Академический Документы
Профессиональный Документы
Культура Документы
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Chlorocebus sabaeus Annotation
Release 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1058
/organism="Chlorocebus sabaeus"
/mol_type="mRNA"
/isolate="1994-021"
/db_xref="taxon:60711"
/chromosome="9"
/sex="male"
/dev_stage="adult"
/country="USA: NC, Wake Forest University"
/note="housed at the Wake Forest Primate Facility as part
of the Vervet Research Colony"
gene 1..1058
/gene="RBP4"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 3 mRNAs, 6 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 132 samples with support for all
annotated introns"
/db_xref="GeneID:103216280"
CDS 12..809
/gene="RBP4"
/codon_start=1
/product="retinol-binding protein 4 isoform X1"
/protein_id="XP_007961780.1"
/db_xref="GI:635055166"
/db_xref="GeneID:103216280"
/translation="MQVPPAPPLRSFTPRGYESATPSPRRYKAAGRPRRARLPSSTRA
RTRRPGLRAVPLPVGGFLGKMKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARF
SGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFT
DTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFV
FSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL"
STS 273..505
/gene="RBP4"
/standard_name="MARC_24240-24241:1032810986:5"
/db_xref="UniSTS:268863"
STS 282..592
/gene="RBP4"
/standard_name="RBP4"
/db_xref="UniSTS:253880"
STS 565..746
/gene="RBP4"
/standard_name="RBP4"
/db_xref="UniSTS:254003"
STS 856..1036
/gene="RBP4"
/standard_name="SHGC-170"
/db_xref="UniSTS:16275"
STS 909..1024
/gene="RBP4"
/standard_name="D10S2145"
/db_xref="UniSTS:66626"
ORIGIN
1 cagggcgcgt tatgcaagtg cccccggcgc ctccccttcg gtctttcacc ccgcgcggtt
61 acgaaagcgc gaccccctcc ccccggcgct ataaagcagc ggggcggccg cggcgcgctc
121 gcctccctag ctccacgcgc gcccggacgc ggcggccagg cttgcgcgcg gttcccctcc
181 cggtgggcgg attcctgggc aagatgaagt gggtgtgggc gctcttgctg ctggcggcgc
241 tgggcagtgg ccgggcggag cgcgactgcc gagtgagcag cttccgagtc aaggagaact
301 tcgacaaggc tcgcttctcc gggacctggt acgccatggc caagaaggac cccgagggcc
361 tctttctgca ggacaacatc gtcgcggagt tctccgtgga cgagaccggc cagatgagcg
421 ccacggccaa gggccgagtc cgtcttttga ataactggga cgtgtgcgca gacatggtgg
481 gcaccttcac agacaccgag gaccctgcca agttcaagat gaagtactgg ggcgtagcct
541 cctttctcca gaaaggaaat gatgaccact ggatcatcga cacggactac gacacgtatg
601 ccgtgcagta ctcctgccgc ctcctgaacc tcgatggcac ctgtgctgac agctactcct
661 tcgtgttttc ccgggacccc aacggcctgc ccccagaagc gcaaaagatt gtaaggcagc
721 ggcaggagga gctgtgcctg gccaggcagt acaggctgat cgtccacaac ggttactgtg
781 atggcagatc agaaagaaac cttttgtagc aagatcaata atctagtttc atctgagaac
841 ttctgattat ttctcagtct tcaactctat ttatcttagg agtttaattt gcccttctct
901 ccccatcttc cctcatttcc cataaaacct tcattacaca taaggataca cgtgggggtc
961 agtgaatctg cttgcaggta aatgtctttc ctgaaagttt ctgaggctta agattccaga
1021 ctctgattca ttaaaatata gtcacccgtg tcctgtga
//