-iii,
1 alalloenawrir
l<olog1, Brian R. “rrarrn an Empty Space and Call Colby, loy Hakanson, ‘cranlaroolcs TKO lrernpo. Brenson, Michae1."So1 Lewin Dr1w1ng at
i1 Art." C111-rsnnn Science Monit11r,6 April 1979. rary krrockouu.” Damn: News, 11 February 19111. lsronlclyn M11s111m."Nrw York 1111111
Krarner. Hilton. mn; Whitney Reviews 1111 7os." Hanson, Bernard. "conrcpnralisrs at Wesleyan." 1111111c191s.
New York rims. 19 lons 1979. 1-l11rrp1rd conrnnr, 1 November 1911. 1r11no, l>1¢ro_ “concspr11,1l, 1nrrnpo|og1a, graffiti "
Pacheco, Richard. “Boston lnstitute Gives Hanson, Bernard."l1Witt Finds Home at cornere dd glnrno, 11 Dcrcnrbcr 1911.
Showcase to Minimalism.” Standard Timer, 1\1l1¢nc11rn." 1-lnrrnrrd Courant, 511 A11g11s1 1911 conn, Sandra. "M11cl1 Ado nbonr Nr1rl11ng?"
1; April 1979. Hanson. Bernard. "LeWltt's Demanding crarns chrrngn 1111111111 17 |11nr 1919
Saulnier, Par Emmanual. "L'Abstrait dessin." Drawings." Hnrrford cn1ranr,1 October 1911. 1>’cl1.1,nr1n.1.“l coin d1 sol Lcw111"Ln c1111o1n1
opns rnrornorional, no. 71 (Spring 197911 11-19. Kramer, Hilton. "Art: Modern Shows uf( dal rn111og1nr11o,»o lanuary 1911
Schulze. Franz. "When is Good Art Not Art?" Acquisitions ofDraw1ngs." New York Timex, 20 c;in1@lsnn, Deborah "The Tower omrl. 'l 111
12111111311 Sunday Tongs, 1 lnly 1979, March 1981, l;o111ral>lc Lrfs Assnrancs sncrcry, New torlc,
Taylor, Robert. "ons Minimalism at ICA," 11/lays,Io11n Bentley. "sol l_ow111T1lr1s His l.1n1 N1A»\rr,r111 Handrnaldfn of 111| 1,1111 “
cnrirrinn srirnrs Monitor, 1 April 1979. from Geometry.” Globe and Mull. 14 March 1981. Arr und Aornnn 1. no,1 roc1ol11r191s1;1sr1-Ss
Thorson, Victoria, ed. Great Drawings of/ill Time: McClurg, locelyn. "The Draftsman ls Vital Link in l<r.1111r, Rosalrnd la. "11cw111 rn l>rogr1ss" 1111
The Twentieth Century. New York and Redding, l.»eWitt Plan."HnrIf11rd cnnronr, 11 September urrgmolrry o/1111 /1y1r1r.r;111dr and orhor
Conn.: Shorewood Fine Art Books and 1911, Mndrrnrsr Myrnr, can111r1dgc. M111 1 lvlll'
Talisman laoolrs, 1979. Mclinroe, Col1n."Atheneum Buys LeWitt Wall vrors, 1915, pp. 141-51. Reprinted 1n Royrowof
cglanr, c1rn1a11o. ~v¢nis= slccp and Sparks." Drawing." Hanford conronr. 11 111111 1911. conrrrrrpnrary rrrnon, s1n111c1 11111111 N1.o1l1rr
Domus, no. oos 111111/Angnsr 191o1= 11-So. Miro, Marsha. "Cranbrook`s Artists Decorate a 7,nr1.1<§111nrn1r 191711111-39.
Crorssletq Mimi. "Geometric Works of Sol LeWitt." Room`s Skin,” Detroit Free Press, zz February lvlclvonald, l<ol91r1. “An lncprrfd ccorncrry,"
Horrfron Post. 11 November 19111. 1981. Arrworlr. 11 may 191;
Danofh Michael. “Sol lAWitt: A Wall Drawing," Pacqrrsnicnr, Alfred, "Sol Lcwnrs Le Developpe~ lz1ynor,v1y1sn, “Tl1= Door snows 1\nn1r1a Nnsei
011111311 3 (ssprcrnbcr/o¢rol1¢r 191911 ss. ment mural du dessin." An Press 46 (March Gallery.” New Yurk Toon, 11 111nc 1911,
" '80 Medals: Artist Sol l.eWitt and Stonecutter 191111 1944. 111111. Eine. “zo sol 11-win nach lralirn"N111 Arr
1ol1n ncnsonram /oa1na119, no. 1 (March Phillips, Deborah C. “New Editions: Sol LeW1tt." 111 Europe 1or1ob=r/November 191511 foyer, 7-9
198111: 24. ARTnews 111, no. 5111/larch 19111; 111. 111sS1ll.1o11n."Tl1c Best and Biggest 1n
Glueclt, Grace. New lkzrk nrnc1,11 lanuary 19111. Raynclr, Vivien. "Two Shows Contrast Social Pittsburgh." New Krrk Times. 17 November 1985,
larson, Kay. Village vaicr,11 lannary 191o. Realism and Conceptualism,” New rorlr rirncr, scl11oldal~.l, vcror. Arr afOur nrnrs T111 sa111r»11
Pa.lmer~Poroner. Bru11o,"Whcreis the New 1 November 1911. Callerrwn vol 1 Now York: 11711111 1915.
Direction?" Arrrpmk 1, no. 4 (17lar111ary 1950). Russell, 1ol1n, “Arr c1r1log11¢s1 Thicker bythe Tr1n1,Ton11naso.“1rw1r1,dal|'apparcnra all'
Perlberg, Deborah, "Dance: Lucinda Childs, Dozen."New York nrnrs, 1 Aprrl 1911. apparizione." 1111111 rrlarrr, no. 1 <Marrl1 191111
Philip Glass. and Sol L1eWitt."Arr/alum 18. Russell, lol'ln_"Sol LeW1tz," New York Times, 17 coyor.
no. s llanuary 1911111 1143. December 1981. w1lson, w1lliarr1. "The Art call1ri1s1 1_1 cienfga
Ruxell, lohn. "Sol LeWitt." New York Timef, Smith, Roberta, “Grtdlockf ‘hllage Volre, lifzl Area." Los Angclcr Toner, 1 May 1919.
7 November \9Bo. 111ly 1911. ‘a1ranr.Gard¢ Arr Show Adorns Belgian Horncs."
“Sol l,eW1tt: Four-Part Configuration of Six Tigiro, Mary Ann. Hnarr and Gordon 111. no. 11 Nm l/nrir nrnos, 17 1\11g11s1 1911.
Geometric Figures i|\ Four Colors, |,1|,1|1, |\'1 (November 1911): 11. confr, Holland. "Sol l1w1n at 1111 Drawing
six Geometric Figures and nil Tl11ir “wall Drawings on Display." Hartford conronl, Center.” /111 in America 71, no. 11 <n1c1111111r
Combinations; Six Geometric Forms." Print 18 lun: 1911, 191111 131.
Colkcrors Nrwrzcnrr 11. no. 1 (Iuly/August Field, Richard S. "On Recent Woodcuts," Print nr=l1sr. Tl1o111as, “sol 1,111/1111 T111 Two scnrs
191o1= 1o1. Collectors Newsletter 13, no. 1 (March/April ‘rorrns Derived frorn 1 c1111c‘1nd‘l>yrar11ids.‘
Tennant, Donna. “The Artist as Think Tank." 191111 rao. 11111 Fncrnm moyernncr 1911/iannary 191711
Houston Chmrllrle. 23 November 1980. Armstrong. Richard. "Sol LeW1tt." Arvorum 21, 1-9.
Tilroe, Anna. “Het Geheel Dat Meer is Dan no.7lMarch1953):70-71. Guillnt. lacq11c1,“T11s lacsr Summer sl1o1~s1n
di Vom der Delen.” Avenue, Iune 19110. 14. Bell, lane. "Sol LeW1tt." /\RTvlews 52. no 3 E11ropr¢ sol 1,¢w1r11 Wall Drawrngs an
Wooster, Ann-Sargent, “sol l.¢wir1's Expanding (March 191311 ron. 11/lagas1n," cnrzorrn Magannr, no 14
Grid." Arr in Amerlru 65, no, S (May 198n): Russell, lohn."lllt1strated Books Arc Making a tnngnsr/september19111=99.
\43'47 corrrcback." New York mncr, 11 n11g11s1 1913. Marcadé, laernard. “sol 11wi1r."Ar11rod1o. no, 1
zirrnnar, William. "Building Properly Heated. Russell, lohnflourneying Back in Time At, Yes. l$u1'l1met19S6lZ B0-93.
Inspeetor sarislicd." Soho Weekly News, 17 1111 w11irn¢y." New York nrrrfs, 19 Inns 1913. Russell, lohn. "sol l_¢wir1.“ New York Tnncr,
lanuary 1950, Fizlarutti, Santa."Sol l..eWltt: Galleria Bonomo." 11 March 1911.
Abatt, Corinne. "Fleeting: Paintings Destined For scgno 41 tNov1rnl11r 19111; 17-19. snplrens, s1111nr11. "nn eooirabls l1=|ar1onsl11p2"
Brie( Lifef Eccentric, Birmingham-Bloom/ield Liebmann, Lisa, “Stubborn Ideas and LeWittv Arr 111 Arnrrrro 74. no. s <1/lay 191111 111711.
Edinrm, zz Ianuary 1981. Walls." Artfnrum 23, no. 1 |October 1954): van d¢r lvlarrlc, lan. “Report frorn l>ir1sb111gl1=
“lJArt a11jo11r1i‘1111i." Lfacprcss, 14 Pcbrnary 1911. 64411. T111 Tr11nn1al lzeyiyedfarr 111 Arnerrsn 7.1, no. 1
Balryn Ann. “Sol l.1eWitt Has a Homecoming in 1/loorrnan, Peggy, "New Edit1ons,”ARTnews 11, (May 191111 1c»9;.
Hartford.” New York Times. 17 September 1981. no. 3 (Maron 191111 so. Bork, Ern1s1."111rgl1¢rs Black 1111 11o1."ARTnrws
Brown, Susan Rand. "The I/eWitt Riddle." Robins, Corrine. The Plunzllsr Em: American An 11, no. 7 or 191711 97,
Hurrford conrnrrr Mognainr, 1; October 1911. 191fH9a1, New York: Harper sr Row, 1911, norssy, 1ol1n.“Dra1~1ngs rracrnn 1111 lllusinn of
Caldwell, Iohn, “Sol LeWitt and the Walls of the Russell, Iol1n. “rs/lodsrn li/l11s<11rns Arc on Every s1rr1pl1riry." 11111111911 san, 7 October 1917.
Wadsworth Atheneum,” New York 1imes, 26 c1ry's l.is1," New York 111111, 19 April 1911.
September 1911,
ararlonaraav 313
Chadwick, Susan. “Wall An: A Flening l:CIair, Charles, Culor in Cantzmpamry Painting
Hue:k»Ehmer, Brilta, "Wall Drawings:
New York: Watsml-G\|p!il.|, l99l»
1<111111v919111 M1111,1e1." 11111 1<11»111w11|1 411, B1p¢rienc:."Hauxmn Post, 1 May 1989.
F11111,411, 119. 14s lM111¢|1/A9111 1919): wvrr Maslzrs, Kim. “Anjsl 'Fl.-abbcrysted’ at Decision
nos, 4-5 (September 1957): 184.
w P1111 Work” W11shing1o11 P11sl,1§ luly l99\»
1<111p11. 1191111111 "sol L1w111¢ The 111111111111 H¢11n11¢y, 511911111 “S1111111 s11|11111/s11| uwin,”
ARTnews 88, nn. 3 (March 1989): 171. Mmm, 16111. “Anim Proms! M11§¢11111 Dir:n.or'i
C¢n1er."Arq'or1m1 15, nu. 5 llanuary 1987): ma.
Fix of Paid' Washingmn Post, 11 Iuly 1991,
Lang, Ioel,"S1x Words F11l1ng a H¢adline Span." 1<151¢lg111=f.A1111a.“,\111¢11=911 1119111111 11111 11
1-1111119 111 G=1111111y." Nm V911 Times, 11 Mmm, K1111. “A111111 w=111 11111 of Eidaibilf
H.111f1111 6111111111 11 111111 19117.
Lapham, Lewis. "Notebook: Wall Painting." Ocmber 1989. Washingum Post. 13 luly 1991
H111pe1a, 01111191 1917. 11.13. Kulkus-Monlividas, Kristina, "Conc¢p11n.l Arlisl Maslus, Kim. "Peep Show' Artwork Back on
191911, 19 A1111. “A1 1119 1111111119111,111e 11111 9r1\19 Sol l,¢WiK\ Keeps Viewers Wondering." Nrws Viewf' Washingwn Post. 16 luly 1991.
New: L:W111 and Shapiro." Washington Posl. 2 and Caunrr, Evening Pas! (Charleston, 5.C1)1 Mmm, 1<1111,“1>911pl¢ v1n111 1111v¢ mp show."
December 1987. 4 June 1989. Washingnm Post, 17 luly 1991.
McNally, Owen. “Sol l.eWi1K Decides to Come MillerfK:lle1‘, Andrea. “Le Musée comme lruvre McNally Owen. “Sol lxWitl: ldca Man." Hargfard
Home Ag1111." H1111f9111 c11111»11, 1 M1141 19:17, zz ar1efac1,"Lex Cnhms du musée nnruanaldhn C911111111, 4 A951111 1991.
11/111191, c1111¢11119. “Les 5191911 9111111911111 111 »111dm1¢ |Sp1i11g 1959): ons. 141119119 ow¢11.“sp=1111 Fly 0191 119111111111 9f
sol L¢\v111J' A11 P1919 1111. 111 m1111111 19s7>¢ Neil 15111111 “s91 19w111. 1111111191 011111 Gallery" l:VWl¢ Artwork.” Hanford Caumnr, 13 Iuly 1991
1932. Anf11r1m1 27, no. 7 |M=1¢h 1989): 13741. Parachini, Allan. 'Photo Show ls Bark in Focus"
N111b111111, 511111, “sol 19w111= A11 1;11pl1»191." Nusluum, Eliot."New laWit1 Work Explores 1111 14119491 r1111¢1,1r11111y 1991.
D11 11/1111115 591111111 R1g11111, 11 11111 1917. 11111111." D11 M9111¢1 5111111119 R¢g111¢1_ 13 I11|y Ripley, Deborah. “Prints and M\|]!ipl¢s: from
Rcif, 11111. ~‘,\11 nf 1119 1/1111113 E119 11 1119 0111191 19119. Candy 111 1<1111|; me lay 111 M11|11p1=." mmm,
of u1111111111 11111111111 of c911<1p11111 w111ks." Russ¢ll,]0l1n.“Fr0m a Glnrmus Pas! to a no, B7 (5um|n¢r 1991): 94-95.
Nm York 111191, 99 A9111 1917. c11111111¢11111111y 11119111 F111111=." Nm Y111/1 T111111. 51111111911 1119111111111 “c111=¢91’1 cl11111p111= Navel
111111911 191111. ‘~c1111¢§ c1191¢¢1." New rm mm. 17 August 1959. Warfare,” Wall sum l¢wmuL 14 Iuly 1991
1; April 19117. Russell, lohn. “Glory Days for Big Exhibitions. Sannsld, Edward I. “A Seruekss Ann-1-1px at
111111111 191111. “1:/111111 19111911 11114 S111 Lewin? Cominucd." New York 'I1meS, 24 December 1989. <;¢1191111|11p." Nfw HM11 1z¢g1m, 11 /11191151 1991.
N119 141111 n»1111, 111 A9111 19117. Zevi, Adachiara. “Sol l.AWi!1: Un Conccttuale Tcrnin, Christine. “An Work lnslallcd Aher
5111111 M1¢111=1. “A115." P29911 M11g1z111¢, 1; May inform: l’a1‘chi!e!1ura," Llrchrremrra 35, no. 4 Dirzdur Balksf' Basmn Globe, 16 l\|.ly 1991,
1917. 4;-94. (April 1919): 291411. wauis. a11111,“P¢1-9111; 5911" M111 Amzrim 79,
111911111111 Phyllis,“Sol |.9w111’1 Dy1111111< Bzlchclor, David. "Abstract Art R:\'us4s: Notes on nn. 9 (Sepmnber 1991): 19,
M111111111111111" Newsday, 21 A9111 1917. I_.:Wi\t and Reinhardt.” Altscrilm. 110. 79 Cotur, Holland. “Sol l.:VW\:L” New York Timls.
\1\@11111, 1/111111119 ~‘s91 LeWir!: Idées d‘1111111." 011111111/F=b11111y 19911>1 6197. 74 lanuirv 199;
A1111111119, 1111.11 M1111111111 191711 1.1-1111. Fawczn, Dennis. "Line and Logic: The Ar! of Sol larsun. Kay. “Drawing Gondusionsf New Ynrk
A191191 1~/11111991 “wan w91k1, c11111¢11111111<," LeWm." Nm Haven Reghzev, 11 lanuary 1990. M11g11z111¢. 1 M1141 1991.
/1119111111 1»11¢11111119»1111, 119. as 11/11111/A911 FRAcfL1»111111i11; 199919119 “P1¢1111e1¢ £p11q11¢." Pix1C\lS1 Rnberl L. "l:Win’s lmagm Arrive
191151: 11. <<a11111g11¢ of 1119 mum111111 1111195111 Before He Does.” San Umlm Tribune.
1-111145, w. 11114, ~<;9|91>111111g r¢m9<1111y A11 11 Le P1111111, 19911. 19 November 1991.
Williams cnllegef' c»111»11[11 1/ H1g»191 Hf1pg11<1d, s1111111."1u1-1111111111 A11 History." An llimtr. Sara. "Collecting P1-ioelrss An. |1151 for the
m1111111111,1;M1y 1911. m Amman 78, no. 7 |luly1990): 115-zz, 181. Luv: of ll." New York Timer. 11 February 1991,
G111111, 11111191 1111191 11111 G11111 111; M191 A11 Heanney, Eleanor et al. The Rzfca Collecrmn. s¢1.1~¢1111¢111~¢111. 111111. “s111<5¢1<¢11§, s¢11\911111=
c9111¢13' 111111111111 511911, 111 s9p¢1111b¢1 191111. Chicago: Refco G11111919911. Show l:Wi!t`s Aumsibilily” Harrfnrd Courant,
1.11\111191111,L111,s11AL1»w111. 11w1¢11<¢ 011191 Russell. lohn. "Sol LeWin." New York Timex, 11 1 19911111-y 1991.
G11|91y B111|¢¢i11, 139191111111 19111. January 1990. Vogel, (hml. “National is Pledged Loon-Work
111111111.M111y A1119 ~‘s11\ Lewin 1.111 H11 A11 Smi\h, Rnbcr\a.“M1nimalism on the March: c9u<<u911.” Nm V111 1111111.11 |=1111=ry 1991.
1111 the 111111119 191 Shows 01191111111 111 A191 More and More Less and Less." New Ynrlr Zimmer. William. “large Slmchlres and Prinls
5911114117 51111 M111111, 19 1911111111 1915. 119111, 111 |11111111y 19911. Rgveal Rools of Conce'p1uali§ll\f` New York
o1111111111,1<|=111.“s111 1.¢w111. l11|111 w1\111" Brensnn, M1chael."ln Conncdlcul, a Conctplual 111191. 1 1111111.19 1991.
H1111 A11,119. 1411091111111 191111 119. isfs Nonconceplual Collection." New York lacobson, Marjoryq Arr For Wnrlc The New
s11111|¢1, 11v111g.A111111¢1111 /1119/1111 19991. New T1111¢1, 9 /11151111 1991. Renaissance 111 c111p111111¢ c11u9f1111g. 11911911
v111|<¢ 11111111 a1 Row, 1911. Gamarekian, Barbara. "Museum Resmres a Nude 1-1111111111 11115111199 s¢1111111 Pr¢ss.1993.
“sr11p111g 1111 111 sp11¢e."sm11»111»1. 11 1111111119 191111. 19 s11111~." Nm 111111 mm. 19 |1111 1991. lnhnson, Ken. `Krt and Memory” An in Amzrlka
51191111111 1/1111. “sol 1.1w111 111111911 1111 /111 111 Gamareluan, Barbara. "Show Closing Demanded s1.1111,11 (N1111¢11111¢1 19991.99-99.
Idcas."Ch|1:uga Suv|~1imrs, 18 March 1988. al Washingmn Museum." Nrw Kirk Timn. \<111p11, D1111.1|11.“s111 11¢w1n:’ ,mf11111»1 91, 1111. 2
s11g111<111, 111111, "s11| Lewin; 01111111 14111111111 13 Iuly 1991. <o1111|>¢1 199311 97.
M1111111/Le case d'A11¢." 1111111 911111, 1111. 19 Hacketl, Rzgina. "Sol LeWitt's Ar! is Mind Over 51191111911 M11-y. *s111 mmm 1‘w<111y~Fi11¢ Years
11111111119/11/111191119191199-79 Manu." 51111111 P1111-111¢¢111g¢111¢1, 111 N111=111b¢1 of Wall Drawing. 1968-1993f' ARTntws 91,
1;111d11|111, 1/111191. “P<11111111g 91 1\1¢11111¢11111." 1991. 119. 9 (N11v=111|>¢1 199911 1711,
H9111 1111. 1111. 1.1; 1M11¢11/A9111 199911 71-77. 1-1=1111¢1111, M111i11. 5111111111119 L11f¢1111.111=111¢11, s111m1. Roberta. “A11 |11»D=pu1 191111 11 5111119
(lampbcll, Evcrrtl. “Sol l.eWi!\ Structure al 01111111111 1111119 1/1115911111 w=9¢1\1111g, 1991. w1i1111g 1111 1119 wan." Nm 111111 111115,
New 1119111111 511119 u111v11111y." P11119 Del 511| |<1111111=1111=111.M1¢|111¢1,“1>¢¢1111g11119 1>=¢p\111|¢1 13 May 1993.
51111111111 19191; 191111, 1-11. and Finding Polltics.” New Kirk Times, Wilson. Andrrw. ‘Sol lAWilt lntervirwrdf
11 |1111 1991. An Monthly, nn. 164 (Mardi 1993): 3-9.
amrroawiww
Coen, Ester. "Sol LeWitt idee al cubof’ Smith, Rober\a."Tour1ngthc Outer Llmltx of (Jragg, l<1r11ly, “ l'l1e A11efllu1111l11y"0111111111111
L11 lzepnlrlier, 111 Iuly 1994. the LeW\!! Sensibility." New York Times. 7lreee-n1b1r1997.
Goodman, ltmathan. “Sol l1eWi\t: Gallery \z8." 7 APN] \99s lr1l1n111n,l<er1."s11lLew111¢ t'l1u l1a|lcrv."
ART11ew1 93. nb. 1 (Iannary 1994): 118 Stapen, Na11ey. “Bb119111 511| Lew1n, Mu1eu111 9l` M1111 Yrrl mire, 14 >l111en1l1er 1997
Gutterman, Scott. "Sol LeWitl: Drawings.” F1ne Arts," Almrrws 941119. 1 |]anuaryl99SJ:168 l<al1n11, R1chard,"Scl Lfwln 11/1re."rl11 111
1111111111 A1111q11e1 Magazine 17, 1111. 9 Turner, Janalhan. "Aeeun1ula1ibn1, Zlerynrhia." 111111111111 55, no. 11 (November 19971 111.
(November 1994); 97. ART11ew1 94,n11,9 (November 199911154 Lrn, S\even."(§e|¢‘bratlng 1l1e lfnwfr r1l`ldea1 rn
Kimmelman. Michael. “The Playful Side of a Zevi, Adaehiara, ed. Sul Lew1111 Crlrlml 711111. 1111." <3l1111l1111el 11111111 nrlrler, 7 Februarr 19971
Usually Austere Artist." New M1111 Times, 1; Rome: L1br1 dc AFlUo, 1995 Rush, Mrehael “sul LeW1tl\A’all l»11111i11g1 1991"
October 1994. Cotter, Holland. "El Analsul and Sol L:‘Wit|." l<e111w,1 lunr 1997.
Saltl1lerry.`5\ Year in the Life: Tropic of New Fark Tirnes,5 luly 1999. Tuelaer, Paul l-laye1. “snl lewrnr Aee:'Al<l'111n1
Paintingf' Art ln Amfrica Ez. no. tn (October Kandel, Susan. “Lewius Paintings: A mall 911. 1111. rn e1 19971 115,
19941199-191. df Color, Concepts." Las Angeles Tvmrs, Ad111r1e,lsreelre.“‘Anyl1111lvc1111 1111 11-1
sel1ieldal1|, Peter. “sarnr Sol," Village vane, 15 5 Derember 1996, A1111 'l~l1.1r'e 1111 l=111111;"l111r1111e111 111, 1111 11
Mar1l1 1994. l<a1111er, Ieffrey. “Lew1n'5 w15d9rn1 The Grand llune l995l3 S0751
sehraenen, Guy. s11l Lewin; Systeme 11 lauelr/111111. old Man of Conceptual Ar1."F91w9111, 15 lsanenl,D1y1d."wal|-nr-wall l.e\'Vitt."
Bre1ne11.Gern1any1 Neue; Mueeurn Weserburg. March 1999, 51111 1-111111111-9 e1<1111111n-1, 15 lznuary 19911
1994. MaeAda111, Barbara A. "Sol Lewnn A Tale of Two caurey, 1\11dre11, 5111111111 11111-r 19.1 5. o1<lerd1
Ternin, clniarine. “The F111e Linea of S91 Lewin." sq11a1e1."ART11ew1 95, 1111, 5 llune 199111. 1111. Oxford University Pre11,199s.
1111111111 011111. 19 September 1994. Sherman, Mary. “LeW|t\ llu1|d5 Arr nn l<ea~11n " s1ni1l1, l<11l1er1.1.“s11l l.1w1n; l=1eew1lden11e111“
Cotter, Holland. "Personal Without Persunallty," 111111111 sunday Herald, <1 se,11e111l1er 19911. Nrw 1/ark 111119111 seprernher 19911
New Y9r1< Trrrrea. 5 October 1995. srnill1,l111berla.“A self-£ffa11ng Avuwal of l11l1111a11, l<e11.“s11| Lewrnfpaula Camper
Dorsey. lohn. “Sol LeWitt`s A11 Sounds Stiff and Ge9111erry‘5 l>r1wer."New Ya1l< Trnres. Gallery," N111 vrrl r1r11e1, 11 oeraber 1999,
Lurilre sen5119u§.” 51111. 11 February 1995. e February 1999, Nyer11e1.Ale1a11d11 Ler 11 11. selerrrel w111lr1/111111
Gardner. Iarnes, “The l>aa5ie1n 91' S111 Lewin." Arnrer, Alan, "Primary 51r11e1ure1," 011111511 Tl1ell11y1a11 A11/1111111111 1911111111111 riullrrrrrrn.
New York Review r1fA111,n11. e (March/April T1il11111e, s [une 1997. l>11y1911,ol119 nayrnn An l115rnure,1999.
1995): 4-5 Baker. Ke11ne1h.“LewinTurn1 ldeae 111111 Arr," sr-nnh, lzaberrr “wall nraw1ngefLa11ee Fung
l»l111dry.An11. Sul Levwrr. Pans: Centre 11an1ana1 51111 Fwrerreb sunday Exannrrer 111111 cl111r111ele. (}:1llery," N111 19111 l'11111e, 11 lune 1999.
dee ans 11laninue1, edin11n1 du regard, 1995. 11 l1111111ry 1997. s111a115k1, Edward l. “le-wir1'1 Arrwerlr 'l;1l<e1
MaeAda111. Barbara A. “sol LeWitt: Are, Lawrence Balehelor, David. Mrnrmalrenr London: Tale shape at ICA," Ph1l11111l11l1111 11111111111 Mrnruzirrr
Mzrkry, loh11 Weber," ART11ewe 94, nd, 9 Gallery, 1997. 19 Mry 1999.
(November 1995): 1.11. Carnper. Fred,“M9n111nen1a of Gernnerry." Vogel, caral. “sol Lewin Thrawe curves
Rayn9r, Vivien. “vnrmraiie and wall Drawings." Chrrrga Render. 39 May 1997 111111 1 111111911 1111111 111r,"N1wlb1lr 111111,
New lhvk Times. 6 Augun 1995 Glueck, Graee "Sol LcWin Making waye1 11 April 1999.
Rdwlands, Penelope. Alzrnews 94. 119, 1 and se11d1ng a Me15age."New 121111 Trmen
< lanuary 19951: 1911. 24 August 1997.
a1a11oen11v1<11
EXHIBITION HISTORY
was
sul |..'\\m nm/ 11m.»f~1y\ M1 nm, LW mpff,
x».,.\.\|`1\'<,u..g<...1|m~,< hmg..
sm:mm1»m~~,\\¢\u¢r.\r<11;-.\\.»f,x1.W.,,».»\,»
4/ \\1.lz.\wAf_\\'.1|\.,.\.~\\»|1,»g.-\1N..m.»|.\f\,
\\.1|]|.\m~m\vn, l\l.\\~.
` _\
sf..~\..».\,\,m.\.\\L.\m1.»gu»\»\f1n|afgun.1
,\m.m~hdu>¢f L-1 .ul 1
SU/ 1,L»\\'m mu1>f.¢\»f/W,.\.m¢m.\|\L-\1-md.
.__ /.mm
\ns¢aHa\\on new at the |934 s|eaem|< Museum Amscemam, embmgn s(z1\vff1.~
,» .~ » . 11mn\\~»,.».»m,w_|.~\<m
\;.\1m\,|,.»m1.».\
1985 Soll,<‘\'\'rr7\\&dllJmwmgA,||\»m\1\c|<\r ,.VH
.- \\VHf.K»w.»1~.»...,».'M»,»1n.w
hlrvu I:
5ulLvW|1r,L|gh\L}a1|cry.Ncw sm comm,-<»my An,1`md.».\ an <;f“m.,n., mum., ‘|.< ¢p.».1.n“»m¢_ NJ,»|f~
swarm dv 5olLr\1Q1| .1 :e.n.»,»<»|1S,<;a|1m.~ 1-Ugg." M-,lap/mf, nw 4. xz.,;-mm <11 mg!-.», Sullv\\'|/1:\11xlIlImuu1g>.Kotm-r-l}c\<-lI»\h.\9\.
Maulana smumv, am, l\.x|v ualv, \;¢1|¢m r»1=f.1fn.. H<»m»m<», mn, 1\.\1» 1|.mn.»m, mf|m.“ v.`\\.\|.»g..¢ |»\ (im
\\z.11n,.1wmg§.m,1slmmlm m“.f| m-.n|»¢fg S1rur'!1m'>: 1978f19N6, .-'\|\ncm.|!lI \'Dr|\.A. Lurnh l|.\c|\]fm\
Gallery. Lu> Angvslss WI lu\\'|!l \111ll l7m\\'my», Ie( .nu d'.|rw. M|\_m
1=ym,m4; A mu lnmwmg b,fsf»1L.'\\m1_ sm<>1<|y“ 1987 s.»z1(~\v.f1 fum. mm \v¢|»§-f <;.\r1`-rv. Nw \'.»f|<
Museum. New York mpg" §1fm1»~.»§, Nw Pmm, <;.\\|¢m r~m|1¢m Sull.v\1'vrzl>m\->mg\, mm \~»r,¢f<;,\|1m',
nmmmm rvzmfw m LUW, 1=.m\|.» ><.mmu<<-, m»n<»m\», mn, Italy Nw Yurk
sp\»|¢m, ugly \\111z1>mwmg=, Mum dun m.»dm\¢ dc ld ,mf ,\.»H.~\\m sm/.~nm» !\1.\»~»m<» Mmm., Hmm
New \\/mkf sn: Lrhhn. Hamm umvmny An dc vm; I|.\|»
Museums, ntmhfadgf, Mm. rbmfh-In by 1>m.1»n> z>,»..m.¢1>, mm wfxwf <;.|1¢f,, NW vm Ml mm- /mm/1A.f..~» mm smzprw,
Camlme lone\ en dw smm»".~ 1 X; X 1, mm Frfmnun PIM. M. |<Umb1.m,\\u,hmgwn,1>_<i_
smcm c¢»l|m|0n, Landon New my xv/ Lf\v.", \»11/1z>f.m»,|gA, ny, m..\¢> An rum,
su1Lf\<m1 \\n1z1:mwmg§, c|¢»'¢|md mmfum Iowa
was nffm Lp@mph|¢|by'|1»m L. »xmmn1 |.»Wmf n1.m <;J1|=f,~, r>h.|=u=\ph|.»
swam oy, emma Gnguln, n.»|.>gna_ lmy Hull 1>mwmgA, up F;-mm; <;A1|ffy, Rnrne
n;a1m¢ Petcr numb, xmma sn! /mm Tumi fm”/\\1.1| 1vn.»m»g§ |989
sul Ln\v|rr' vvmk, an Paprr from m.»1<sM \»@§m1|>¢h¢r |<umw<mn, M\m>m, u¢rm.m»~ Sul L\'\\|l! Prn|1< 1970 MNA. Nrw l§n\.\m Mmeum
carlmmn, cmufmpmfy Arn umm, Acaxaloguc by 1\1@mn|\< s¢<»<k¢hr,md» 0| .»\|\\cr\L.|n Ari, (I<u\|\., l /nl .md l,v:u|v: 71|1<a
cm<mm\| su: Lfwm \1hlllImw1ug<, |<.»|md I-nsghvr. <,.\|lury.\'\’u»|ry4|\ L'f..wm1»,r~1|`1.11<\.,w.\,
s»1mv.1f,M.mq rmm, Tunn 1>u~§¢|.1m funn
lmmma fu paw, Spuio »mm.\gin¢, r01.gm», sul mv." um: :»..\.mK~_ <;.\|1¢f..\ Amman sul 1.'\\m- 1 f.~n-nw ;.»mmm», mlmv .lf
luly B<-mmm, umm s\pra|¢»<, ,\n»mdm\
New v/nl11>mwm,p, Rhona Harman (Gallery, sn/ mvm mu l>m\¢~»,;f, <;¢|¢m \\\»n |,.m\hm, x.»1L¢\\u/1. Am-0/»,plL~/,» <>,»m <'~1w,, mlm”
chmgo Pans lc<..||1|’c)nm|e\,[Lum
Pyfnmuk, lah" u/:rw <;a1|ffy, New wk s.»l1.@wm mul11f,w~p_<,.\|¢m Rmlf, Mvl lr\\Hl \\hll I)m|\'mX> N54-1988, K\||\>l|\n|lc
Sn/ Lemn- wnn dmwmgs. umm, U m,~.m'1rf<. sn-»\kh.»\m mm, smmlma L..\.\1<»gu» bv summ >mg¢f
m1¢n¢ v=ga, 1.1eg¢, ufngium xwwkyS.,/1,f\\m,Hmhh~m r~\uwum .md N al 1
New sfwnm, Donald vmmg <:a|1¢fy,urmg\, smlpmurf n;.m1<n.m§h|ngmn, mi, 1h|~»,hur¢ sul ll-Wm mm1>mw,.,g,,<;,,|¢m nun, Mumm
»vu1lnmwm_g§,<iemr¢ nzmonal dim by |>hy||» |<<m\1»\~fig1 <<m1..gu¢w
mn¢¢mpm.n. ummhnf, Frame sn/ mvm <;m\fm-S, X¢>~.,.~1,.»~, Almfl., s;..1¢fw M1 1,.~\m¢_ Rm", 11m\\f.~§\_ 1>.\m¢1 \v¢m\>¢fg
Gallena Marzo mmm, Rome wg, L|~g¢, Belgmm llnllcrv, Lm Angm,
vymmms uwmzrfs Sm papw, salem vm Sol L¢'W|l1 NIH l!n1wmgs,Gmcmc Murray (I.\|1cr). x<>r1,¢~\\'.u mm11m\\mg,,m||rr\<\ Ugn 1-mmm,
Lambert, Paris Fumhufgh lum
lnnuguralExh|I7v1mn. wuz! nmwmgs by sul Lmm, PM/< up my ram, nm mf nw, “mi sum my suz L1-\\'m \»a»r111mwmg\, 1¢X.\~ <.;»|1¢w, Hmm"
Drawnng <:em¢f, Nw vmk syv.»m= Hunks 1vys@1Lf\\m_ r\1||mf§.>u mmm _snrn~\m1,,\|nmm/m._».<»,Pu//uu1|/N.\p|¢»
Sal Lew,/1; Pr1nts1y71>-66,Ta\e(iallcry, Lumsnn fm awk Am, Mmmp.»1.§ [¢m|.»gu¢ by s¢»11,¢~\\m N1/IIJn1|\'u|g>/\1kvrA\ Am m,»~,
(caralogue by Icrcmy Lewisof-J amy Bnght) '1 hmm, M41 m;_\||¢f,',1s<»»n»f.
u»<<amn~ msvoav in
,W 1..»\v,1/ \\z.1z1>~.w~,¢, Iiundncr |<un~1mm¢un\
mmf, >~,W|M.d
Sul I,u\\'1l! lm' (mu/m'.‘vu \lr|¢c1un'< um] Thru
(mrrivrmllmm. (nacmc ?\.1urrzy(|a||cr\',
r.1..\hufgh
>~/1,f\v.,¢ Hlmk r;.,»,,mu~>, lulmn Prcmv <,,.|1¢fy.
Nw. \\\r|<
\ul lr\\'111. Srulpluwv ul gm/mh¢'<, Galcrlc Palrxck
Rn»,IAu».1nnu
'ml lL'\\'|1l ,\'u\\'_S1rm1un's, llunald hung hallvry,
sunk
r,m,m.»»» A ww ‘vu W f/wr a@f<<»~|, was \,»Alm'»z1_\,»\|erw |9<»u-;\»<»1». Pam
f, ~ UN Nmrlwf
s..I L¢'W||1,(§.\|Ien.\ I<I¢...<... I;..~».-.I II..|......., x..l I .-III... I\I..I.... 1\.........y., |‘I........\ ~.~...| \..Il.I\\'... I..».....I..-~_ II .I|||rI \\.I||I\.Iv I . |II.I\
luly <..\IIcrv, I I..»\.... \.III I I.m.|~...
s..1 1..~w.... <;..I¢.i.. nw.. 1. um... II......... \..lI.»\I'... 1. II..." ..I III.1l II..........._ ....... ......, \..1I. II... \...1..._...,.......I... ....,.............I|....
Sl;/r¢UI>.xnI I'W1lllu;r.llI|mIII| Iliuunrl, I\|1|.\\\ |’rn'l\\\. rum. .-..»....- .|'.... ..-................., I-_...I Nun \..Il
New Y...I< Nu/ I.>I\nI J. \IrI.|//|..I| I.|./I. lr..I...II.I~_\..|II.II
sry.../....... mul I......II........_ <;..|....- \'..... |995 ...I r\.\.\...I
I....h¢.._ I-..i. \.\I I.'I\'I1I. I .»\.... I ...|I.-.., I .....I.-.. \.I/ l.‘\\II/ .I1»I..I|I.|./I.~_I II Im. \..|II. II.
s..I 1...\v..., \II.II n...».~...§. ....... .1..~ I ..II.~....... ... \..l I.-\\'.I. III-.I...g1........._.., |..|... \\..|..~. I II.>~|rI_I .uw
1.>..I..».......l1>...... r<.,......., I‘.......\ .:..II.... .. <...|I¢.., N... \...I .......I.-H... I.. >..»........ \..Il. I\.II \.I.. ........./. .» IH... \\II.I. ..~I....
u..1|f.y_ u....~¢....v ..I v.-......... <...g.'. .II _.I I I....»I.».I I.. |<I....._. I |..|........ II<>\vIII |I|I|\
N... mm P..~..»>_ I<........I r...I.f._ I»..~..I.I...| (..\|IcrI, I ,|.....g..
x..I I..»\If... Q... ...A ~... ,...,...~., .;..I¢... wg., \..l I.-II .II I\I.Il I>.....~...q. ..,¢.. ...¢., I ........ . |996
I .<g._ Ix¢|g...... I»I.\rI<vI, New \urL \../l.I\\'.IIl'.....~ ...-.. ......_ |I..»r\I....».......I
MII I.-\\IlI Ivml.-:II/...I \mI./III.-I. f\<v I ..|I|.~|I M.».I.»... \.|, \.».\ I... I. II.|\.I..I I.. IILIII I
1994 New Ynrk \..IIII~|\,l |\I\.|~|I\ .»I I|..I|~|..II,I I\\rI.I||I
3ull,.'\1'||1, I.»I... wfl..-. ....|I..., N... \'...I. \.II I.-\\I1I \\I:/I I|f.I\Im_g», K||I\|v\..|I|r|I, \..vII| r\I...........| \.|,I».I... II III»m.|I. ul \II
x..1 Lfw... w;.1In.........g., I-_.If I ,..II.-. ._ N.-.. II.. I. \.-ll.'II'... <II....g...I...._I.I.......» I I...I..... .II \..II.II... II../lI»........ .1......II........ .....I
1.-......1I, 'I'/`/I.. za ni... N... v...I Im...-|...... \...../....... /......lI........ \. MMI.. I>..~.I.....,
S.-I 1,.w..., n....I......I.. ... I.....~..~... f ..I.-.I ... \.II I.-\\IlI Mu. I\I|Il \\I»II\ I\»wI.|II \..|I|v|I'. ‘\l.>\\ Mu I
lwu l7m'I funn, Q\|.\r\v| I 4I||\u|\\. Nvw \'|»rl\ lIu|\uz~I| \ ..| I|...II....I_\\'.~~| I|....I....I_I ...... \..I I. II... II.l....... ....... .I.-.I \...II ...,.......,.,
NI/ l,4'\\.'1ll. Knwll \\I|rl\» .III IHIIWV, '\Nw|II.|| II \..I I.-\\'.II l..I.I].I.\ I.......1y,|I..... \|..».-...... ~_I|.I :II I.|\ \II.II,I» I .xI,I .II \I...|...I .......I......
\.'crn.\. Lurlnh .\r\, l`|\I\ .-.~.., ..I I I.....|....,......~..I|.» I.. I....-.._. M .III..1I _.I I
Sul l,r\\'|1| 197;-IVQK. (..\|vr|c N.\II<\n-II.-r|.I_ I’.xrI\ \.I/ /.'\\IlI \.............. \I..1I II.....~, I<........ ..»... »..I1.\I'...1.........¢\,. .. II.. I Hn... .......~..... ...
XnII.~\\'|1| IIIIII l7n1w1II;1>,1\r( 81 I’\||»I|\, K .c|\c\'.| I ...aww ....g, \'.I|,. I ......I, I ._-.... ...I \.I_I\‘..I..\.|I. M......
x..1 nw... \II.I1 |....w...x<, /.-..~...I...., I.-.......I.. \..I I.-Iv... I\I.II1»........,\_ I...|....\I....g.-. \..I l.I\I... I\..II\,I.,.I.... 1.,....I - \.|...|\.-, II-.I...
<:f...n.... .I. v.|......, |...|. s_I.I......»\.~....-|.»_ I ..»......... \../l.\\... ,\... \\...I,s l...... I ...I|.~.. N... \...l\
\ul l,uI1'1|1 \\I4ll IIIWA W/ulr ,\Iyrn/Imnl nu Kimi MI/ lr\1III .......-I. . I...... .., \.‘.|I........ .»|I.g \..I1.\I... \... I...III......f...,~,V..-. \...< .~.....»
.....1 I<.~1....~.1 Im.. .... n....»., n...|....,. I<...I<.... I~I..\¢..... ul \I\. \’\'|||I.|IvI~In\vII, I\I.\»~. \Ir..III.»~\IIl\|\rI, I n ...-.I I\.....I.....
I..I|f.._ 1x..»..... _\IlI l,I‘\\'III x............, I ...|.-...- |»..-.... \.»....... \..I 1. II... I>........... .....I »...I.».....-, |I...|.....
...I 1..Iv..., .,.|¢... I...... .If ,I........., m...I...I .,|...g..., I mmf
I..~,I,.II,....... . ...N ,.. I...- I<.<v. < ..... .... M,..|...I ......I........
»-.Jw
‘I-.
.?,P1
_,L
fx
‘~'v
,_ Iv
»;. '
i§.|r°k T;
I
H UN »<m<>»w
Works from rhe Collection ofvororhy and Herberl Nnmeralrr Mu1hemnrlfnlConrep1s or conlehrprrrnry The lleorrle in lerrnw, whnney Muaeum of
Wlgel, Universiry of Michigan Museum of Arr, Arr, Leu Caslelli Gallery New York Traveled Arneriean Arr, New York
Ann Arbor ro Yale Universily Art Gallery, New l-laven; LA. Lonrer Gallery, wniee, Calif
Gallery Selzrrions, Hanson-Cowles Galleryn Darrrnoorh College Gallery. Hanover. N.H.; llhrh n snnle.l»1arranGoodnnin Gallery,
Minnezpolis University Arr Gallery llnivererry of Nnrlh New York
sioo Gauery, New York Dakoia, Grand Forks; unwerarry of California, rhrorlyh rhe snrrrrher, lreeon Gallery, London
nrnwingr, Daniel Weinberg Gallery. sao Franenro lryine; Arr Moeeoni ofsonrh 'rerae Corpus lohrr welrer Gallery, New York
lohn Weber Gallery, New York Chrlsll; Illinois Stale Univmlry, Normal; Frorn Allen lo znrker. Terar Gallery, Hrnlrron
Cullerturf, Worcester Ar! Museum, Mass. Muhlenberg College. Alle-nrown, Pa.; New selerrrnnr/Perrnonenl riolleoloh, l_oa Angelo,
conrernporory colleerora, Aldrich Museum of Gallery nf Contemporary An, Cleveland; County Mnaeonr ofArl
Contemporary Arr, Rldgelield. Conn. Minneapolis College ofAri and Design Malnplee. New \ork
Arrrrrr' Broke, hlopkrnl Hall Gallery, ohio sore
me |979 llniyorairy, Columbus
Atypirul worke, lrrlian Prerro Gallery New York Stulprarx' nrawrnga, Toneharone Gallery, Pl1msvlPress Pnhlrrorronr. l=eheny sarnnel Grllerr,
Aapekre der ooer lohre- Aus der sarnmlnng New York London
Reinhard Onnasrh, Narionalgalerie, Berlin Places ru Be; unrealrred Mrrrinrnenrnl Proyeor, senlprorr' plrnrogrophr, llnnler Gallery, New York.
loaralognel lkoaa lsrnian Gallery New York Traveled to Maealarrer Col1ege,Sl vaol, Minn.
Book Arr, New Gallery of Contemporary Art, GIld::Forma1amIlmageirl enrh cenlnry Ari, rironp erhrlnrioh, lohn Weber Gallery, Neo York
Cleveland Pace Gallery, New York Super Show, Hudson River Museum, Yonkers. N,Y,
New York Now, Mead Arr Gallery. Amherst Prorperool The seyenher, Aldrreh Marenrn of Traveled lo Cleveland Genrer for
college, Maas. Conremporary Art, lridgeneld, Conn, Contemporary Art
lzerweeh Sculpture ond Parnong, Worcester Arr ohe Hundred New Aeqorrirrona, Brooklyn lzeeenr Aeqnrnrlonr, Adler Gallery, l_oa Angeles
Mneenrn, Marr. Maeearn, New York leer Frgnrnlrrrn, Mar Prorereh Gallery, New York
coheeprnnl wnrkr by Eight Arnernnna. Johan AlumnlArtlsrs:£xhlbl1lnn royo, Syracuse Group Erhrhirrorr. John weher Gallery, New York
Preno Gallery New York uniyererry, New York Young/Hoffman Gallery, Glnrago
The Poerry ofsyrrerrir, laaroer Arr Gallery Drawings Abowl Drnwrrrge New nrreeriorie Arrlrrr lrookr, The Lrrerirl ure ofrirne, Edwin A.
California loarirore of Technology, Pasadena rrooli-larsl, Ackland Arr cenler, Unwernry ulrieh Moaeorn ofArr, wiehna srare
Drawing the Lines, Monrelair An Morenrn, N. l. of North carolina, chapel l-lill unirerairy, Kansas
Arr Is /or rhe spine, Paula Cooper Gallery A Gren1Blg Drawing show, lnrrirole for Arr and Rosa Ernian Gallery, New York
New York Urban lzeaonreer, las, r, Qneenr, New York
uniyerarry of Kentucky Arr Maeeorn, Lexington whirney KlenrlxlzIlg79.WI1llney Museum of 1950
Recent workf, lohn Weber Gauery, New York Arnenean Are, New York conrenrpornry nrnwrngr and worerrolorr,
Four Major works, Yonnyl-lomnan Gallery, zhe lzednrrrre Object: A surrey ofrhe Mrnrrnol Memorial Ari Gallery, Unryorairy of lzoeherrer,
Clucago Amhenc in :he lgoaa, Institute ol' New York
worlar an Pnpen Margo Learin Gallery, conrernoorary Are, lsorrnn cnrrerrr/New lairk, Lowe Arr Gallery, syraenae,
Loa Angeles Pnoerne +, nayron Arr lnaornre, ohio New Yclrk
saoo ond Under An sole, Franklin Fnrnaee, The Traditions o/Mihionrliern, Aldrieh Mneenrn Genrer for crearive Phorography, unryerairy of
New York of conlernporary Arr,l1rdgeneld,conn. Arizona, Tileeori
Geographir, Genohio yianahia asa., Mrlan worlo on rhe Wull, sen shahn Gallery, wilharn Explomrmrra in :he '7os, Pllrshurgh Plan for Arr
Yarlow/salnrnan Gallery 'roronro Paterson College. wayne, NJ. Prmled Matrev. The Museum of Modern Arl,
rrinrr /rnrrr Poroeol wear, New Gallery of lzeeehr Anynirlrionrl Arnerreon Prine, The Museum New York
Gonlernoorary Arl, Cleveland of Modern Arr, New York The Geamemr Tradition ln Amcncnn Pnlnllng.
Pornririg und Sculpture Today: rom. lndianaoolie cornrah College nf rhe Arla, seanle roro-roso, Rosa Earnan Gallery, New York;
Museum of/\|1 Aehniolean Museum olArr and Arehneology, Marilyn Pearl Gallery, New York
Liaaon Gallery london Oxford, United Kingdom Pier + orenrr; conarrnerron rn rhe Arr n/rhe
lnl<, Zurich Proeperrnr; rhe Seventies, Aldrreh Museum of sererrrrer, Hayward Gallery, London. Traveled
La lolla Mnaeani of Contemporary Arr, Calif. conrernoorary Art, l1id5elield,conn. to Rliksmuseum Kroller-Muller,Ol\erlo,rl1e
Nnrrreralef lor.;-1977, Minneapolis College of New York Now, Phoenix Arr Mnaenna, Arizona Netherlands
Arr and Design The Mmlrvl/1lTmdll‘xclvl./\ldrlc|1 Moreoni of znrerrrorronol senlprwre fnrhrlnrron, naael
Mnpped Arr: chorra, leonrrr, lzegrohr, Nohe conrernoorary Ari, lzrdgelield, Conn. Fornrn nerrgn, lnanlor for vranelle Gearahirng,
Gallery, New York (catalogue by Dororhy Mayhall er al.) Linz, Austria
Arriro ofrhe seyenrier, Yarlow/salrrnan Gallery, Padiglione d'arre nioderna, Milan Espasizlo/le lmcmnzlonnle d'nr|c, la Hlenmzlc
Toronio Drnwrrrg, l-lal lsrornrn Gallery, New York di Venezia, Venice
Arrirrrlanoka USA, Dalhousie unryerairy Nova arelrnhger i, Henry slreer Settlement, New York syrrerrr. Inquiry Tvun5ll1rl|m.Toucl\s\l:nc Gallery,
seolia. Trzveled to uniyerairy of california, Arrrrlr' sookr USA, lndependenr Gnrarora New York
lryiner Allen Memorial Arr Museum, Oberlin lneorporared. New York snreh, Lemme, Long, sohrlhork, lasaon Gallery,
college, Ohio; University of Wisconsin-Slonl, Cenobio yinralrla. Milan London
Menomonee; l-larzford Arr sehool, Conn, cornerr, eliae Meyer Gallery, New York New Edltlans: 1980, Multiples, New York
Grrdr, Eyanelon Arr Center, lll. ROSC 80, Dublin
yard Arrrerreon zarhiliirioh, Arr lnarirore of chieago We Mrehoel Ren colleerron ofArrrerrran Arr
salyarore Ala Gallery, New York rooo-roao, Melnloah/lnryadale Gallery,
waahinglon, uc.
:xniairl on wlsrolw
Collemon sennebend, cnc, l/lneee dan 1989 l1llll!7b;er1s, erlnienv seliellrnann, New lerb
contemporain, laerdeainr, Franee AI1sm1rrions,Tlle lvlnaenrn ofModern Arr. vrller neevellee; nrlnveenr preyelr, Genrre Genreea
Hel Meubel verbeeld-Flarnimre er An, lvlnseilrn New York lfnrnprdnn, Paris
van llenningen, Rnleeraarn learaleene by l-lnnb Capita seleere, srerleliylr Van libbennnenrn, Phelegrepln by Pernrevr and senlnlere Ariel/rev
l/lane et al.) Elndlraven, rlre Netherlands Ferrer, l<areren selnlberr, lnnelan
Pyramiden/Pyramids, ICC, Berlin and Galerie The Presrnfe efalerenrer New lnrlellerlenr, L'/in l-eneeplnel, nne pevrpeenve, lrlnaee wan
lille lcewenig, Freieben-laaelrern, Germany Gallery dee, unrverairy uf lllineie, Chicago rneaerne de la ville rle Paris learalegne by
learalegne by lelerniann wieelerl learalegne by Nina relalnnl Suzanne Page el all. Traveled le lrlneee
Amknwa. AUr¢d /rrlstrl. Sul LzWilt, Max Pmlelcll Andre, llenya, fldvln. Kerellv. lelmn, sewn, darr eenrernnnrarn rle lvlnnlreal 'lraveleel
Gallery, New York Langer ar Ge. Fine Ana, New York as Arie eeln-eprnel, and perspernve lo Sala
isles; The World e/,lvl Tedey, Mllwanleee Arr nnreriren ledlrbew, Galerie ae Poche, Pans de Eapeneienee ae la rnnelaerrln Gaya .le
Meleenni lvlerhedr efnbrrvnerren, Gallery urban, New verle venernnea, Madrid. As Cl1lll'ep!Ar7 sine
zerrlee, Hamburger llabnlrnf, Berlin (catalogue Mrnnnelrrm, Tale Gallery, l.iverpeel Pevepelrnve la lverelnnrballen, llambnrg
by Harald Szeemann ev al.) eee Wars efavnerreen Pernnng /mm me Geller-nerr llrnnr' Fnrnrrnre, Harrne Gallery, Boston
Erpeelarene inlerneereviele d'arre, la Biennale eyrlie wedrwerrlr alrlrenenw, Galerree larayene, Fvieenlrea. PllrllegnereeAlnerll~nn Merrmgr on
di Wvlezln, Venice Paris cenlevlperery Arr. Fundacan Galnnere
olayene, Lawrence Monk Gallery New York snnelnver rdeeler, Galerie Pierre l-lnber, Geneva Gnlbenleian, Lisbon learalegne by lnelnb
aealenva, Galena lnana de Aizpuru. Madrid (catalogue by Nielrnlae llearrraaell lzaeri Kirebnerl
wnggre in lrelie, Pinaeereea cernilnale, llavenl-la, leepelrerem Hrreelrl sr Adler Nleelern. New vnrlr
llaly lcalalogue by Henry Marlin) wevla en Paper’ lzeberr Gvervener Llenelrl /add. 1990
eerh Annrverrary Group Earlnbrrien, Paula Cooper sez Lemrn Rvber1Mungold, lin-lrard serve, Cross, Blum Helman, New York
Gallery New York /eel slapne, Paula Cooper Gallery, New verlr ere Fevllen ee lleeree un Perm, srlfrilng far
carl Andre. Deneld /ndd. sei Lelwrr, Galeria 57, seleered rnnlr, lareelre Alexander Edrnbne, konstrukllvc und konkrele Kumi, Zurich
Madrid New York lcalalngue by Margll Welllberg Slaber el al.)
Galleria lvlarie Pieroni, lzerne Prrnlr by senlprera, Landfall Press, Chicago and Fleerwerler, lvlneenm ef Contemporary Art,
The Turning Paine An und relrlrer in reels; New York Lrle Angeles
Twennerli Anniversary Exhibition, Cleveland silderrrveir, lzbineeiele l-lallr, celegne lvrrrgenvrern- The Pley efllre Uneeyeble, Palaie
cerner for Contemporary Art. Traveleel re srghrrngn Drewrnge wrrlr celer. Pralr lnenrnre, des bezux-arts. Brussels: \A%lner Secesslunv
Lehman Cullege Ari Gallery cny univereiry New York learalegne by nenald Knepirl V lennil
er New York, Bronx Edition Arrelier, Grae, Anerna Seleflcd Arrlsrsfram the First za Years, Max
ae Cubes, Fine Arie renrer, University of Made in /lmeried, virginia Beach Genrer fer Prbrereb Gallery, New York
Massachusetrs. Arnberee ine Area, Virginia learalngne by walrer narby Minivnel wevla renwelie. Andre, Flavia, /add,
Grids, Fnie Arla Genrer, unrvernry nf llannard el all Lellmr, Leng. lzynien, lannghellnn Gallery.
Massachusetts, Arnlrerar wevla an Paper; leealeae, lzlrena l-lefflnan New York
Aeeedenne, snnnefanrenrnnaenni, lvlaaerrleln, Gallery, clrieaeb Canrrmporury lllnerrered lseela; vvbvd and lwrege
rlre Nellrerlanela £s:en1laIPlzimlng: Kelly Lemrr. Mangeld_ selllly, ree;-lesa, Franklin Pnrnaee, New varlr.
Blank and wlnre, Marisa del Re Gallery. New York Nelson-Atkins lvlnseinn, Kansas City, Mo Traveled to Nelson-Alluns Museum nl' Arl,
learalegne by sani llnnrerl sel levmr in lraliar Complex refer ll, Gaera di l<aneaa Giry, lvln.; univereny er Iowa Museum
From rlre celleenen efnereelly end Herbert Vogel. lznnarnne ai Pnglia. laan, lraly nf Ari, Iowa cily
Arnar An lvlnrennr. Elmira, N_v. lealalegne Arrler/Designer, New York Genrernperevy Prrnrr: lnelndrng Barth, Bochum
by Pamela lleeelrerl. Traveled re Grand lzaenlr Medevn Mnarevr 'sa l-lelnngin Taiaelialli, LeWl!\‘. Ruscha, Sultan, Vhrllers, Tomoko
An lvlneeinn, li/lieli.; Terra lvlnaennr of l-lelainlei, Finland learalagne lo. lvlellanelerl Liguuri Gallery, New York
American An, Gliieage; Lanrneler Sculpture i Trrennal de dilanbr /can Mrve, rnnaaeie lean The New Classlflsm, Gallery nf the New York
l>arlr, sr Lanie, Me.; An Museum ar rleriaa Miro, Barcelona Schnnl of lnrerior Design, New York
International univerelry, lvlianri Summer Shaw. lohn weber Gallery, Nerv York Mlrllmnllsm, Galerie Ressle. Slockholm
lzeenen avnerleeea, sala r, lznrne nrreerly en rlre Wall. Laine Gernllarel Gallery. slrrper, Barbara Krakow Gallery, Barren.
Minimal ee eeneeprnel, Galerie Gabrielle lvlanbrie. London Traveled to lolm Sloller, Minneapolis
Paris A needde e/Aererrenn Drawing: lesaresg. Radrlral anfpapier, Aarganer lcnnsebanr, Aarail,
seele (Small), Rosa Eenian Gallery, New verlr Daniel Weinberg Gallery, Lee Angeles Switzerland
Linien:A1belten aufPapl¢1, Galerie Ralf Rickey Arr in Pleree Fqfrecn l/eere e/Aeryeinrrena, wbirney Affirnner end lnrerrrena seleenenr freer the Gerald
cblegne lvlnaenrn of nrnenean lirl, New York s, Ellrerr celleenen ef Genrernperevy ein, Arr
cellage, The Museum of lvledern Arr, New velrlr under Pressure Western Pvrnrvnelnngfvevn the l5rlr lnerilnre of Chicago learalegne by Neal lzeneera
werla er, l-liralrlrern lvlnaenrn and senlpnire cenrely re the Present, cenrer fer rlre Arie, vera el al.)
Garden, waalringlen, nc. [catalogue by Pnyllrr seaeli, Fla, learalegue by lane Kessler el al l Qlmlntlmls: Pav! II. Annemarle Verna, Zurlch
lznaenewelg er all elppveprrere /lrreerenenn Phatugruphyk cnvererrel Avnerrren Musrers efrhe ber; Early and Lele ll/evla,
Three neeader; The Oliver-Hnjfmnnn cellernen. lnrpnbe, Laurence lvliller Gallery New York Tony slrafraai Gallery, New Yerle
lv/lneernn of canrerneerary Arr, cliieage (Puvves ehelaier, Galerie lenriee Navarra, Parie Num/i Ilzvorl' Aliglllem e Bnnfl, Sul Lelwrt, Marlo
learalagne by l. Michael Danoff er all learalegnel Schjarm, Galleria Alereanelra lxenerne. lenrne
sel Levnrr/serene selnne, lvlarla cervera Galleryr Second lnrernenenel lrrenlrnl biennial Luvori mlavl: Domfnlru Bianchi, Sol Le\‘hr!.
New York Einlenehrenr vwll, ldlrrrel and simnl in H1-l, Die Glullo Paallnl, Galleria Ugo Fcrrami, Rome
Works an Paper Irlvlmriorlul, Shea & Beker Gallery, Deichmrhallen. l-larnbnrg. Germany lealalnene xx Century Sculptures /rem arp le zedlnnr,
New York by Harald saeenrann el al.l Galerie Aeadernia, salabnrg, /lnarrla
:xalairlna alsmav
Iemrifer Bartlett-Sul Lelfhrt: New Prtrlts, Gallery Twrory who naorrl wrwlrrrg Gallery. A srorr |994
Koraookl, Osaka, lapan ofaaoryrrrary Erhrblrroor, Daniel wriobrrg sralprhrr, Rhona Hoffman oallrry, vhrrago
'rwrory-1wrory¢ rwroorrh Anniversary Twentieth Gallery, Santa Morrrra, Calif Morro srolplorr Er/olohloy, llwoa fzallrry,
Cennny Work: on Paper, Rosa Esman Gallery, Amrrrroh am or mr rolh armory: Palhlwag London
New York and Sfulpture, Martin-Gropius-Ban, brrllh. rooo, lablohlra nalrrlr, Cologne
Helmut Fedrrle, Hamish Fultlm, Sal LeVWrt, Traveled lo Royal Academy, Loorloo Porta ood Mrllwplrr, lrlarllaorolrglr uraphrra,
Galerie Franck + Schulle, Berlin The nrrrrrofr Anniversary loozelooaf A Legacy New York
Pop ro Now; srlrolorlr fam the Prrmorror and a Mandate, Newark Morrom, N.l. Thr Ao or fwrwory Holoraow .llroowrob or
Cnllertiun and Extended Loans, Williams PREFABJ Rrrahrlarrlrg rhr Legufy ofthe sirhra, Hroory, lewish Marroor, Nrw \brl\
College Museum of Arr, Williamstown, Marr. Rose Arr Maaroro, Brandeis lloryrrarry, A Paolrwrg snow, Marrao ooorlroao (Gallery,
r5rh ,aaalyrraory lzrhrbrooo, Rhona Hoffman Waltham, Mass, Nrw rorh
Gallrry Chicago srrrorrgoa del srowriof ararg Harold. /oseph Mvrlvrvlul/1r1: Aorirr, flaw", /oalrl, lowol, lrlowlr,
Show of the Year. lohn Weber Gallery. New York Korarh, Sal Lrwm, Marlrar Oehlen, valarlo Moogolll, Ryymor, lworrr A Moa uoourorol
sammloog Lafrror. Neues Maararo wrarrblrrg, Rrylllagigrao. sooo, Spam rraralogorl Er/yllrlhoo Prrroorwag l-any aol: Now lvbrka,
Bremen, Germany (catalogue by Marrlo oardaor Sfulplure (Displayed loaaool, Mar whrrh Qursrxmt rhr cowowoo Lolo: “llfrllwolrl
Henrschrl) Prorrrrb Gallrry, Nrw York Arr," Hallen fur Noor l<ohrr, srhaffhaoarrr,
Tram/arm; srldoujrlrrslorlpror rm ao. /ahfhaodrrr, Uoragr, oalrrrr vyoo Lambert, l>arra swrrrrrlaha
Krrraarhallr Baarl loaralogurl rallrr from Two Drradra, A/o, New York ,ao Yuurx-Ar| lo rlrr rrrrryw rrorr' Tha Alllor/rr
Plarzvcrjizhrung, Sruugart, Germany maralogor Maloplr lmagro vhorographr Smre loo; pool uarorooal Hlaowy loo.,-rooa, Aldrrrh lrloarorh
by Thomas Krllrro er all the collrrrroo. Thr Mroram ofModrro Art, of cohrrrrrporary Arr. lzralgrnrla, Coho.
lzrprm, Morro oaolooal de brlaa arrrs. Riu de New York lraralogor by Brendan call rl al.)
laneiro Frrragaaroa nroproorg Shaw, callrry lax, uhorr llryrlopmrhr, bloaroha of cohrrroporary
De Hnnnurd 1) Bluelltz, Bibliolhéque nationale, New York Arr, chlrago
Paris Mnxwml Morwrrallww srlrrrra war/rr /row rhr For 15 vom. lsroolrr /urraorlry lrrloloor,
sprrlal collrrrioorr Thr Phorogyaphrr ovary /rom Levhtt Co/lemon, Berkshlre Museum, Pltrsncld, Thr blorrarh of Modrrrr Arr, Nrw xbrlr
Pop tn Now. lorrroarlorral Center or Mass. Traveled ro Lyman Allro Art blorroor, coorrmporary ,wrworl Awroroo Proof, Arlalraoo
Phorography, New York New loaooh, Conn. Gallery <1fAmericAn Arr, Phillips Ararlrrhy,
aoolo and Parrpllor .957-rooa, Marlborough Dr vrrrororlrog/Thr collrrrroo, slralrhjlr van Andover, Mars,
Graphrrr, New York Abbrrrooram, Erodhoyrh, the Nrrhrrlahda W/all to U/ull' Robert Barr); Dame] Buren, 501
Foorrrroal olajrrrr by Arorra and Arrhorrrr, Early MlnmtnlArtMus1erwvrk§, loho Weber Lrlalo, soooo Parrrrroo, /alla Rohror, lrly yan
Rhona Hoffman Gallery Chicago oallrry, New York ary srolrlrrr. Soulhamplon crry Arr callrry,
A New Ameritan Flug, Max Protelch Gallery, Pholographlr worlo afrhr loooa and royoa, soarhahrproh. uhlrra Kingdom
New York zabrlalrar c;allrry_ Nrw vorlr Opera Calonxn’ /ahora Korahrllrr, SoILrlW1t.
slrhop, Lrmmr, Mangold. Marttn, Wrmrr. oalrrlr srlrrrrd wall wo,/ra. Edroooa srhrllroaorr, vorooo .Mrarwla, /ahmr l»lroao, /ark sol. a.laoo:
Schorlle. Yaris. Traveled to Galerie Schottle. New York uhrlrlhopry, loo Trorloff Modrro Arr, rzologor
Munich om Cleveland lorrraorrooa/ Drawwrg larrrwoalr, from row Aloolarro-nrroro oflhr Aloolarr,
5éme rallrmoo. olayrrr aiwrorrr. Centre Georges Cleveland Ga1lery,Unl\ed Klogdom Galrrrr lzryrlrr, baarl lraralogorl
Pompidou, Paris rf Years: A lzrworproryr, Cleveland Center for Thr rwrr Mrrrwg afrnr sarrr sarrrly; An Howrogr
srrlrr and sraarorra coarrmpoorry Dmwrngs and Contemporary Arr, Ohio nraralogor by ro Erllr soor by /ohh Cage, sarah shrrhao
Prints from the Permanent Collefllon, National Ellen G, Iandau cr all Gallery, New York
Gallery of Arr, Washington. uc. ar Years: Parr r. Paula Cooper clallrry, Nrw Yorlr Dessms raoaerooa, Marr llloodraa, Para
Selenium; from rhr callroroo, Thr Marraor of In ra claarrrl who worlo/rom rhr Prwoaoror from Mwrwhal rn coarrplaal/arrf ubrkr from
Modern Art, New Vork callrrrlmwhlrory Moaram of/horrrrao Arr. the Dorothy oral Hrrhrrr vogrl callrrrrao,
New York National Gallery of Arr, \varhlogrorr, oc,
1993 Ralywhalyuver: A crrraa, Morraro of rraralogor by lnhn 1; Paolrrra rl all
The Gznmerrlf Tmdilllm tn Amertmn Arr Contemporary Arr, l_oa Aogrlra. Traveled Méml Si :lest In nulf, CAPC, Musée callarl
1930-r99|7,Whl!ney Moarorrr of /rrbrrlrah Arr, ro Mrhrl Collecnon. Hooaroo; Solomon R. romrmporalh, Bordeaux, Frahrr
New York Guggenheim Maaram. New York; Arr Tower lvzrarwr par Mrarayr. Gallery ran, New York
Eumpean and Amenrnn Dmwmgxf lgel-lysy, Miro, lapah; Pbllaorlohla Moarom of/rrr A/U fo Santu fr; l/arm obyrrra orrlgooa by
Nolan/Eckman Gallery New York cyorrwrgrr worlo by sol Lrlwrr ood eya Hrrar from Pamrrra am: sralplora, Laura carprorrr
Sculptures and Multiples, Brooke Alexander and rhr wrarhrrrpooo collrrlroo, wrarhrrroooh Arr Fine Arr, Santa Fe, N,M.
Brook: Alexander Editions. New York Gallery, uolyrrory of North Carolina, Papa, work lobrr wrhrr Gallery. New York
Prlorr /rom rhr roooa and loyor. Paula Cooper Greensboro wlorr worlrr: Group Erhrhllrao, l>arr\vllormrrlh,
Gallery, New York caorrrarrioo ro Process IV' My Homo is voor New York
The Callertiun Grows: Selected Acquisrttnns Howar. /rrrlao Marrow. Loaf. Poland worlo an Papro srlrrhoor from rho Prrrororm
logo-rooa, /radison Gallery of American Art. On Poprr, Tzuxrl ar co, New vorlr collrrrroal/yhrrhry Museum ommrrlrah Arm,
na; Einfnche ut dar srhwlrogr, Kooarhaor Zug, Ncw York
Phlllipr Aoarlrroy, Arraoyrr, Mao.
on Paper, Barbara Mathes, New York swrrarrlarrd somr Llkr lr cool, Barbara Krakow oallrry, Boston
our o[5ighr oar o/Mioal, Lisson Gallrry London Lryrra, olyrra <7 paprro lfarrorrr. Galrrrr Prvnts o/narlwrrrr, rogg Arr Moarom, Haryarrl
Narlrlo-srrla, Parlr University, Barron
oameanr sleganre, Locks Gallery. Philadelphia Sixties. Museum of Contemporary Art, Tokyo lnaiagiaral Bhilrittbn, 'llminas Segal Gallnyr
/lnainer llimeniian; Painringr by senlpirirs. in wanilmnlerei-wall Drawings and Wall Baltimore
lohn Weber Galley, New varlr Paintings, Kunsllerwerkstatl Lolhringer Strasse, Conceptual Tools. Selecriarufram ite lzWitt
Munich leaialagaei Collection, Oetllral Com|:c\ic\|t Stale
1995 Rerrinaidering me olrjart ri//ml rosa-i97s, University New Britain
New Piabltroltons, Brooke Alexander Editions. Miiaeiirn of Contemporary /ln, Los Angeles Golden Oldies and New Ddighls. Pine Prilll-5.
New York (catalogue by Ann Goldstein ez all New York
Carl Andre, Sol Lel*/lrt, Alfonso Artlaco. Inside/Outside: From Sculpture to Photography, In 1h¢ Flaw: Altmiate Authwing Smtugia,
Parrnoli/Naples Laurence Miller Gallery, New rink Franklin Fumane, New York
Drown on the Museum, Aldrich Museum of winks an Paper, WP Gallery, Philadelphia Capodtmonu in wntzmpmanea and Prospettiva
Contemporary Arr, lziagesela. Gunn. In Small Dimeneiana, Andre zarre Gallery, oelpaeaaniiievaricngliairenieniparnneiriella
RAW spare, Real Ari ways, l-larrferd, Conn. New York raazalte dzlo Staleliilr Museum di Arrinerdami
Sequence and rylamanye, siiaan Sheehan Gallery, From Christo and ltanne-Claude to /e)?'Kamns: capnaiinanle lvliiaenin, Naples
New York /ohn Koldor Art Projerrs and Collcmoni Limited Edition ,mme Books Sine 1990, Brooke
Carl Andre, Hanrltl)arl1ul/en, Sol Lellhlt, Mnaeiini of canreinperary Art, Sydney Alexander, New York
Lawrenee Werner- Drawings, Strurturex, learalrigne by Nicholas laaiiinel
Relations. l.C,. New York ,ld Reinhardt, Robert Ryman, Robert Mangohi,
reenee and Pernaanana The Power of Blork Richard Serra, Ellsworth Kelly Sol Lelfwttf 1991
and White, Anderson Gallery, Buffalo, N.Y Editions, One Great lanes, New York New virrlr on Paper, Bauingai-uier Gaueriea,
learalrigiie by Anne Wayslon er al.) Being Human, Museum of Fine Aria, Boston waeliingran, r>_c_
Bern/al and Hllla Berher, Sol Lel/Wtt, Eadwzard Thr Pmismu of Vewn, Pun ll: Donald lvdd.
Mnyliriiige, /lagiaar Sander, offshore Gallery, 1996 Sol le\Ml’¢. Brice Malden. Agnes Martin, Fred
East l-lai-npian, N.Y. Main S1o1wns,Caslno Luxembourg, Luxembourg Sarldbork. Barbara Krakow Gallery. Boston
45° :vera ea Lrngnirae if; onayrea ai la collertton Passions priyeee. Musee dar: inaderne de la ville sarely Made, Nnrwielr seliwl ofnn and Design,
do CAPC Musée, de lo [olleftlon du FRAC de Paris Norfeue United Kingdom
Aquitaine, et ae, rallerrirna primer, cnc, Pacewildenslein, New York The Power of warae and Signs. Index Gallery,
Musee d'arr rrinrei-npnrain, Bordeaux, France Retrospektlv ll: Sal LeVWtt, Rlrhord Tuttle: Kyutfla lapan
ivnnrmiiiring in Ainerira callaliarariye Prinn and werire/wirrlra igayeiyay, Annemarie Verna. Gcametl1CAl7sl‘1acl‘ion: Mel Bochum Sol Lelwtr,
Presses 196o~lg9n, lane Voorhees Zlmmerli Arl Zurich lmi Kno¢beL Andrew speniz, Nuinarli Galleryn
Miiaeiirn, Rutgers University, New lirnnawiek, Altghtzro e Eoettl. Hamish Fulton. Sol Lellhtr, Washington, nc.
Nl learalegiie by lrayiil lvlielrenlrery et all. lohn Weber Gallery. New York Muxlt: Alain Kinli, Sol lzlllhn. Thomas Ntlzlrnwslri.
*traveled ra Mary and Leigh slaelr Gallery, Minimnlnm; wrirlra lay /ann cliamlierlain, nan Gallery 123, New York
Narihweaiern uniyeraiiy, ryanaian, lll., Flul/ln, Ellswfirtll Kallyq Donald /odd. Sol LrW|t1. Calor and wiper; van Farbrn and napizfen, Galerie
Museum ul' Pine Arts, Houston, National and Riilirri Mangiilii, Lipwnrrli lniernaiianal Nichst sr. sreplian, Vienna
Museum of American Art, Washington, l),C. Arls, Boea Raton, Fla. Marginn virn Acconci, sal Le!/Wit, Gordon Mana.
lultonk Shaw, Little-iohn Contemporary, New Yurk D'unL' .entre luaiairr, Miieee royal de Marieinani, Clark, Robert Smtthsan, Barban Gladstone
Contemporary Drawing Exploring ine rerrinrry, Mrirlanwelr, oelgiiirn Gallery New York
Aspen Arr Museum, Liiliiraaa lq76»1g96 Twenty Years in Boston-Farewell Minimalist Prints, AR Giallnini Gallery Bulk of
A summer Show, lvlarian Gaodinan Gallery, Boston. Hella Baltimore. Thomas segal Gallery /lrneriea World Headquarters, San rraneiem
New York Boston
Systematic, Karen McCr¢ady Fine An, New York
Adding ir np; Print Aeiyineinarn lamina, Hare Bones, TZ'Arl & Co, New York Skulptur Pmjelrte in Minster 1997, W|:§d§|i§d|¢§
The Museum of Modern Art, New York Thinking Print: Books /ri oillbaanla iasiH9e5, Landesmuseum Miinsler, Germany taaralngiie
r:nrpiaa drlifti, Miiaeurn van Hedendaagse Kiinrr, The Museum of Modern Art, New York. by Klaus Bussmann ei al.)
Ghent, Belgium Traveled to Cleveland Center for xlvll Eepnaiaiirne internaaianale anim, la Btknrmlg
(imap Exhllzttlon, Pacewlldenstein. New York Contemporary Art; Henry Arr Gallery. dx Wrlczlh, Venice
virw /rrini Amari, wliirney Museum of American University of Washington, seatrle. In Visible Light: Photography and Clasitlficarion
Art, New York Ars om moo, Centro per l`arte contemporaries in Am Srienre. and the Everyday, Miieerun
Arfumolazmnl, /an [Jll7l1ets, Sol Lellhrt. Morto Luigi Peeai, Prato. Italy
of lvlrniern Arr, Oxford, unitea Kingdom
Merz. Zerynlhla, (krntrada Cervinara, Paliano, Traits senstlzles, Musée de Macon, France (Cilahgue by Chrissie lles et al.)
Ilalv
learaliigiie by Monique Dargaud el ala]
rrnlolrl on Nlsrniw
1m..W~ U. 1 \»1.z»./W. U/ mf/ nm. mb
_\.»r/.\\m,1,m.l. mul., \mH~»1>.|z1L»f~mf\
(fn/vu lh1rk<‘,Urrvvr,\\| |S.\\|\\h.x1]ur), |&klt.1~\
my mu U/ sulzp/V/H I mm Alu' l'ulu~m/ m v/»»
lm/,\\n1m m < mm, m,..m»..,,..1\\
:IWWvrf.-1Jm»~~.»| 1 hmf\~)|vr.l\41l/4~~\\
lm- ,\1~/W., \~l lmm xml/1 /Q/w. nm/
Rnlnmf lz/lllv, I7ur»k\ <».\|1¢r\, Nm York
\L~z,w.-, umm.. Huum .m \;..1|<.\`< mg..
_\L»,,/.<»~.» .\ /u-1//U/,H U/ um /V, N \~,~<~\
|<i1|um\ \\h\'|\n1.m. Nun Mvrk
[uw mn \\;»fn~ .W /nw 1.»m,1L~»\w,
.\1.~w~1,/, MIL sm. \\mm>,1um~.»
mu \.».k
.\I|mVml l’mr~` [mlm \\ulwr \,4Hcr\. \\'u \<»rL
U..-V :MW/H. u.\~\|\.<»1 1|\u f\r\~. Nw Mnk
.\r_ W/mmf .T z..»/ ~/M1 .hi [AML-r~ m :lm rm/
\\L..'.~1¢,..,m_w.f/1. S/mn ml1>¢»M.f\m
im Imzu, Nludvlnk f\1\|~u\m\, \m~md.\m
`.".m»gu~ 1»\ RH Im\`¢\41\
x~~~,.L», <,~~.,, I xhrfnmw, }‘.m'\\'v|<h-nnclu
ww wk
So\ Lewm wmv me \ns1a\\a\\un <re»~ am the \99s P.a<ewmens\em exnmnmn
:mm 1. <;.=|1m »1»,:\:@\` iurk
1'/W ,¢m1.\u»»\, [mon&|.4llur\',Ium1<m
_\4ul[>vzm llmmld lmhl, \/mm Immun. Sul l,u\\vl1
Rmlmzrruvl :ww W nk-f 1 f.,y;.g.~, L\1m»/.an M fm <‘»mbndg@, mm, <¢M\U,¢u¢, 1'f_m-Im m
x<\||mnmm.", \v,m¢f|h\»f\ s\-.\/mme. mn .sm/»_ /H. Aw \\mm~, P.m1.\ nwpm
Lkwpmgvf .\n>M_ mp/lg mul-»g»\¢ by lxngm
<,..r1,-U. Nw mm
nuker ¢\ nm |<\.|N."u\¢um Ahlen, ummm, .\1<.\d¢.m\ .Lf
r<.m»1,xa=f|m, FMC and :»1»|»e< d( m.\fL1.<_
~~,z,~,W, v.\`¢\\.1d¢1\~m n, Bcwrlv Hx|]~,\ .nhi
ww /mm .'\1mm4. bmw" P.'»p¢-»-fy, .W
m1,f\\m, fwzwf 1L\1,mg.ml_\\mL\\»n Pm-r,
.»\v»fm-¢»»»/4113.\\1“\n¢, r~\\m\\m on Amcmm Amwm, muff, P.\m»1\ An :»1u~fum,1~ng
An, Nw wk »-|\\|M1¢|p\m
Island, N.\'., Lmun mm -\f| xfuwunu.
nm sfwm mfpmu <5»11L»L~/M, me Am Nw L-»|\d.m, :mm 4,~,,,.41,n..~ f,~m~.,.,-.m.f» '\~~~`n.mL~
;LM~x\»_~ \»\ <t»m<|».1 L.\\|| ci AI \. Imwlul
cum, Lrm\~¢r<.q nf m,\\¢.hu»=|\>, /\mh¢m Hlmrmg my 1m~».1m|~ I|1sn1lI»1rmv/Ar/
\“ xm<-mm | ¢dvr.\n\»n \»f.\n~, nw \\»r1\.
71 5, me Am <;=n\¢r\ L'n\\mny of ~f»9»~yf», sm Dmgm A1u,fum <»»
\1am¢hu§em, .-\mh»m m \m\m,|m.m .an n. .\|lcr\, l'm\:m\\ ut
c'<m|fmp<»mv .~\n 4<m1\>gu@ \»\ Hugh \x
Nunh L..m\h|\.\, hrcenwlmmz Fmumm (..\]|cr\,
mumf, Barbara |<~1<m\ Llallerv, |a`Nm. 1>,\\Ȣ> H AL1
\,|mnm_ N \ , Mmfum my u.»|\~mpm_.r\ An,
1m~§m.11.4f1m.¢n~ n..,m,,gf, ml/pfw, Aw.:
1995 \,h»L.|gu Imam: .\r\ M\|¢u\1|\\, Cora] &|.\l1]<»_ H.\:
\\\»,/<5 M Pap", .\<1d»><>n Gn1|cryot1\mvr|\.m
\\'m\¢m imhr r V, Hf11mgm.“, “Mn _ l'n,»<f~.¢\
.-\n, Pmlnps A<m¢my, Andom, x~1.m, 1WL».sL..zf :>W."g§ /mm f/1.»Q.»/zL».,¢<»/1 Uv uw H
An <.,»Mrrv, \n1hvr»\,xm~~
Mmm; (fhomc, Mhrks on 1-ap", |>hi1m¢1phm um~Mk,\f\1<1f.<h Mum." ol <:.».“¢.“,».»m\
fm »,..»~».g my LW.-~.p.~..~ ».'/.mm mm.
lmmguml Fxrffmmm, me <.a|1¢fy :»|¢><\.~, An, n.<|gfn<|.1, cfm"
I/lc l’rrmmmvl A uflnlmrl, Mujrum ui
1\1m<<> cny lminmg sw,f1W\, Lm|1¢<,A1|=f;, x¢|,..f.~n.m1<
mm. <1h.\f|m|¢, x <.. <`.»|\m\\p.»m, »\r|,1_`h\.4gn
1»wgm$m»1f_ xwfk, mf nlpw/mm my L1-um
Hn ()Im.l nl Iimvrzrln, |~r.\nk11n I’nrr.\\¢h
r.¢>11.fL-mf, <.0nmmu| <.01|¢g<, Nw 1.\md<»" Ull. A (.ulIcLml I'xh|fv|lmn, lcnnun \\`v||\hCrg,
L~.\|\cr». Nc\\ York
Thmyffwe mm "1 r.`~»m Pmm Pm, .xmmg New ‘xhrk
(`mmvm\|m1 Pu»\1hlr Milk ff .411 <'.-ml f, 1gf<~f|W.~_
Pmm, Doxug/\rr,Nat|ona|(3a|1eryuH\rt, .'\1ulwznl Prvfmflnvl M1rzmml.'\r1 and ll» .-\1IrrvmH /1
\\.\1kcrAr\lc|\lur,?\1uv n¢¢p.m~
m~hmg\<m, mi. umloguc by mfm Brcucr mn ml /mm I/1.»KL-ff, 5/nw, <.u1rL»L/1.~,,
lm-1.Wp1.» .H 1»fm.f/.mv L¢»u~1~mrmg ;; xg-Am
fl al ] Yrxwled lo hnc Arts MusL‘umS of L.~»~mm \v|1m An <,n|1¢f,_ vn.\¢f~.¢\
san Fmnmfo .»/ 1 <»r1.-mwlkl mlrW11¢.~111,/M H/
uf xsmfrn A\mr.\11.\, Pmh <\.»\.\1¢»g\|¢ h\
1>»¢mW;~r1y.¢\.‘ mmm, \>f..mmn
Am azrxmf, Vn|co|d'c]sa, lialv [Ulm smngm
L'n»\fm\»_ N I m~.\\.\|.»gu¢ |,, vm mmn¢|1
um¢»mp.”nf,' mm, fignmupumfy H.~5r~.»y .\/,.mm1l.\», nm Hm»f|> Lambvn, nsflgmm fx .\1_\
und AmmulPmn1mg,\’Vl\|\ncy Muscum "Q <<.\¢\m»g\»< by <:hn,\¢x Sauer)
l7.»r||1hiIzni|1,_SuI lr\\'»r1, R .»f»m_\1,4»wrL1 1>,m,~_
Anxcruan An as Champmn, snanmwd, ¢.`»n|\. :;m~;-1;Xr|,1~m»~»/|m.m"w,, :>m“.».g§ .mn
\;41m¢ |-f.-n.1< + >~hu|\v,Bvr1m
Rummz znffhmdm/su1Lf\\'|»r C01/.11w~1m~,_ `sL¢.r,»f.U¢» <'1"1..m, rmm, LW, I.r\\1lr, .\1mw»ni,
rm A.~¢.;.' mf dvclgv/1 .k»11.».~/W 4 m1.m.~1v.»»,1
sum# smzpfmf/»m11 umwmg, 1<upp<|>.m|, Ryumu,<;.\1=m-1.¢|»ng,N»w mu
mf mr1m,.-H, >m|¢1»,1, \`.m 1\bbcnm~num_
Landcxmustum lvanrvrum, (Cru, .»\u~\n.\ 1.»m.mm.»»»» Hmm z»."z».»w,,, ,s.»r1.'\1m, /.nm F
1-,.“11\.-W,-, nw Nc\hrr|mnd>
Lf mr W/w.ff1'r,,./. rmuvfff ,1'm»~ wr/mmf. pmw Smvo/1,Snndr.x(isr|ng(i.\1Iery, xvwxurk
K,m:f/-1m~z1.- .\f1»m~». dn |vf~<m Iu~ wtiuur /a/mx
Lf 1~z0\wm mum, ummm nun Rhone /\Ips» ww f¢1K¢-uf/x»\wff1¢~5§, ART for mf xsmd,
mm mlfm |<m1\g¢r \|\.»u1 f , Munuh
mum, Tmflcd :U smgf d¢> N.“..»n\ Lwm J
»\/».m»>»\ 1»»f.~mf..»..¢/ HW/if lm". my >r,,~\,
Lwwmg lf Amhff l<1n¢io/Luugmzgr: mm" Ncw york, vs_ », Long mana any, Nw \xm<,
um., \;\.~,»r. <;\\\|m, Nw “WL
Amrncun Dmwmgffmm Q NEW rm rmum SFSC Pumpeu, Sin Paulo, Ncw Uc|h|
.\ m1,.pz.»~ ¢ l.»imm|>, 1 < m.¢w.\,_ Nw sm
cvllmmn, H.\mm umvmny An r»1u`¢u.n~,
z><»<|sm¢»~ wsvowv ww
as~f~~
QR!
1999 H11 1111,,,1.,11,1 11.11111111111111_ 1111111111111111111111, v111111,1111111111111 1111111111111 11111111 1 1111111111111
111111 \.». ~, 11.11111 11111111111111 (f»( 11 11111111111 \11l1.11111 1 ,L\fL 11111\1111111111111,1111111|11111; 1‘1111111,111.1,111111111111 s111 111111111 1.111111
111. 1111111111111 111111 \1111 \1»1111 \111~111111 (111|1'11|11111|~, I \~1`\ \r| 4 1'|\11'1,l 111111 1.111».11.11111111., 111.1111
\\1~1111.11_1.1-1 111.1111 11.1111111111 1>111111111111.11~ 1111111111 »1111111,1'11~111111.1111-11, 1111- 1111111 111111111 1111111-11 111 111111<11~111,11111 ,
11 v\ff., 11111 \1111.1111.11 \1,11111111111111111111111 11111111111 1111111111111 \..111.1111,\111111111_ /111' \v111'r111111 1111111111 .~1r1m111(.14ll11Y1',
11111 ,»\,. 11 111~1111»11111111-1_11\ 1 1111111111111 \|.1\~ 111=11 11.1111 1111111111 11111111111 111 .a111<111,111 A111
1 111 \\ 111111111111 ,»1» 11,1 \11,111,1111111.111 1111111111 11.1111-11, \1»11 111.111111.1.1111g11¢ by 11,1 1>111111p1 1111.1
11»11.11111 111111111111111,11111111111_1~ 1111111 1111111 1S1»~\1>11 1111111111 1111 111111111,1<111.1111111111 1111111 1..1111111_
11111111111 ~1 11 1111 11,1111111111\1 1.-111. 11111111111 111-111, 1111111111111-11111111, \1-11 1'11111\..1.. $111114 \Inn1¢_\_l1|119
11111111.1111 1111111.11111111111,1111~11__1111111111111111 11111111 111,1<..111.111111.111111111111.1111-11,\111\'1111 1111111111,1~11111111111 111;111,111»1¢n11 111111111
111111111111 11111 11,111.11 111. 1 11.11. 11,11111,1111111 \11111~/111111111111 H11111 H1111 1111111 \1»1l1'\\'11111111l \f11~11»1,~11111~1111111111 N.1111~1~1_\1<ph111,\'1111111
11»11..1 .\\', \111~11111111111111 \11» .11111 11.11111111 .111 11111\1111111;111 _11111.g111»1.11»1 1111 \1111111~111111111»1, 11111111 1.11111 1;111¢11,
111111.1111»1»1.111 111 \111~.11111 111111111111 11..11.111\.1»1.1111111.g.,111111g1.1 1»1» 11111 \\' \u1 imk
111.111 \.~L 1,11111-11,11\1.1111»..111111;1111.111111 11111111111 I11111 111;11l111V11 I' 11»1 11/ \\111L1r \r| \111111111s11111~ 1»1-111111- 111111111 11111111 1111 111111111 1
\111\11=1 111111-11\1111111.1,11.|1\ 111 \111111-111 1111x111 1111111111111-11111
11111111 \,\.‘~ 1111111111111 11.111111111111111 ¢1111111111_11.11»1111»11.1111-11_~..11111111111111
111 ,\\\ \.f~ 1 -1111111111 \1_11.»11111111 111 \1»11 1.111 111111111111 111 1111111 11.11~111111
111,111»111111~. 1111 1_1111111111»1.11111 11.11.1111
1111111111 1,11 111111 \1111111.111.111~_ \11_11111
1-111111111-11
1111111111
LIST OF PLATE ILLUSTRATIONS
7ne lollowrng lrst is intenoea as a FRUNIMAYYER rrontlsorece s, wall Drawing :¢9l5 e, sllrdv after l/elasotrel, less
representsttve soryey nl the artrst's Arcs, circles, ana lrregtllar bands lnt on paper
output oyer the past tour decades, rrontlspieae r.° wall urawrng me Latex narnl l4‘/a rr ll ln l3o2 lr 279crnl
As stron, rt rnsltloes many worlrs not A as rn l9l,4 crnl grro coyerlng the rlrst orawn ay; Dana Carlson, tewrlt collettron
leatoreo in the errhlbrtron. Those works wall. All two-part romplnatrons or arcs ctlrrstrna tteltnlanelt, James sheehen,
that were lnolooeo ln the srmoul/t from corners and sroes. straight ann snnly Ripley a. stony after ve/asqlrez, i959
presentatlon of the errhttnttan are not straight lines, systernatleally rlrst rnstallallon Paola cooper Gallery, lnt on paper
aesrgnateo wltn an asterlslr t~>. slaclr pencrl qno. hloe crayon ares New VDIK l4 '/a A ll in l3G2 lr 279<nll
NU( all WOVKS lil (Vie eXhlh|[i0l’\ BIB ann lrnes S9D|9Vl’ibEr, V999 Lewltt collection
rnclooea within the soryey 7nanlrs nrst orawn oy, sol Lewltt coortesy Paola cooper Gallery,
goto Susanna srnger chart Cnerven rrrst rnstallatron: Waiker Art Center, New York to. stony Alter Vslasque1,l958
ntlar lzopln. snartann whcnael ana Minneapolis lnll on paper
Theresa raoctn lor their ellnrts rn Aprr|_ |972 14 Ve lr ll rn. t3e 2 >r 279 cml
corrlpllrng thrs lnrorntattan collection cl the san rranttsea Moseonl Lewltt Colleclton
Am
11. E/1111.1 woaxs 40. Fluor Struclure, 1965 45. wa// Structure: /'ive Madules
so wo//1111q Drawing, 1952
Painted wood w/rn One Cube, s/ac/1 1965
1n11 an paper
9 1115/ein 122.9 1 29,5 cnu 96 1 96 X 48 /n. Painted wiwn
19.* On/ecrivity, 1952
Painted wood collecnon o1 the wnimev Museum ol 1243.5 1 243.5 1 121.9 cm/ 72 112 112 in. uns 1 30.5 1 20.5 ¢n11
50 1 50 1 9 °/1 in 1121 1127 1 24.5 51111 American Arr. New vpr11.n11rcr1ase,w1111 Collection ol w1|| lnsley, New 1/1111 Collection of Rouen ana synvia
Lewin Collection 1unds 1111111 me Painnnq ana Sculpture manqnie, was11in1;11~/nviiie, New 1/511
1151.3 1151.3 1 59 c1111 111 50 ’/1 1 31n (219 1154.3 1 75 51111 Co|lec\1on o1 me waiisworni Atherieum. 125.5 1 31.5 1 31.5 1111>
Lewin Collection Collection 5| Paula Cooper. New vork Haruord, Gin 01 vlrqinla Dwan COIIQCIIDI1 ol MJS, Parii
Armlher Version: Paul Maenl, Bérlin
11. Rim,1960 az! wall Piece /nor/1ey sn:/1/. 1954 11. Muvlm-/ge 1/ 1954 Anolher vErSi0l\ (Enamel On SIEEIIZ
011 nn canvas Painted wood Painuea wpaa wan can conipamnenis. 54 1/1 1 95 1/1 1 95 1/1 in.
50 1 57 1/1 111. 1152.4 1145.7 51111 50 112 1 21n.1152.4 1 30.5 1 5.1c1111 eafn mn¢a1n111q pnpapqrapns ny <154 1 242 1 242 11111
Lewin Collection Co11ec11o11 01 me Museum ol Samara srown. Los Anqeles, and Cnlledion of the Neues Museum
Fine Arcs, Museu111 of New Mexmo. 11asn1111;|1an1s Weiman Germany
11. /:un Fanning m/ue/, 1951 Lucv l_1DDard Colleccion 91/1 1 10 1/1 1 95 in.
011 on canvas 124.11 251 1 243.5 51111 ea wa// sznicriire 5/af/1. 1966
59 1/1 1 59 1/1 1n 1151.5 11515 cn11 sa! wa// Piece /, 1954 Lewin coiiecnon vainced wood
2s1a1e i11Ne111e Lewm. cpliecuon 51 Painted wood 43 1/1 1 43 ‘/1 1 9 =/1 in.
Peeer Lewm 40 115 1 2 111. 1101.5 1 45.7 1 5.1cm> es-au /1/uyn1111qe L 1954 1110.5 1110.5 1 23.5 cn11
Collection ol Paula Cooper New V011 Paincea wnod w1¢11 ten comparrmenzs. Collection 1111115 Museum of Modern
ze' Run /ye/low/. 1951 eacn fonlaininq pnozograpns ny /111, New Vork,Gi|ta1 Anna Legg
011 on canvas 54° I/apr srrucri/re,1953 5ar5a1a Ernwn, Los Angeles. ana
50 1 50 1n. 1152 4 1152 4 cm) 1>a1n1ea wood 1lasr1111ql1qms 91' wal//Floor P1ece miree Squares).
Estate of Bella Lewin, colleccion of 12 1 45 1 3o111.11B2,9 1121.9 1 75.2 cm/ 10 1/1 1 95 1 9 5/1 in |966
Michael Lewin l_e‘11/in Co1lect1on (27.3 1 243.5 1 24.4 cm) Painted steel
Lewitt co|1ec11on £acl1Sn1iare;4a14a121n.
24 Somersau/nnq F1qi/re, 1950 ss' wal/ Slrucrure Blue. 1952 1121.9 1 121.9 1 5.1 cm)
011 on canvas 011 on canvas and painted wood me VER Collecxion
52 1 42 "/111/1 /132.11105,9 cm) 52 '/1 1 52 l/4 1 9 “la in.
LeWi!tCollec(1o/1 11551115511 24,5 cm) 111. BL//cn 5 v/1117: 012:14 52° Modular wa/l5trui:1ure.195B
l_eW11lCo|1e¢11o11 cua£S.1955-1959 saueo enamel on alummum
as. wa//unq figure, 1951 B8 ‘/2 1 as V1 110 in.
1111 on paper as 05115/e wa/1 Piefe, 1952 45' Mac1ula1 Cube, 1966; remaae |959 (224.8 11 224.8 X 25.4 cm)
12 1 5 1/1 111 130.5 1 22 2 cm/ 011 an canvas and painred wood and 1999 Collection of virginia Dwa1\,New York
Lewin Collection Two pans, each so 1 24 1101n. Painted wood
H27 X 61X 254 Cm) 72 1 72 1 721n.1lB2.9 1152.9 1152.9 cm/ sm Wall Gr/H1 13 1 31, |996
ea! Workmq 01.¢w1ng, 1952 Lewin co11ec11o11 whereabouts unknown 1e1111h111on copy) Paimed wood 1alsn steel version)
1111 and collage on paper 711 711 7 in. (180.3 1180.3 1118 cm)
5 '/1 1 11 111. 1215 1 25.9 51111 av wa/1 s/1011015 1953 uc Floor srriicrure 5/af/1. 1955 Colleclion ol Bernar venet. New 1/11111
Lew111co11ec111»n 011511 canvas ana paimea wood vainceo wood
52 1 52 1 25 in, 151/1 115 1 52 in.141 1 45.1 1 205.3 cm) an rnwr/waii amz |966
11 seam: ngure, 1951 11575 1151.5 1 5: 5 c1111 cc/ilenion ol Tne National sauery 111 Baked enamel url Sleel
1n1 on paper coiiecnan of spnara a11111an Arn, wasn1nq1o11, 0.0. Tne uorprny and 109 1/1 1 10911. 1 37 1/1 in.
9 1 12 111. 122.9 1 30.5 11111 Hefner: Vogel cniuecnon, /xiisa Mellon 12115 1 21-15 1 95.11 cinm
|.ew1¢1co11ec11511 ae. noun/e /'/551 Structure, 1954 aru¢e funn. Pa1n1ns‘ vernianenz Fund. Collection ai nie 111 Institute 111
Painzea wooa and 0111 nl oaromv ana 1<1eroer1vooe1 cnnauo. gin ni virginia mian
za. w51/un; Drawinq. 1952 30 1 45 114411.
Ink and collage on paper 175.2 1121.9 1 355.0 c1111 41° Standing 0/wen structure Black, se Modular Cube 1969
9 111=/1111.122.9 1 259 11111 neszrovea 1964 Baked enamel nn a1u1ninun1
1ewi11co11ec11o11
Pa111\ed wood (also steel version) 50 1 50 1 50 in.
59.* F/our Srrucfure [ws/1), 1953 96 x 25'/1 1 Z5 ’/4111. (152.4 1152.4 1 152.4 un)
11. ww/11ng Drawing, 1952 Painted wood 1243.8 1 54.8 1 55.4 cm) Collection ul :ne An sanery 111
1111 and c°11age on paper 55 1 25 1 25ln.1139.7 1 11.1 1 71.1 cm) LeWi!! Collechun onrario, Yorontn
5 1/1 1111/1111.122 5 1 za 3 c1111 Lew1tlCo1|ec11n11
/\np111e1 veisiuni erivane coilecnion,
1ew111co11ec11o11
colorado
funn 1111 cun1e111porary Arc, 1912 calareu 1n1 un paper A wall 111y111e11 ye111rally1r1111l111ee11
ax unmlea, 1951 su11seque111yers111ns 111 1111s arl1-1ur11 lo 114111.125.4 1 35 5 11111 e4luaIDa1\s,ea<h 1y11n a u1llerer1l l1ne
Pr1n1ea a11n1111n¢erne111lur :111 e1l11l11l111n 111slu11e11 55 yar1a1iqns rather 111a11 49 l:ql1er111111 q1R1111er1an11 Syly1a q1re<111111,an11 a1l eu11111111a11ons
ol 511| Lew111's wqru at 111e nwa11 Manqala. was111nq1qny11le, New York 131a»:l1 pe11e1l
Gallery, Los Angeles. Apr1l1951 ew A/l rnree-Pan va11a111111e qn r1rs1 urawn 111: nazukp 1»l1ya1n11111
14 1 14 111, 135.5 1 35,5 c1111 rnree mfferenl 11111111 11/ runes, 1959 11. l/ernfal arm Hampnral Lrnes, 1910 June, 1910
l_ew111 c11l1e¢l1p11 |1111 ana pene1l on paper |1111 1111 paper 1=r1va1e w11e111p11
1111. New 111111, q1r1a111qnes Gund 1=r1111e11 annpu11¢emen11ur1r1e e1111l11l1p11 sauare cprnppslle, 1911, s1l11s¢reer11 equal pans. ea<r1 1111111 a a11lerenl
11111 pure11asell>1 e1¢11a11qe1 $111 Lewin. wal/ Drawings & srruczures: A square q1u1qeq nq111a111a1ly a1111 l111e 111reel111n,a11p all se111u1na1111ns,
A11q111er 11e1s1an: se11a/P111/err #1 rne 111211111111 111511 seqrnerrle yer11<a1ly1111p1our equal par1s_ eae11 »11l11l11ur rulers
r/:11co1 1955-ss F1qures/var1a11q11s of /rrfqmp/ere open 111111 a 111llerenl 111re¢l1p11 111 1111es cnlqrea nencll
1aa11e11 enamel on seeel cubes. Jo11r1 welaer Gallery. New 111111, Black vensll r1rs111rawn ay cnns Hansen,
9 '/1 1 10 1 1o111.124.11111.a 1111.5 11111 onqrler-1l11ve1nl1er 1914 F1rs1qrawr1 ny; Hans Herr11a1111 Nma Kave1n_A1w11l1a1ns
c111le1:111111 al the wesualisenes 13 113 1n. 133 1 33 e1111 ana others r1rs1111s1a1la111111 111e Jew1s11 Museum,
Lanaesrnuseum 1111 Kunst una Lew111 cpllee11p11 F1rs1111slalla11q11:Kq11ra11 r1sr11e1 New 1/11111
04 lrsv or eLi(1:lLLpsvanlons
1111. Alternate 5tra1ql1t, Not-Stralqnt, 1111 Double Modular Cube, 1969 114. wa/l nrawlnq #105 lla. P/an /or a wall mawlnq, 5 r.ll1./1,
and Broken Lines ol Random Lerlqtn, Palnteu s1eel clreles lronl me eenler o1111e wall July 4. 19751975
rrom Me Len sine, 1972 120 x 53 x 531n.1304.s 11150 x 150 nml 1Ac5 491. lnl1 and penrll on paper
|nl1 on Daver Collection of virqlnla Dwan, New vorn slack uenell ao 11 40 ln 175.2 11015 erm
11xl1in.1Z79 1 27.9 cm) rlrsl arawn by sol Lewltt san rranelseo Museum 01Moner11 Art,
Lew1t1 Collection 1q|. 7 Cubes Hall-0111991 nuqust, 1971 T.E,W13lkEY F0uV7L1E\lUV7 Furld Puflthase
Baked enamel on elumlnum colleetlon ol Lorenzo anu Marllena
1ea.- wall lzrawlng 1125 103 ‘/e 11 554 ‘/4 x15o1n. Bonnrno, Barr, ltaly req. wallurawlnq 11145
on 11>11r aoiaeenz squares, 11 one 11ne. 1252.9 115572 11 3B1rm1 All lwofpar1 eorrllnlnazlnns ol olue arts
21 ren I1nes,3>u11e lrunqreo llnes. cnllectlan ol :ne nresuner Bank, 11s. Wa//D/awmq #105 1rnm <orners and slqes, ana blue
41 one thousand llnes. A11 lines are Franklurt Ares lrom llle mlunolnls of twe slqes slralqn1,nots1ralql11,an11 broken llnes.
stralqnt and drawn at random o11ne wall 1AcG 51. Blue trayon
Black pencil 1oe.7x41<3,19s4 Black penell rlrs111rawn ny la B1asl,£ Nlarlln,
rlrst lnslallatlon- szaqtlsen Museum, Bakea enamel on alumlnurn rlrsl arawn t>v.sol1ew111 la, stnlup. P 5leqen111aler,s wlanler,
Leveruusen, cerlnany 159 1 159'/1 11 159 ‘/4 ln. August, 1971 Sol tewltl
Novemben 1959 1429.3 11 430.5 11 4299 cnll collecllon 111 Lorenzo anq lnarllena Flrst lnstallallon l111ns1nalle earn,
collection of me mac Plearqle. cnllectlon ol tne Walker A11 Center Bonorno, Barl, ltely swllzerlana
A|h|EI'\S, Ffahte Mmneauolls, walker Sneclal Purtnese September, 1972
Fu11d,l9B7 colleetron 111111e Solomon R
suqqennelm Mu5eu111.New voru.
1111* Four-Part Modular cube aornerl, v1ll.Al11:s 5 tluzs Panza colleetlon 1pnotoqrepn reeoras
1/1.141101 cunts 1975/1975 lnslallatlqn al Parlza celleellenl
Baueo enamel on alunllnum 111, wall nrawrnp me
lm. Larqe Modular Cube. 1959 120 1120 1 120 ln. All \W0'DEYl CONlb|Vlal10r\S 01 blue BMS ral. wall nrawlng 1:95
Baker: enamel nn steel 1304.5 11 304.0 11 304.8 cm) from IGYNEVS and 511125 and blue stralqnt ur noteszralgnl llnes ln (our
53 11 53 1 53 ln 1150 1150 11150 :ml collection ol tne san Franelstn Museum s1ralqn1,no1s11alqnt,an11 or1>l1er1 llnes alrecclons or ares tonneetlnq polnls
Colle1:11on ul the Emanuel Hoffmann o1Mo11ern Art, TB walker rounuatlon Blue cravon 40 ln. 11015 (ml apart
Founnaliorl. nermanent lqan to tne Fund Durenase rlrsl drawn oy; e, alasl. sol tewrn, slam nenell and blue crayon
Museum nfCel1temporary Arr, Basel, 5, »1ar11n, la son1u1>,l>,s1eqen111a1en rlrst nrawn t=v:Nl.cauro11l,s.coyre,
Swltzerlanq S Wldmef sol tewltt, P, Mora. R saecnl, E.
Flril lr\§la|lall0n‘ Kur\$Utal|e EBV", splne1ll,R 1osel11,Mlml wneeler
1o¢ 3 11 3 1 3,1959-az vl1.:1l1cs,c111cLss.sn11>s sw11¢erlan11111ep1<1ea ln 1111s pno1oqra11111 Flrst 1ns1alla11on 711sell1oallery,Mllan
Bauea enamel on alum1n11r1l seutemoen 1912 July. 1971
175 ‘/1 11 175 '/1 1175*/1 ln. 111. wal/Drawlnq #115 colleetlon of tne solqnlon R celleexlorl ol Mlml ana Peter Haas
1445.5 11 445.0 1 445.0 em1 circles and qrlq1/1001471 Guqqenneim Museum, New vork,
vrluate eolleetlon, eourtesy of Blaen nenell Panla C0l|eC(|0rl, C-111, |992 ree. wall Drawn-lo 11291
Konrad Flscller, nusselaorl rlrsr arawn t>y:s.l<a1o A 12 ln 130 5 <r1l1qr1o wverlng the
r1rstlnsralla111>n,Jol1n Weber oallery, 111 Llnes and Ares lerrnrolflon plan /or black wa1l.w1111l11 ea<11121n,1zo,5 crm
111s Drawing lor Seven slruetures. 1977 New vorn Kunslllalle sem, swrner/ane1, 1912 square. a yertlaal, norlzontal, alaqonal
|1111 on traclng paper seutemner, 1971 1n11 on never rlqrlt or nlaqonal le11 llne ulseetlnq
15 '/1 1 15'/1 111. 1311.4 11 41e ern) colleetlon 111 on anq Mrs. R l»1a1ll1vs, s Ve 112 ln 121.5 1 30.5 cm) tne square. All squares are lrllea.
whereabouts unknown Deurle,BeIq1u|rl Culledlnn niDo1o!hV and HQYDEVK Vnqel one nlreetlon at me llne ln earn square
The qates of me sleel s1r11e111res ana ls uelermlneq by tne qra1lsr1la11.1
tnelr eelleeelpns are as 1o11owa;To1>le11: 11z,° orla, arcles, Ares /rom Four Sraes lla. wall Drawrnq #250 w1l11e :raven ana blaell nerlell qrlq
1970. slorm nlnq Art centen new voru. and Four corners, 1971 on a black wall, all lwnrpart ¢om1a1na1111ns on black wall
rap riqh\: 1970. centre natlonal wart el lnl1 on Baner o1w11l1e ares from corners ann slqes. rlrst drawn oy: unknown
qe culture Georges 1»11rrlp1aq11. Musée 11 '/1 111'/1 ln. 125.5 11 23.5 cm) ana white straight,rlot's\|alqht.am1 rlrst rnstallatlon; Kunsenalle Basel
natlonal q'ar1 rnqaerne, Pans. cen1er Lewltr Collecrlorl oronen llnes senrernben 1975
1e1t=1972. Grenoble Museum, france. wrule crayon on black wall colle<1l11n ol tne Elmer uollnson 5s1a1e.
Center r11;r1t:1972, Tate Gallery, Lennon. na. Black zflrsles. Real Grla, Yellow Arcs rlrsl drawn bv:soll_ewl1t Har11orn
Bottom lelt, 1972, Alhr1qt11-l1no1 Arc tram four sldes and Blue Arcs from rlrsl lnslallatlon; San rranelseo
Gallery. Buflalq. Bottom center: 1972. raur Corners, 1972 Museum o|Mode1r1 Art
Raussmuller Cqllectlon. Bottom rlgnt; Colored lr11< on caper June,1975
1972, Moaerna Museel, Stockholm, 15 115 ln. 140.5 1 40.5 :ml colleeflnn ol 7ne Museum ol Moeern
Lewltt culleetlorl Arl, New vor11. rrarllonal 11111 111 an
we 1 2 1 1975 anonymous aonor
Baked enamel on alumlnurrl
IBO x 350 >r1B01n.
14572 1 914.4 11 451.2 cm1
Collertlon ol General services
A11mlr1ls11at1qr1 1G.s.A.>. Svracuse,
New York
ulsr ur l=tAv£lt1usrnA11o>1s 40
Amérirarl All. NEW York, PMCNBSE, Wilh tee wat/ Drawing sssz
res, Wa/1 Drawing 11355 tn Lines trgrn the Miagernts
tunes tram the Gilman reuneatien, Inc. 1he wen is divided vertteeliv into three
A 12 rn 130.5 rrru grra eeuerinq the al Lines, 1915
equal parts, ree. veiiew. and blue, lst
wan. within each 12 in. <20 5 erm int on Mvtar
1a t1ain.145.1 ir 45.1 ern) ren Lines from the cernen siues, part: Un ren. white vertitai Parallel
square, one arr trnrn the rerner
Cmlection n|Dan1e1J.Kramarsky ana Center tn Pnrnts an a om 1911 iines, and in the centen a Square within
trhe direction ol the ares ana
cgier etehrng and auuatint which are white herizentai Parattei
their aiaternent are determined tw
tae The Laeatren er a Line, 1915 35 1 35 in. <es.e 1 as.e cm) tines. Znd gan; Un yeiiew, white vertical
the rtrattsrnant
Ink on acetate Collection gi the fine Arts Museums of parallel irnes and in the eenten a circle
White trayun ana black Pencn grid
san rranersee, Anhenearh Foundation within which are white herirentan
on hiatt wah is 11arn.145_1 1 451 trni
Lewiti Collection for oraghie Arts, crewn Point Press garauet Iines.3rt1 nad: on nhre, white
YIVSI GVSWU by U|1kr\GWr1
F1rst1n5ta11at|on Addison caiierv Arrhn/e Purchase, gitt ot several donors vertical parallel iihes, ena in the centen
otAmencar1 Art. Phriirps Aeaeernv. rar. The teratren ol su Geametrrc a tr1eng1e within which are white
figures. 1914 ish- wet/ nrawri-rg 11299 heritantei parallel Iinea The vertical
Aneeuer, Massachusetts
int ana per1c|1on paper the wall rs en/ieea vertreaitv inte three hnes ee het enter the figure,
tteeernhen1=1a1
ceiieetian et the Museum ol 22 1 ao in. 1559 r 15.2 emi equal garts. each with a ttrtierent enter. White erayen on rea. vethrw, ana
LeW1tKCnl1ecttnr1 A 5 rn. t15.2 emi gria cavevinq the watt. niue wait
centernanrarv Art. chreage. Gerald s.
[1||O!( C0|1E(l1KlV1 ist part: on ret1,white hnes from the first drawn try; Marianne Guntheh
tee-rea wait Drawing #301 niirtgernts ol eaeh sine to geints on the new ttiggantmthani. Jn Watanabe
The 1oca!1on of hnes ana oeernetrir grnt. zne part: Un yeitnw, white tines nay, 19111
tee weii orawtng #912
A 12 in, <30 5 cml qrra severing the 11qures.(Yhe taeahens are determined treni the tenter to neints an the grin. cgtieetaen of the Wadsworth Atheneurh.
wa1I5,W1\h|r1 eaeh 12 in tzo 5 erm try the ura11srnan.1 xrg part; on niue. white tines from the riarttera
5quare,nr1e are tretn the rerner er aiaeir gentrt corners to points on the grin. seen
the rntegetnt ot one sine 1The ttrreetien First arawn hy;sg1tewrtt part has an equal number ul tines. ree wat/ vrawrng 11151
of the ares anu their placement are First rnstaitahnn; Torre veerhie. <1ne number of itnes and their iength :ight geernetrre Iiqures (including
determined bv the araitsrnan.> sgetete, ttaiy are determined hy the araftsrnenm right trrangie. xt drawn with white
white rrayun ana htaetr uenen grra an Deeerneen 1915 Crayon ana pencil nn watt erayeh an a niue vaulted teiiing.
qrav waits Courtesy of the artist Ftrsl drawn oy: Je watanatie white rreyen on hiue ceriing
first erawn ht, Sachtkn che. Emily Pigiey Firsl|11sta1|at1on,Fort werth Art first arewn ey: Anthony sansetta
1une,1999 tau waiiorawing #232 Museum, Texas ana ottvers
cattertren ot Barbavs ctaestene. Tt1e1oca!1or1 of a square. Neuerntgen 1915 Agni, 1991
sag Harhun New vert Black geneii eeserrgtinn anrt hiaeir Collection of Levt Strauss 5 cernnanv. Collection of the Pftiladelpftia Museum
crevon square san Francisco e1 Art. Pttilauelnfiia. Purchased with
First arawn hy- M aisset, M. verrneiren. a grant muh the Natiunal Endowment
sei Lewrtt ree. wat/ Drawing xeeo ter the Arts and with funds contributed
tx, 1.ocA11oN F1rstrnsta11et1en;Pa1ars des Deaux avls, A 5 in. 115.2 cr1\)qr|t1 covering a yeiiew tw Mrs tt. Gates uuvn. Mn ana Mrs. N.
Erussels wall, Blue tines from the ieur corners. Rreharn when Mrs. Donald A. Petrie.
reef rne Locatron eta Red Mav, 1915 rea iines trern the rniapeints of the c-teen ane Peter Rnsenau. urs. melt
Paraiieieqrarn, a B/ack Ngtfstrarght tewnt caiiertren four sides,wh1te hnes from the center schaan, Franees and iaayaru Storey,
trne, a Blue Triangle, a Rea Straight to points on the qrtd. <1he number nl Marten aeuitan streue. ann two
Line, 3 Ye//UW Aft, Sflda YE//UW ras. wa/1 Drawing #259 hnes anrt their iength are determined anenynhsus eeners thy eirehahget.
Peetangie, 1915 A 51n,t15.2 thu gnrt covering each at hy the e1raitsrnan_> with attnnienat tunes from nr ana Mrs.
catered int ana ueneit on paper 1OUV NECK WBIIS W|'\I|€ ||V12S to DOVVIIS neu. uiue. ana white erayen. tiiartr William weigin. tne naniei w. Dietrich
is 1 1a rn. 145.1 1 451 emi on 1719 QIIUS \S(wB|1‘ 2/31l|'\ES1f0Vr\ pencil gnu. yellow wall foundation, ann the rriernts of the
LeW1!\CoIIec1>on the center zna waI1:l2lmes1rcmtt1e rrrst ttrawn hy: c. cieuqh and nthers Phitaitetvhia uiuseurn nt Art, tsaz
niutnutnts ol each at the sutes ant wait First 1nsta\latton: ttaitwaiis. suttaie,
ies, Rea Lines /rem the tewer ter: 12 irnes trgrn each earner nth waI1:24 New York tee- wan Drawing 11341:
Cerner/Blue Lines from tne Lawer irnes trern the 1:er1\er,1211nes|ron1\he January, 1915 sit-hart nrawing, the wait is thvinea
Right Cerner. 1975 rnntuernt of each ui the sides, 12 tines Private collection herienntatiy ana vertically into sin eqttai
Catered inn and uehetl on never from each curner,(Y11e1eng1r\ ol vans. 1st vert: On red, hiue hurituntat
15 1115111 1313.111 3B.\cr111 the itnes antt their placement are parallel iines, and in the centen e circle
Private co11ect1or1,Paris determtned in the ara1tsnian.> wtlhin which are getttrw vertical paralbel
Craven ang nenci1on hiatu wait x. Gt:o||E‘rn1c forms 1ines_2nn Dirt: on yeitnw, rea herieentat
teh' Lines to Sperm: Paints. 1975 Firsl drawn ev' Jo Watanabe parattet lines, ann in the renten 5
inn and ner1c11on ve11urh_1n11 on acetate First rnstaiiatren- netratt Institute tee. fewer rwith 12 qenrhetrre figures Wuare within whieh are etue vertical
is >r1ain.1457 1 45,7 cm) ot the Arts and //7125 in [WD dif&‘CIf0llS), 1984 naranei hnes. ant part: on hiue. yellow
LeW1ttCcIIe:tian Juiy, 1915 Concrete with marble ana sitiee on herienntat parallel iines, and in the
First rnstaitatren 41h wa14:The Museum S1991 Hamewnrlt centefn a triangle within which are ren
tee. Lines ta Spec//if Pmnts, 1915 ul Mndern Art, New York 252 1 B4 it ae rn. vertical parallel lines. nth part; on rea.
ink ana gentil on ve1|urn,1n1< on acetate First arawn tw: Jo ann Ryo Watanabe (540.1 X 213.4 it 213.4 Cm) yellow hnfienntai naratiei lines ana in
15 >r1a1n,t45.1 it 45.7 crm January. 1915 siit ul visiting Artists. inenrgaratee, the center a rectanqte within which
Lewitt Coitection Collection n|!V1e whitney Museum at tothe citv of natennert. iewa are etue vertical parallel iihes. sth hart:
iss- wal/ orawrhq #355 varmshea nv: John uooan Marsh. 1909 FIVSI inilallalinnf Brooklyn MUSQUIII.
lsomexrlo lroures ouurnea ny 3 rn. Mav. 1991 collaelroh or the Des momes Arn Center New Vdrk
<15 cm)uam1s wrzhrh each plane are colleohon ol rhe uresaner sarrlr. (CoHrn rme Arts Fum1l,Des Moines, Iowa Mav, less
3 in <15 cm) wrae olaou oahos al rranlrlurl LeWi(( Ouiletlinn
parallel lrhes in ohe ol three airecilohs, nl. Form Derlved from 5
Indla 171k na-rar. sexrrpora rormeh<T11reo forms). Cum: Rerrano'/s mens). 1991 eos' Wa/I vrawrnq M71
rrrsr orawn oy oavro Hroornoorham, 1991 Gouache on never Asymrhelrieal pyramrn wirh color lnlr
Ahrhonv sahsona, Ja waranaoe 1nl< on paper 22 'le ir 29 1/1 ln, <56.5 x 15.6 :ml washes super-imposed.
Flrstlr1staHet1an: Pau1a Cooper Gallery, rwenlyaseven draw1nq5,eac71: Lewin collection color lnlr wash
New V001 11 11. ir s 1/a1n,<30.2 ir 22.1 arm rrrsz drawn Irv: David Hrggrnuorham.
Ocl0ber,19El colleehoh of che wesrlalrsohes ln. Farm Derived /ram a Tony Tassel
courresy ol rhe arhsr Lahoesmuseunr lur l<rrnsl una Cuhir Rectahq/e, 1991 rlrsz insrallallohr nelso. me.. Chicago
Kulhrroesehlrhre Muhsear/ Gouache on never march, 1906
ro-Hoo, Wa/V Drswnnq #541 nauerlerhoaoe oes wesffansohari 30 11 44 '/- rn, <16.2 1112.4 :mi Prrvale eolleohoh
On each of loul waHs,a!l1!ealolm wllh KUV1S!VEY9H'l§ Collection ov me whitney Museum
eolor mn washes superrmposeo rlrsi ov Amerrcah Art. New York eos wal/ orawlhq xsls
wall- :he oarlrgrourro is GG. Len plane. 102,11//Ones, Two; Three, fours, synimenrleal Ilatftonped pyramids with
YRY:r1qh\ nIar1e:YBY.ho(\nr11 plane: and nr/eaparr comolnarlans ol me soo Wa/l Drawing #520 eosor rnk washes suoerrrhuosea. eaeh
ERB. serorra wall: :he hackgrouno rs W, aeomerrre Ffqures//'Ne oeomerrlf Forms oerrveo 'rum more reeaaholes. wnh a 1 1/a ah. <20 :ml olaolr oorneh
Len plane; Gao; r1ohr plane; Rss. lop rroures ano rherr comaiharlons, 1991 with color ihlr washes superimposed color ina wash
n1ane,VGR,Tr1l111 waH:U1e oaelrorouho varnreo wood color 1nl< wash Hrs! drawn 1w:Jearr-Jaeaues
rs RR. Left plane:GBB:1lqrlKp1ar1e'RVG; €scr1'5 ir o ir s in (15.2 1115.2 115.2 om> rrrsr drawn oy: Vransle l<r11aars. sauweraens. semaha du chamoon.
bottom marie. csv. roirrlh wan: The courresv ol the arhsr Roy vrllevoya chrisuwhe cuzin. Pierre rilrnui.
oaslrqrouhn rs sa. Lellp1ahe:GvB; rrrsl 1nstsI|atlon:GaIeria Juana oe Davie r1rqqrhho\haih.clauoe Picard,
rlqVl(n1ane:GRR3!op pIar1e:YGY rss' Forms Derrved from a Cube. 1952 Aizpuru,Mad1ld Brunn nousseloz. Anlhohy sahsrma.
color rhlr wash Parhtea wood Octuhen 1959 Marien sehouzeh. Ja warahahe
rrrsl orawh hy Ahzorhe aonhomnre. 5 ir 54 ir 15 lh. 115.2 x 131.2 1190.5 mv Courtesv or the amsl rarsx rhsrallanoh: Arc, Musée d‘ar!
Bruno Rousselol, Anlhony Sansone Collecuoh u|Cam1|Ie ollver-Hoffmann moaerne de Ia ville ne Paris
Flrsllrls!a1Ia!1nr1‘Ga|erle Vvon Lambert. eoa. wa/1 nrawrr-ro aslz reoruarv. 1901
Paris isa. war/ nrawmq #831 Forms oerrveo Irom a ouorr redanole colnechoh af che Leipsiger Messe,
senremoer, 1991 oeomeme lnvms wȢh color mu washes superunposea. Leinzio. Germanv
colleerloh ol the vrrornra Museum nl lasraux aervlro pain: Each is ooroeren wizh a 10 rn. 125.4 mo
nne Arts. Rrehmonp, Museum rirsl orawn oy: John 1-looan aho orhers eonor inn wash hand. me Wall Drawing 8498
Purchase. The syahey ana Frances semenroen 1991 <Al The oaolrorouna rs sv. The hand is rlanonlaen wramiu wich eolor ihlr
Lewrs Enduwment ruho colleshoh ol 1he ouooehherm Museum lm, rroh: marie; vc: sine plane; ne; washes superimposed. The background
arloao suse plane; 0. The oaelrqrouno is sw. is GRGRR. The (UD is YGER. Three sides:
rro.~ war/ nrawrrrg #552 The hand is vv. From plane: vs; sine 111: vos; 121: vas: <a1= new
Trllea lorms wnh eolor inlr washes ras. :sol-nerrre rrgures, 19e1 plane: vw; lon Diane: 0. Two1orms. color 1nl< wash
superrmooseo. las rhslallen at Paula Cooper canary, Len lornu the oaeuqrouno rs sa. vhe Firsl drawn by; Douglas Beige;
Color mu wash New vork. 1901: nano is c. Front plane: vov; sine plane: David hroqlnhoaharn, xaauuo
Frrsn orawn oy oavro Hrqqrnhorham, lriu ano penerl oh paper GR; rop mane: ww. mom lnrm: 1he mwanioeo Anthony sansrma.
Uriaa Tay1o1,Jo waranane zach; 19 S/s 1119 S/n rh 150 ir so cm) uaohorouno is ma. The nano rs o. Front neoeeoa Schwab. Susanna srhoeh
Flrst1ns(aIla(<or1.Roya1Sfnltlsh various ooueehohs plane: vsv; sroe plane; sv; luv plane: 1<el Tsuiirhura, .lo Watanabe
ixraoenw. sornoorqh ac. <01 The oaehqrouna is nm The haha First rns¢al1a1lon= The nrawlho cenrer
neeemher. lssv isa. farm oerrveo from a Cubs, was rs sa, Front plane: 11011; sine plane; NEW YOYI1
Courtesv of :he arlrsl Baked enamel on a1um1nun1 oanal ave; 1ou ulahef ala. Selltemben less
Eazh oahe1. approxrmarely; 39 va 1 39 color inlr wash courlesy ul me artist
‘/11111100 1100 cm) rrrsl drawn oy; Mary Del Mohleo.
colleehon of lhe uhrversilarr Meoisoh Douglas celqer, Jackie ulenllvsnen ao; Pyramlrz 19es
cehrronr, $a1tT11r11an,L1éq2,Be|qlulv1 Janet Passehl, Arrchonv sansona Gouache ana oenell on paper
July. 1959 14 V. ri 21 va ln. raoz rr sas emi
Collection nl the wausworlh Axheneum Lewin coneolion
Harrloru
0 1151 ur v1.A1[1LLus1nA1<oNs
aol Pwahrre was xl. suns rrrsl prawn hy. Jose Alprgl, Anne Palryr :ze-en Maquenes mr lrregu/ar srars.
orauaehe and pencil on paper Anrhahy sanspua. Magdalena zalac 1993-99
14 va 11 zl ‘le ln. 136.2 1 54.e ann era* rlye»Pprn1e¢1 Slar with Bands Flrsl rnslallallen cehire par( eenlerrr Walercolor an paper
Lewin Colleclion ar Ce/ar. 1991 pprarn, Ancren palals des exppsrllgns. Maruenhayen P1nyec|,Camml;sloned
Gouache on paver Geneva meplciep rn lhrs phelpgrapm hy lhe Arnsieraarn Venus year me
lul. Pyramlli |986 22 ‘le 1116*/e in.(57.2 rr 41.9 cm) June, 1953 Kunst, Arnslerparn
spuache on paper Lewin Collecllph cellechen pr ine Dallas Museum ol Maauelies lahneaiea hy wrllern wgln.
19'/z X 23lrl,(-19.5 X 58.4 Cm) Ar1. gill of The 500. lnc , Mr ana Mrs flrnsleraarn
LeWi\\ Collecllnn era. wal/Drawing #395 Michael J CoIllr1s,and Mc and Mrs
siars wlihihree.1ounlrye,snr,seven. Jarhes L. siephensen Jr.. |985 zu. /rregu/ar slar, l993~99
zn PYramil1,\986 erah(_nrhe.ana1eh peinxs, arawn wich vellpw and rea nlrel(
Gouache and pennl en paper a lo ln. 125.4 crnx wipe panp ol yellaw era. rryewgrnlea slars, 1995 Markenhgyen Prwecl, Carhrnlssrenen
19 ve 11 23 ln. 149 5 rr 5s.4 color lnh wash. The area rnslne the Engrayrrrg-ernnassep rnullrples in ny ihe Amsterdam renas voor de
Lewin cpllecharr haha is ren eplnr ine wash ana ihe area Twin Rpcher hanarnape paper hunsl,Arnsler11am
puisrae :he band is hlue seler inn( wash 54 >1 54 in 1137.2 111372 ernn
ern. Pyrarnnz 1955 The slats are separalea hy hands nl mrlrpn 15
Gouache gn paper 1hrlra1nl1 wash, Prrnlea and puhllshee bv Dayra Larsv.
19 S/a 1 23 1/A rn. 149.13 rr 591 cm! Color rnl( wash Iwo Palrhs Press, New van( xll. Banos
Collection av lhe whnrrey Museum el Frrsr arawn hy' Jose Alhiel, Anne Pairy,
Arnerrcah err, New York, purchase, wrln Ahlhprry Sahsalla,Maql1aIerla zalac are Slars. 1967 ns wa/l Drawrng 1:4113
lunas lrerrr me Parrrhng aria seulnlure mrs( rnsiallahen cenrre a'arl cpnlernr Palnlerl wood Bands e1 lines rn leur celgrs ana faur
carnrnrllee ana lhe urawrhg cernrnrnee perarn, Arrcreh palais des exueslilens. Each: 39 11 39 11 39 1/-in alrerzlens separarerl by gray hanps.
Geneva (99.1 >1 991 11101 crm lndlalnk,lndlalnL1 wash, and celer wash
Zll. Wall Dfawmq #449 Jurre. 1933 Cpllecllgn ral lhe Dallas Museurn gl Art. mrs( arawn hy Jp walanape,
MUl[lD|e BS‘{Yl\|f\E\VlCE| DYVHMIUS wlih cplleciren pl :he Dallas Museuni a14ri. gl1l al lhe arllsi Jrni wlehnrann
color inn( washes superrrrrppsen, Frye ern p1 The 500, lnc., Mr. ana Mrs. rrrsl lnsiallahen: The Museum ol
pyrarnles, The hacugrpunp is snow, Michael J. celllhs. ana Mr ann Mrs. een. wall Drawing :ram lhe eieneurn. Helsinki
Trrsc pyrarnru; the avex is cenleh Four James L. sxephensen uh. 1955 (eurreni lrregular szar wrih eeler rnl( washes Octnhen 1953
sraes: (l1: RR: 121: GRB: 131: env; (41: els. lnsiallazlen pepreiep rn ihrs nhatoqraph) superrrnposea North enp wall the celleccren Q1 Equllahle me Assurance.
The connector: Rvla. Serena pyrarrrnl: hackgreunp is vw. Bangs 1-1 frern new vera
the apex is <eh1er Four srpes 1l\;slaa: ers' Stars [proposal /er wa/I drawing erlerlarle lh1erl0T(each:B =/4 ln.
(21: oven: 131:Gs:(4>:o1 The cenrrecr /ar Da//as Museum a/ArI),19B4 122.2 ehl11:1l1 RER: 121: G. 131. RvR: eas. wall Drawing af 37a
lor:G.TVli1d pyrarnia: lhe apex is eenreh Gouache on paper 141: EG: 151: RRG. 151: sc. 171: GGG A square awrpep horizontally and
Three SIGQSZ (III RVBRI (2): RVR§ (311 21 ‘la >11s'/e ln. 154 ir 47 ern1 calar rnh wash yerircahy rnia vpur equal parls, each
oven, The cennecwr owe, Fourth Lewltc Collechan Tlrsi prawn ny Jael charnherlarn, wrlh a arllerenl plreellan el 3 in
pyrarrna: the anex rs cerrlen raur sides: nayrp 1-lrggrhhalharnmrshrnuga, (1.5 cnr1 wine allernallng parallel bands
111: G: (21: voan: (31: RR: (41: Rom ere- wall Drawing #sue Pairlcla P|1lIllus.Ellzabet|l Sacrer el lines. The hahps are nrawn in lnala
Trlih pyramra: the apex ls centen scars wich chree. four, llye. sn. seven. hnlhenv sansena. Reheeea sehwah. ink washes.
Three sraes: (11, G; 121: nv; (31: eleven, erghi, and nine pplnis. wnh bands nl KelTsulimura,E1lc zerrnann irrera ini( ana inpra inn wash
Color inn( wash caler rnl( washes superrrnpnseel, varnish: John Hagan First arawn lay Marianne Gunlher,
first arawrr hy: rrarrsre Kvllaars. celer rrrh wash Fehruary, 1991 Jo walahahe
Marreh schpuren, Roofs Theuws. First drawn ey: enmany sansona Collectlon ol lhe Disney Deyelpvrnenl rrrsz rnslallallgh Banco Gallery. Milan
any vrlleyeye and elhers ce.,orlan11e July. 1932
Nwvemhen 1955 Tirsi rnszallallnh. 23rd lnlernailehal ceileehprr nl Henry s McNeil,
cnllecirpn al che Minlslere me la arena( pl san vaela ear. wall Drawing #729 Philadelphia
ccmmunaulé iraneaise, Musée earl Octouen 1995 lrregular ealar bands,
rnerlerrre el :fart eenlenrporarn ae la celleclren ol (he whitney Museum ol cplpr ink wash an wall Drawing M84 B
yrlle ne Liege. selqrurn Arnencan Arl. New veru, purchase, wllh rrrsz arawn hy; Evan Terlae Square hgraeren ana rlwrelea hprrzpnzally
lunas lrgrn the Painlrng and Sculpture vrnce Janes. Anlhony sahselia ana yerheally lnrp leur equal squares.
ere. wa/1 Drawing usz leae cernrnlriee ann the Drawing carnrrnliee varnlshea ny Jenn Hagan each wich bands in pne el veur plreelrphs
peuhle asyrnrnelrrcal pyrarrnes wilh Augusi, 1993 color rrrl( wash
ahernahng parallel (he len srpe or era wal/ Drawlnq #396 Collectlon ol the High Museum el Arr. rrrsl prawn hv: rrahsle l(lllaars.
l>gllern1 eahas. slars wllh three. leun riye. six. seyeh. Alla|1\a,GlftulMaTkand Jugilh Tavler Roy vllleyeye
Gray ana whine rnarhle (lahpy liner) erghz, nine, ann len pelhls. prawn wllh through the zmh cenzury Art Aegulsilrph Trrsi rhsrallacrpn Galerie rranek ~
cellechen ol (he Musee au Theaire a1olh.125,4 cm) wine haha pl yellaw funn ana ihe zozh cenwry Arl saclely schulle_ aerlrn
Rgyal pe la Monna1e,Bmsse|s celpr ins( wash. The area rnsrae :he June, |991
laana is red cnlnr (nk wash ana (he area cauriesy el the arllsl
pulsiue the haha is blue calar rhh wash.
The slsvs are seuarated ny uanps ol
lnuia nil( wash,
Colnr (hl1 wash
Gouaene on paver eolor 1n11 washes svna11rn1:oseo. Dan >111srr1 1»er|1nan, Cena Radek. 3111 aan: 1111es arawn 1111111 me vow
50 11 50 1n. 1121 11121 11n> co|or 1n11 wash Anlhony sansana, Tonv Tasset 11ar111;orne11o111ose parms an me 1e11
ca11ea11an 111 the wn11ney Museum 111 r11s1o1aw11 byi Harm Geerhnqs, nrsc ins1a|1a11on; Rhona r1o11n1an side and mccom ol me wan. The areas
sanerm cnirago between me 11nes are 1i11e11 in a11e1na1e|y
Amerrean Arc, New va111,a11r1nase, w11r1 1n1;11¢1 Masman. Rebecca Schwab.
1u1111s1ro1111r1e Pa11111nq ana Sculvlure w1n1 Slarkenburg. Tom van der March. was 111111 111a<11 ana 1~n11e.
co1n1n1nee andthe Draw111q co1111n1z1ee Laaken, w111an1 wo111 co11e<1ion of James ann zayrne cloonan. |1111ia 11111
va1n1sr1e11 ay: Jann Rogan crneaqo rim 111aw11 ny; Pa111 Brand.
Aerv11¢ 11a1111 <e1;ua|snac111g on an uneven wam. washes su11e11m11osea 1111111 one or ue wa11n1aw1nq 11543
r11s1111aw11 11y,Nao1n1 F1111 ano others |n111a11111 wash the 1ou1 corners, on 111111 wa11s, lines 11¢1n1 me mn.
r11s1 111s1a|1a11on Ace ea1|e1v. New 111111 rrrsx drawn ov: Mananne Gunmen ca|a111111 wash oonom. ana sides to miapoinxs 111 the
A11111, 1991 rra111 1<a1ser Jo wacanane r11s1 drawn ay; cn11s1111a ca¢a1111a11ge11, 11111 ana sides of me nan. rne areas
cou11esy 111 the ar11s1 F1rs1 1ns1a11a11o11; Dacumenta 1, Kassel, Anznony Sansana between the unes are 111|ea rn wan
Germany A11111, 1992 1111111 mu washes sunerirnposea.
an wan u1avy111q #291 Mav. 19112 co11ee11an ol me Amornuz Palace >1a1e1. ca1a1 11111 wash
Two-par(111aw111q.Two wans a1e earn ca|1ar11an o1111e oe1nee111e1nuseu1n. soo1e1o. |1a1v First drawn ay: ce¢11 1>a11na1s.
111v1aeu no111e111a11y ana ve1¢1ea1|y 111e Haque Andrea uareseausni, A1e111s »1e111an11,
1n1o1ou1 eQua111a11s,1s1wa11.12 1n, 141. wau nrawmq #462 Anmovvv Sansmta
130 5 ¢n1> bands or 1111es 111 111111 ua 1111es1n Four o11e111o11s, 19112 A1as 4111.11o_2 am) wine, 1111111 me Seplemllt 19131
111re1:11ons, one o11ee11on 111 each pan, o1ave| n11opo1n1s of 1au1 s111es,111awn wim co11ee1ia11 o1 the Musée s1, Pierre,
orawn 1n n1ae11 |11111a1111<_z11u wa11. 55s 11 55a1n.11411.3 1114113 1n11 a1ze111a1i1111 nanus 111 urav ana o1ae11 Lvon. nanee
Same, 11111 w11r11ou1 colors 111aw11111 |ns1a11a11o111 wave 11111, Brnnx, New voru 11111 wasr1,lsKv1aII:a1cs|ror11(he(OD:
111111a1n11 ana color 1n11 wasnes. Des11oye11 2ne1 wall: ares rr111n1ne |ef¢; :1111 wall: ns wan waning 11630
111111111 1n11 ana eo|o11n11 wasn ares 11am the 111111114111 wan: a1<s A wall 1s a1v111e11 no11n1n1a11y1n1o¢1~o
r11s1 111aw11 oy» sa1an 'A111u, Jean-Luc an, L111es 111 faur ofremons, 1955 r1a1n the oam11n_ equar nans. 11111: ane111a1ing nar11on1a1
Arvers, M11:ne1 1-1a11s111enav, nav111 eaueo e11a1ne1a11 a1u1n1n11111 1a1a111 a1111 gray mu wash 111ae11 ann vmile 1 '/- 111. 1zu 11111 bands,
1-11aa1naaznam, Jean Mane Rernen 1oao 11 use in. 121412 11 2194.5 em) r11s1 arawn ov; se1q1o cava1z1n1. Bo\tom:a|Ief11at1ng 11a111¢a1111ae11 and
r1aneo1s Rouen, Anmony Sansotla 1ns1a11a11on- 10 wes1 Jackson aouuavara, Mauro 1>11ae1o1o. A111nony sansona. nnua 1 1/a 111. 1211 em: oanas.
An111. 1953 cnreaqa Serum Sarra 1na1a 11111
ca11e<r1o11 111 :ne CAP: Musée 11'a11 ca1nn11ss1a11ea bv A11 1n 1=1111|1a P1a<es r11s1 1ns1a1|a¢1on: s1u111o oz sonogna. r11s1 drawn ny; 1=au1 K|eiine_ Mneo
1on¢e1n11o1a111,1ae1aeau1,r1a111e co11ee11on ol c1ene1a1 se1v1aes nalv on1us1. uarien senau1en
Ae1m1111s11a11an1o.s.A.>,c111<a1;o Jan11a1y,19ss rim 111s1a11az1on1 Ga1e11e on1us1.
aa1-ue wa11u1aw111g :uso Courlesv ol the ar11s1 Amsterdam
A11one-.zwo-,1111ee'.a1111 1o111f11a11 za; L111es1n ro111 n11ee11o11s,1991 Janua1y, 1990
eom111na11o11s 111 12 111. 1311.5 11111 oa1a11e1 111a111|e aaa. wa/1 orawrnq 11519 c1111e<1ion of Frances Dinmen cnieago
aanus 111 11nes o1aw111n1na1a1n1r o1a111e1e1;21a111_154s_1s emm A11s 1 '/a 1n. 120 cm>w1ue.1romt11e
India Ink Blvd CDIUV wk WASH Ronald Reagan wasn1111;1on Na11a11a1 mio11o1n1 ol one s111e, co11111111111a nn me wan Draminq 11631
r11s1111awn ny- Salah ‘A1>111, Jean 1111 A1111ar1, was111nq1on. oc 111111 wa11s, a1awn 111111 a|¢e111a1inq A wan 1s nivided 1n1o mo eq11a111ans
Arvers, m1ene1 1-1a11s1ne11oy. Dana nanns 111 n1a<11 1n11 ana the nnne wall. hy a 1111e a1awn 11on1 eo111e1 to earnen
111qq1nao1nam, Jean Mane Pe111e1, an, wa11n1aw111q 11459 1n¢1a1n11
Left: a11e111a11ng diagonal a1a¢11 ann
r1a111;o1s Ro11e11. A11111o11y sansona A1es 4111 11112 <n11w1ae,1ram1o11r nrsr drawn ny: Annrea ~1ares¢a11n1, while 1 '11 rn. (20 emr hands 1n1m me
r11s11ns1a11a11a111cA1>c Musee a'a11 corners, eo1n1>os11e, w1¢n a11e111a11na An111or1v sansoua ‘ aower 1e11. 111111111 aner11a1n1q 111aqana1
eon1en111a1a1n, 1ao111ea111, France nanas o1 oray ano color 11111 wasr1es_ The First i11s1a||a11o11: sanaria Auessannra a1a<11 ann nnne 1 'le 1n. (20 em; hands
411111, 19133 wa11 1s bordered ana o1v1aee1 nor11on1a11y Bonomu, Rome 1ron1 the uooer 111;m.
covnesv e1 me a111s1 ana verneauy 11y a 4 1n, 110.2 amy mae sen1em1>en1=1a1 1n111a in11
black oa1111.uaoe11e1rnuaa1an1;a1ay cnureesv 111 me arnsl r11s1 drawn oy; Pam neiine.
eaa. wa11o1aw111o 11112 a1111 yenaw ares 11arn 111e :op left, upper 11111111 on111s\. Mariefn senaunen
11req111a1 11qu1e w1111 gray and 11qn1qua11ran1,q1ay ana rea ares 1ra1n ua. wan nr-awrnq #582 r11s1 instaliationz Galerie u111usL
black 11a1111s,
the ton 1111111 1.11we11e11a11aa1a111:q1ay rnree-aan drav11nq.\sl 11ar1: 11nes Amszeraam
oranne and wmre ares 11on1 the 11o11on1 ren. arawn 11am the lower 1e11 1or11e1 ol Janua1y, 1990
oe1o11e1, 1994 Lower 1111111 aua111an1; qray ana z1|11e the wa1| 1o1ne 1n111pa1n1s ol :ne tap ana causeuian ul r1anees Dittmen cnuaqa
ca11e¢11a11 ol sn1n11111u 1fLAND rower ares 11on1 me 11ouon1 111;n1, nqh! sides <11 the wan, ana the pai111s
11111111 501111 1n11 wash
between. 2nd pan: |1nes 111awn 1111n1
First drawn byZDa1/ld 141aa1hha1hah1. za Camp/ex rarrhs 1:49 aha 1:51, 1999 <a1hr 1h1< wash haha Band c~,1r1ahq|e wash1ha1ah, uc.
ahzhahy sahsena. Reheeea sehwah. Pahheea when BRR 1£>1whcrha1»ahes aueX-|e~a1>eX
whhh sraruahhura. hahs vah Kaa1w11X, sash. 113 1/A X 1s =/1 X 12o1h. whch ea1ar1h1X wash haha. eaha: RR.
Teh vah aer Laaneh, wi11a1h wa111 12oo X zoo X 304.9 hm) xrhahqlesz G 1¢1Eaui1a¢erahcr»ahqhe
varhzshea hy; ahhh 1-cuqah Courtesy caneha Maha Rherahh, Rarhe whrh cahnr hhu wash haha haha W.
Uctohen 19139 1rha1hq|e; Rva,
caneeheh ar Anson hu, Laeuwaraeh. calhr ihk wash
:he Rezheruahas
Yomas lvanrnerg, Emily Ripley purpIe_ar1l1 qreen. ln lne center is cnrrslina uenmanelr, James sneenen. cpurlesy of rne artist
Octoben 1999 a black qlpssy alan. Emily lzrpley
canaenan ol lne Jewisn museum. Arrylrc palnl Sememben 1999
New York mrs: prawn bv: Elvre Apranrs. nayrn Courtesy Paula cooper canary
nenrpewpll. Jay reasley, Meanan New varli xlx. Primo wonxs
aaa! Lanny Drmpy, 1995 Gansen M1:haelG1hbons,Jahr1
lnk pn nauer Gibhons,CV1ris Hansel. Jann rippan, asr, Wa/lDral1vmg #979 an- surfea Cube cunrainirrq an onjen
29 '/1 x 34 ‘/4 in (14.9 1 B1 cm) Beth Lealnerrnan, rrlsnn Lowe, Arcs ana uanas. pr nrrperranee out Little Va/ug |968
Pnyaze cnllerllon, New York slepnen MaImed,5a1ah wlszneanev. wal/ urawrnp #923 slaerr-anmmine pnpcpqrapns rrrpumea
Matthew Pruaen, sean Rrqlay, Arcs ana errele, on never
aze. wallbraw/ng #am Paul Swer1heck,CIinK 1alreaa Latex varnc 12 ‘/r 11 lo rn. (31.11 x 25.4 am)
sprrai mrs: rnslallanpn; lnsmure nl rrrsz drawn ay: Nalnanrel c.a11ra,41we11na Lewin callenipn
Blau parnl on wnile wall cpnlarnparary Arr. Pnrlapeipnia Gual11onl,John uppan, Anna xunz,
rrrsz alswn ay vaul Devens. Mav. 1999 rlnralnv Rrnlev. Russell willrarns ue-an srprre Walls, 1915
Norbert crunsenei, Rpel xnappslein. caurlasy p1 ine arnsl seplarnaer 1999 fauneen vlmpearninqs
Rrlr Me1|ers_ vaul Rpnnaas, carlrresy nnpna Hoffman callery, £a:111mage;4'/a lr 4 ‘/1 in. 111.4 lr 11.4
Anthony Sansalta Alex zeqners ser. wall Drawing #asa ChiC3\]O mn; lrarnear 13 lr 13 rn. <33 11 33 cm)
rrrsz rnszauanpn; apnne1an1enn1useun1. Black ana aalursr llal and glossy, Eamon; e plus 4 printers pfoofs and
Maasrrrenl. Acrylic parnl aaa. Arcs ana Bar-111s rn Crrlpn 1999 :1 anrsfs moms
lne Netherlands First prawn ny: Nlrplar Anqelov, Danrca srllrscreen Pnnxea by nprrs srrrrrrrelinu and mum
January, 19915 nalur, Jann riuqan.1npn1as Mass. 31 '/a x 39 1/» in, <80 1 loo cm) ny xeyur Parlrer ar crurrrn Pprm Press,
cpurresy ol lne arlrsn Jay Matthews, vralar Maarxans. Ealnnn; 50 oanrlana, calnprnia
Nika span, Inqrid wenar Printed ny Takesnl Ama, Vsutomu cpllearan or me Umversiiv p1
sea wall Drawing #540 June, 19911 Kallrnaur, PierrefVincen\ Bralllarn. calrfprrua. serueley An Museum,
curyea panns. culleeriun al vlcmnln versienerunuen, Rlenarn wma, Watanabe Studio Lm., 11111 of me artist
calpr ink wash Dhsselduvf Brooklyn, New vera
First prawn ny: Anna CecLnl1nl,E.v.d, Punlrsnea nv Eainuns scnellmann. sau srrflr wan cprnppsire 1971
ulevaen, Anrnpny sanspna. rernanaa au wa/1 Drawing #911 New vorlr ann Munlcn alan-anrwnire pnrnngrapn
vala, Aninp Wismen lyp zanpnl irregular arcs,11requIar yerneal nanas. irrrage size: za va lr za 'lr in. 112.4 rr
varnisnea py. Jann npqan ana rrreqular wavy nanas, asa Npnfsepnrenlf rprrrr #2 1999 12.4 crm; merau: ao 'la rr so ‘/e in.
renruarv,199a ncrylre parnl Palnzea linerqlass (TLS 11 115 em)
cplierlipn p1uss,Lur;ana,sw1zzer1anu rrrsl arawn by; Anlnpny sansplma, 24 ‘ls lr 20 1 5'/1111. callecnan of me Henry An Gallery,
Mrp 1a1<1sn1rna.H1r1enr1nlprnura <52,2 >r 50.11 ar 14 cm) unnrersizy at wasningmn. seame,
an wall Drawing #sas June, 1999 Cour\esy p1 the anisl Jfrsem am clarne upnsen Pmcpgrapny
wayy rnlur nanas wiznin a qray, red. cpurlesy Marian Goodman Gallery, cplienrpn. gin at Jnseuh ana Llama
ye11aw,ana nlue naraer New Vnvk aaa Npncepnrerrrs rprrrr sa, 1999 Nlpnsen andthe Boeing Company
cplar inn wash Palnsea vrnerqlass
rirsz prawn py_»<rrs1in sales, saanrnp an wan urarrrrng 4909 24 va 1 zz 11 10 in. aan-4 Pnprpqrins 1918
cna, slennanre Sack, Greg wrlnarns lrreqular panas lrprn rne upper corners <sz.2 ar 55,9 1 25.4 cm) culpr pnmaqrapns mounted an paper
nprn, 1995 ana lne senier cpurresv ov me arlisl imecnanieals preparea lor reprpaue
cpllerlipn al lne cplny cpllepe wal/ Drawing new lion)
Museum p1Arz.wa1eryr1le,~1arne, irregular ares Irom lne ranler and asa. Nmoenrnerrre rprrrr 41,1999 saen; 14 va rr 22 ’I41n.(362 yr sm my
om pi rne arnsr wizn assislanee lrpnr irregular nprrzanlal panes Palncea linerqlass Lewin cpllenipn
me Jere Aopen Acaursinuns funn Arryne narnl 20 va 11 sa 1r1oin_
rrrsl prawn ny- Nleplar Anqelpy, <52.1 11515 lr 25.4 rml urasa: Aurpoipgrapny 1950
ara Wal/D/awl/1g 11549 Jan Baue1.Dan1ca nauir, courlesv ol the artist 1a1aan»anr1-wnire pnansqranns rmuneea
lrreqular nlpns al color Peter Moor1s,Danlel senornlq on new mseenanieals preparea rar
ACM/IIC Dalhf May, 1999 aa; Non-Geometrir Form are. 1999 reproduction)
Firsr prawn ny: Lana Anranarn. Courtesy Galerie Meerz mnpur, Brussels Parnlea fiberglass 62 sneaes. eaens IZ lr 22 in.
sapnilrp Cno.Amal1e FIy11n,Tnry 24 x 33 l/1 r\31n.1s1 1 55.11 33 cm) (10.5 lr 553 ern)
Marsn, Keyrn osler Kinr Pmnrawsni Cnurlesy ul lne arnsl Lewin cplleenun
Firstln5\a|Ia\l1Jr1'T11r11lv college.
Ha1!|o1d,Cor1nec\1cu| ssr. Non-Geometric Farm 83,1999
June, 1995 Painted finerqlass
Ccurlesv of lne artist 21 r sa va lr 9 =/r in.
(63.6 X 160.7 X 24.8 Cm)
caurcesy ul the arnsx
1 Lrsr or vl.A1:lLLus1nA11nns
wee". Crown Paint, 1950 an Was/yB1us!1sIrakes, 1995 111. omzcrs 5 Pos1:5s aaa cpnee Tan/e. 1951
50511 of nineteen p11o1oe1ch111ps pr1r11ea Gouache 011 uauer wooa ahn r;|ass
on sor11erse1 Satm heavyweiohr paper eo Ve 1 55 ‘le 1h. 1153.1 1153.1 crr1J ns-ve Fo/arhp Screens, 1951 15 1 45 1 45 1r1
Each sheer; 11 111 111. 121.9 1 21,9 <111> Lew111 co||ee1ior1 color 1r111 wash 011 wood panel 14512 1121.92 1121.92 crr11
Pumisheo by crown P51111 Press. Each screeh: 12 1150 11'/1111 Ea111ph.ur1/111111ea
0a11|ar1a.ca11r. me /rregu/ar Form, 1995 1152.9 1 3511 3.2 crhv ranrrcazeo hy voshrzsupu Na1arr1a,
cr111echor1 of the me ms Museums of Gouache oh vaver Fanrrcaxeo hy; wa1arrahe 51111110 L111.. 5rpo1/111. New vor1
sah Francisco, Achenhach rpur1oa11o11 50 '/2 11421h 11531 1 3501 cm) 5roo1|yr1, New vor1 Punlrsheo my Mu/11p/es New vor1
for Graph1c Arts. crown 951111 Press Lew111 cpl/eccruh Pr11a1e eo11e¢11orr
Arcruva. pm of crowrr Pom( Press an Hrp/1 rap/e, 1992
me frreqular rprrvr, 1995 an 5111, 1959 wooo
aaa-sea. surrrrse 51111 sunser at 1>,a1ar11>. Gouache or1 paper |h11 oh wood 511131131r111295 133 133cr111
1950 50 '/1 1 93 111 1153.1 1 235.2 cr111 3 '/e 110 1 10 111. 15.9 1 25.4 1 25.4 cr111 Er1111pr1. 12
co|or phozuqraphs r11oor11e11 on paper Lew111 co1/ec1ror1 £11111or1; 5 0/us 2 arhsrs prools rahrrcacea hy Nrco 5c11uursr11a,5erqer1,
1r11echar11<a1s urenareo apr revro11ue11or11 Faor1ca1e11 by. wa1ar1aoe s1u01o 1111, 1he Nether/an11s,V0sh1!suqu Nakama,
reopusheo bv 5111o|1ar1r1 1wu11ip1es, mr /rrequ/af /'0rrr1. 1995 5rop1|vr1. New Vovk 5roo1|vr1, New vor1
New York Gouache oh hanarrraae paper Pumrshee oy 1he soc1e1e aes arms ou 1=uo1rshea by A115 usu hoos F/1h1er111ah
32 vases. 5 1 5 111,120.3 1 20.3 c1111 30 1 39 1/1 111 115 2 1101c111l 111usee.ceh1re Georges 1>o111p105u, Parrs
courxesv Mar1ar1 G55er11ar1 Gauery, Lewrn cel/echorr s11e.5o1Lew111aho sxeuheh
New Vnrk 3-re Lenny Doapy 501. 1999 seherrheven Tame, 1995
een squrgg/1 Brushslrakes, 1991 Pa1r11eo wpoo arm canper s1ee1 aho p1ass
aes. cube. 1955 Gouache oh paper 3 '/a1 1 1 1 rrr 159 111511.scrh> 25 1113 2/1 1 45 ’/1 111
511 11|ap1-aho-w11i1e phocooraphs 50 '/a 1 15 rrr, 1153.1 1193 crh/ 511111511-11 plus 3 ar11s1's 1>r5o1s 155 1 255.9 1114.4 c1111
zach photograph* 12 110111 130.5 1 Lew111c5|1ec11or1 rahr1ca1e11 by wa1arra1>e 51u111o 1111. 511111011 10
22 Ve 115 1/1 1r1. 1512 1 41.5 cm) (36 B X124 5 X124 5 Cm) 5111111 R11=1ev. N/ro 1a1ash1rr1a
Lewrh collectiph vrwa1e co1|ec115r1 Seviemhen 1995
Courtesy Pa¢ew1|oehs1e1r1, New York
valor rrrdrrdpd lirlow. ru pnrroprophr ...P rrorray Margo lrayirr Gallery Lo. Araprlos. pl. 5r. Bryan Davin: p1.1.s¢or.aarrl.a5~Pa¢=vrald¢aa»ra§ra.Nafliw»Il:Pl»s
rr/ Sul lfwrrr pl. 51. lzplorrl la. Marr. ar-rd Paul Karr. pl. 5;. lolrra D. ..o.arrraymaalodillivoll.1lrrir1.P|-»r|nu\l
Schiff; pl. 57. Sludio Hartland; pl. gs. carlay Cmrven Clrp¢k.pL1a|.£G.sdm1np£pl.10=ln\nA.R|ni:
Prorarpprrrr. rrprarpprrlr r- sara madlwrll. rorrrrary pl. 59. lplrrr D. s<larm pl. or. upraardo srmla; pl. 15. Pl17o.l||»fy5“|P=Pl»7rFldS=‘N'=Pl17=_
sara Praprrdp Mrmaarr. pf Mridorir /lrr. frprrraaparrr 1. oorarlr.y /lllrra Memorial An ll/lamrrraa, Oberlin College, o.ararl»rallll¢yclari»u1aa»,o»aar\»y
Pirrlrp /l.clr1rlr..fror..a,p.rro 3. l1rr lam... ohio. pl. oo. lzol~»¢rr E. Malo. arid Paul Kam pl. sa. N~Yprlr.plr.1n~11¢EImI’¢¢\Wlla\1Il\=r
Ben slaclrwrll, rmanrsy sara Frarrcirw Maa.¢aaair of Paa¢w’a|d¢n$u.!&vrYod:|»|.z7sMlma|I|-z7i¢
lrorrrpprocr 4. Prrrr P1rl1.1r1p.
Mpdrrar /ln. pl. 7.1. Ellrrr Papr wilrprr, oplanrry oorarr=ay<alrri¢l:aaarrr.<:aw=.0|Is||-=.n:i.||iur
Frpm. lip 5. Roper 61... <o..rl<~y Frarnllrl Gallery, Parrwaldrrprrlra, Nm York. pl. 71. photograph pL17moir1ardiPa»lmptm=ram\sy|vhW¢i»d
sa.. Prarrrpro. ng. 5. arrworlr o norrald lrrdd o Thr ll/laawirra of Modrrra Aa1,Nf~ York; pl. xp. Ga1l¢r5nN¢wYofk;pL1.|n.ldIGa=lr|sa|/Flu
more/Lroraasrll by v,\m;A, Now York. ng. o. arzwarrlr 1.P. l<olir.. pl. so. wallrr mrmll. pl. ur pliolograpli ' -plmli-mrmranaylrannuudn
Q laaper Inhns/l lccmed by\KGA. New York; fig. B: e aqgp The Malrrrurrr pf Modrrrr An. New Ypris PL ss. l.aada~ipbur¢.h=4'ilI'>\"l»GH-lw1P|-!x!HI4I
plrprdgraplr .Q llrmaarai pl cprrrrrrrpprory Arr, chicago. Gregory lkrrsprr. pl. gp. André Morairr. pl. 5.1. ltolxn |_aaifrarala.=PL1lra»aar\a=yc-|rai¢ra¢1ai+sr|-|e.
Eg 9- nur.. P151 wllsorr. rorarr<.y Parrwlldrrprrirr, E. Marr. and Paul Kan. pl. ps. Donald Yoarrag pL or lxarlia-r.pL1|;.mr||uyAaann|ivuu(Hni¢.
Na... lorlr. ng. ao. ooalrmy srrdrlarll Mrrxarrr. ubprarprip Polripranm luraapmi. pl. ma. Manira zara-irluplnlrl-mywu=Pl»=l'=vilHdl-s
rlrrrsrrrdarrr. fig ar. rporrory Plrlndrlplria Maa.r.aria of lxirlalrr, roaarrrsy offrnllrrlar Krarrruarririaliaaap Basel: oorarpafywerrascnmrriirllnvialnmal-ah;
olaio.pL»¢olar¢uylla»lriwa|aig.\\la¢&da=»
rm. Eg r1. cary M1rlror..rlr,¢dorr=.y l<rollrr-lvlrlllar
lylo.1...r.,urr1rlo,rlar N¢rli=rlarad.. lip. 13. srl.
pl, ro7. Frrqriirr Porodirrm. pl. ips. wplipaarp Gilnnell
pl. aop. oorirrrsy lolara wrlorr Gallery, New Yprlr. mrnqa-rl '
Pdllaurr, rprrrrrsy lllrl sprlararr. np. 14. Tor.-r Rayrirr. pl. rio. [leonardo laenola. pl. 1.9. lm. Blackwell; Mriua:|1L»¢ludrinl&pa:=|I-»€lh||
ap. rr Tom vor. fyrrdr. rorirmy luaoraa Hoffman pl. 11.1. Grprgo Colombo. pl. 119. Parr Munro. l1mm;vlm=muuy
<;allary.cl..r1go. ng. 17. l¢rry l.1°lrorrrp.l1a.,roa.rrr.y pl. 134. lldbprl la. Marr. and Parrl Kam pl. us: craamq Maana#Au.rla¢N¢|r¢l-rdgplaprcarysngns
l.\'rarrr1ry Mrnrlarrr of/\rr1¢rr<arr Arr, Nrw Yprlr. sg. ra. Clrrrruars. pl. ips. porirrrry mr Am Mrrmarris all sara pL,pa.M;r\naaaurnn5P|-:mrs-aappsipa
.; ape. Harry N Abrarrrr, Now Yprk. np. la. D1./id Francisco; pl. ug. saril Willixmsa pl. 145. ooaanoq Tar¢ pL,aa.r1oaaraa.ayl\or<;a|=y,rearliralr.P\»n-;~¢r
mald, plaorr>pr1plr o The soldmda. P. <;r.gg=ralarrrrr Gallrry, lroradpaa. pl. r4o. cplarnrsy Marc Blondeau sox, o1aanr=yvlr|arr,\r\0nr.r.\|i-npukpl.|»»=
Pp...id1r.raa.. Nrw York; np. 15. losleph smrfai. opaarmy Paris. pl. 147. Clyde l~lar¢. corrrury lpyrr ll sdvwarm lu»lo=rvoQaa|nrpLx»=S¢u=Whiz.lz\ql.i-rr
wad..~orrli rlrlrrorrrrrr, Hanford. lip 17. ro..rr¢.y Mel pl. i5o. Grprgip Colombo; pl. .51 sara slmrwdl. <all¢y,laaradoaa.pL;aa.r¢|G|uu.p\;»=llm
spclrrarr, lig.1s»rr>rarr¢.y /ldrrari Prpar. 55.19. chrsrrr pparnrsy sarr Francisco Mraxraara of Modrra. Arr; Pagrlmlal-a.ooarraaa.y ' larsl:
lxrurrrrrrrl, rpaarrrry Tlar Arr lrirrrrrirr or chicago. pl. re.. supliorr lar-ig. Plaproga-aplay pl. 163. ooaarrory Plsna-awoarn=yvu»a»oa1Lll¢nr-,Hui-rl;
lip. 1... Rnbzn E. Mm. and Paall Kar., cnunesy luhn Marc lllcrrdeau s./a., P1ri§. pl. 165. Dormlaod Firdlm plaagnlurnqrwiaa-».oa-ag '
wrlm crum, Nrw York. lip. 1r. courtesy Marrar. pl. iso. croffrry clrirrorru. pix .67-isp. oprarrory N¢arYm-lr;||I.;¢<m¢\aqn|u-nlulr.
goodrrrarr uallrry, Nm vorlr. sg 51.5.1.1 Mrsrraar. Galrrir Yvora larrrlorrr, Paris. pl. 170. saaaa Hardmn. .\r1am=ahm;plnw-;|ml=m»liUlflf:||l|¢!\nu
ng 54- rplrrrrry w1drwpr.lr mroorrlrrr, l-larrrord. pl. 171. Diem lmsmer; pls. 171-ip.. Sabine Alall1a-ar1d A_l-|dls;||l3m|:ld|||PlllI:|I.p|:(hnl§
lip. ,.. rrarirrrry sandy slrogopd. np. ,o. Geoffny Dorrasril dorrrrrsy w¢.rlali.¢la¢s laaaderrriramaaar liar PL3==E|i=rmwu9r»u|lCr|=|nrl-nhuxlll-na:
clrrr-rrp... rprrrrory P1ula Cooper Gallup Nw Yprk: Karrasr arrad Kulrarrprsclaidarr Maaarmr. pl. 15.1. David olaaarraayllarr1=1r»revlna<.a|r:ie.1-iaia|al-n4=
ng. 17. .olrrmy sarrdra Grrrrag oallrry. Nrw York. lip. larlliraglrarra. pl. rw. Erika lxaralroara ladr. pl. rp5. S\==»~Shs==PLnsP¢nvlsls-rlisrwlvur
ill- roaarrdry vida.. Dara Barak, Chicago; Hg, 39. rorlrrrsy
CRG Gallery, New York; Hg. yn' Zindman/Fremont.
courtesy Paula Cooper Gallcryn New Yorlp pl. .pr vlcllolm ' Dirélii
Ray Andrrws: pls, 1o.Hpr. |p5¢pl1 Suszfai; pl. 1ro. opaar\r=yMaru1c;aaaa|r-<;a|a:y.||¢v\ari=|L,a¢
rraormy lmorrald Prldrm.. npr /lr... Now York, lip. 4.. Groffrry Clem¢nls,pl\o!ogl1ph o .gps wlaiarrry Philipp=Dqr.h=¢.pL»p.'nnn»»a|.oa-aaqn-la
o.orro.y Adm.. Prprr, rig. 41. xarr Keller; np. oy Mrirraarrr of Arrarraoarr Arr. pl. 1a¢ oparnrsy lplari wflxr coaapaahpnewvollcvlsur-wrlulpdrruel
pprlrrny w1d.worrla /lrlrrrrrrrrr.. mrrrord. np. 44. Gallrry. Now vprlr. pl. 1.5. counesy David larry pl. pl.a4¢.aaaaru.ayll=r.rylla\¢al=p.urri~=aluyof
uarrd Marlrpw.. plaorppraplr 11 Pr=.rdrar znd Polldw. 1.9. D, lairar. D", oourmy Parrl1 copper Gallrrya New waalaiaa¢p»..s¢mr.Pl-an-n»=m-aqnulm
of H1ry1rd riollrgo. np.. W51. roaarrray Ronald York. pl. 11o. asm Plrprpgraplaia; pl.. 11141; wrllmr M\|saumofS|nFn:iax|Ik|5-lpzlkhythvug
rrldrrrorr ra... Ar... Now york, ng. 51. nr.. Blzckwcll. Wolff: pl. 119. slryr Whilz; pl.. 1.11-131. Plidap lso. Plswmruyumwuuakpunhh
r<>.rrrr1y Sari Frararpro Mamlrrrr pl Mpdrrrr Arr. fig, 54. pl, up. Marlodna. pl. 117. Michxel Traapra. pl. 154. pl.,rapurr1=ar¢;pL5s1.Elaa1ra¢wiarr».r»|r~p
lzrrlrard N|<o1,<our\r;y Srari Krlly <lall¢ry, Nrw York. l. campbrll, rrialrrrsy Cesar P¢llr ar /lroppialra. pl. 139. P1orwalda=a¢aaa,N¢wYml=Pl~vx1lraaan»a»r|.
np. 57. laroh larirrldordl. Hg 55- rolrrmy /logaa.r dprirmy lllrriraa Hoffrrrara G;Ilery, cllaupri. pl. 141. °wrv=YP~\dl<`»°P=G\|l=='7,Nav¥»\\=Plun-s1i=
s1r.drr rlrrlrry. criloprro. npr. 5941- larol1 lxrlrrldaardr. <r»rirr=ry l<.ara5rlr1llr lam., Swilurhnd; pl. 145. oourusy MmGra»iaa1o.Pl»nmrarupl\a|lmana|n
Milo.. Onnlsl; pl. ur rprrrmy lardiaaaapolir M.r§<raar1 of cnllgrplaonpauplulruiiardcand-m
Plorr. Phorppraph. by srara Moen... pl.. ra-a5, .7-rs, An. pl. 15.1. sarsararaa siragrr. pl. 151. cNMl-ls/Laraarrir p|s.s»U|-3lz:D.ll|llsDe=pl.)i=muqAnh
7-P27-. 7-4'Z5- 17’18r 34. 39. 0J’44r 47» 71777. lclrlulr lrrarz. pl. 151. salyalora Lroiln. pl. 151. srrsaar orraifrpd, D=ilml/l/DlG\lla-pneulbalr.
ll), IZB. ljl. I49, 155460, 198, lrlifloy. 53)-335, 345-351, loradpra. pl. 154. sdlyardn Larira-a. pl. 155. laaa lodlldu.
,l62-ln, 374, 379, llvawll Plimograph. by lara lzrryra pl. 156. Fred srrrrmra. pl. 157. dpairwsy Uma Galltry, Planpgaplarofirmrunipaaapwrpagrrelaair
p|§. 5, 19-Zn, 25, 26, 35, Rl, RS, 91, 98, lll. l2l, \2§, \27, \§0, New York; pl. zss. 5.0. srlaerraplz pl. 15p. Eaiorrrar
rla1. 11.4, 1.a, 1.5 Pl. a. n. larrrr. ur., pl. rr. c1r..rrarr..
DdP°dulu7H:lndrPqnn|dqr~»\rlwvI=n|=
lzryarilr. pl. 1o<>. Plapro Graplria corrram. pl. 161. Palrick
l13!8(ri¢|\x):Sr»u|1n|Si|r|u¢p;pp.\|*g7.q.=
pl ,rp Grpffrdy cldrmrrl.. pl 31. ory1,..rlrrr.,rorar\=.y Yoaarap. pl. 1o,. rpaarrosy Tlar United sun. Holocaust
P-aso<lrllaard'U“).su-ararasigrp
Paula cprappr Ga1lcry,Ncw York. pl. pr. rr».rrra.y Mrrrrorial Mrirrrrrrr Plroro Archives, waslaiaigorra, n.<;_;
P»m=l°Wmm\>=l>-emluqhlhmngr.
x -;¢l\vllsu3/\r~,7
4 II 3Sgg;r|oJ_
3'7°3HLO\'\¢e
3 ,_,. ., ,
37:
’fi?'f
411
,»,.
;:.
fine; 2
T`
1 -,
i '
.i ¢_; ,
:Sing ~
y.
~¢
,N
<?"'*'i
1
\_ 1
I1
\~
CONTRIBUTORS
4l
‘a
1
J' ?‘
< Y'
|%i¢R,
Q VP.
'Q
.I Y
i`
A \ W'l
Q, ,",\»
_,QQ
U.
`a.u(12
'f5‘v)*’}-*M
; £1-E
|» 1
~ ~a
_ _o-osass-o
‘fp
>fTFi.1: 'SE‘
'gf ' Q 780300 083583
‘Fl HA' 1 4
-1-¢f
UMg. k
O\‘
\ \~\ \