Вы находитесь на странице: 1из 142

Notices

6126 -- 6278/19

ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 49
05 December 2019
(Published on the ADMIRALTY website 25 November 2019)

CONTENTS

I Explanatory Notes. Publications List


II ADMIRALTY Notices to Mariners. Updates to Standard Nautical Charts
III Reprints of NAVAREA I Navigational Warnings
IV Updates to ADMIRALTY Sailing Directions
V Updates to ADMIRALTY List of Lights and Fog Signals
VI Updates to ADMIRALTY List of Radio Signals
VII Updates to Miscellaneous ADMIRALTY Nautical Publications
VIII Updates to ADMIRALTY Digital Services

For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: admiralty.co.uk/msi
Searchable Notices to Mariners: Web: www.ukho.gov.uk/nmwebsearch
Urgent navigational information: e--mail: navwarnings@ukho.gov.uk
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@ukho.gov.uk
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@ukho.gov.uk
Phone: +44(0)1823 484444 (24/7)
 Crown Copyright 2019. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
intellectual.property@ukho.gov.uk

For UKHO use only 219449


I

GUIDANCE NOTES FOR THE USE OF ADMIRALTY NOTICES TO MARINERS


ON THE UKHO WEBSITE

The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
admiralty.co.uk/msi or the searchable NM Website www.ukho.gov.uk/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.

NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.

Software required:

Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website (www.adobe.com).

SEARCHABLE NOTICES TO MARINERS

Enter the www.ukho.gov.uk/nmwebsearch website and select the search option that you require
following the on screen instructions:

ƒ Search NMs by - Chart Number only


ƒ Search NMs by - Chart Number + Previous NM Number/Year
ƒ Search NMs by - Chart Number + Between Previous and Present Dates
ƒ Search for Single NM by NM Number/Year

To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.

NOTICES TO MARINERS ON-LINE

Enter the admiralty.co.uk/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List

FURTHER GUIDANCE NOTES

For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
ƒ File content and description
ƒ PC and printer specifications

CUSTOMER SERVICE

If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:

Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@ukho.gov.uk

Our Singapore team can also be contacted outside of UK hours on:


Tel: +65 6424 4200

Wk49/19 1.2
,

ADMIRALTY NOTICES TO MARINERS


7KLV $'0,5$/7< 1RWLFHV WR 0DULQHUV %XOOHWLQ $10%  LV SXEOLVKHG E\ WKH 8.
+\GURJUDSKLF2IILFH 8.+2 7KH8.0DULWLPHDQG&RDVWJXDUG$JHQF\DFFHSWVWKDWERWK
WKH SDSHU DQG GLJLWDO IRUPV RI WKH $10% FRPSO\ ZLWK FDUULDJH UHTXLUHPHQW IRU 1RWLFHV WR
0DULQHUV ZLWKLQ 5HJXODWLRQ  RI WKH UHYLVHG &KDSWHU 9 RI WKH 6DIHW\ RI /LIH DW 6HD
&RQYHQWLRQ DQG WKH 0HUFKDQW 6KLSSLQJ 6DIHW\ RI 1DYLJDWLRQ  5HJXODWLRQV ERWK RI ZKLFK
FDPHLQWRIRUFH-XO\

:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN 13 
IRUIXUWKHUGHWDLOV

7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV

Planning for the future


Plan with ADMIRALTY Maritime Data Solutions, brought to you by the United Kingdom Hydrographic Office.

Admiralty Way, Taunton, Somerset


TA1 2DN, United Kingdom
Telephone +44 (0)1823 484444
customerservices@ukho.gov.uk
gov.uk/ukho

Find out more about our market-leading


ADMIRALTY Maritime Data Solutions:
admiralty.co.uk

and are trademarks of the Secretary of State for Defence

© Crown Copyright 2019. All rights reserved. Correct at the time of publishing.

 Wk49/19
,

EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.

Wk49/19 
,

6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJ LQ6HFWLRQ9, WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13   $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13   $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13   $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN 13 JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13  $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
a WKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
b WKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQ VXFKDVDQHZK\GURJUDSKLFVXUYH\ LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN 13 7KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO $'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1& YHUVLRQVRIFKDUWV

 Wk49/19

I
[49/19]
ADMIRALTY Charts affected by the Publication List

ADMIRALTY Charts International Charts

348 INT 1252


499 INT 1474
1205 INT 1736
1516 INT 1833
1528
1568 ADMIRALTY Publications
1698
1827 NP 38
1872 e-NP 38
1874 NP 42B
1940 e-NP 42B
3428 NP 81
3820 NP 88
5524
5527

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/19 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 05 December 2019

Chart Title, limits and other remarks Scale Folio 2019 Catalogue
page

348 China - South Coast, Chiwan Gangqu to Dachanwan Gangqu. 1:15,000 47 78

Includes significant safety-related information as follows: changes to


depths, buoyage and coastline.

Note: On publication of this New Edition former Notice 5287(P)/19 is


cancelled. This chart is to be deleted from the list of charts affected by Notice
5598(P)/19.

499 West Indies, Harbours in Saint Lucia. 87 124


A Port Castries. 1:5,000
B Vieux Fort. 1:20,000
C Grand Cul de Sac Bay. 1:10,000
D Marigot Harbour. 1:5,000

Includes changes to depths from the latest British Government surveys.

Note: This chart is to be deleted from the list of charts affected by Notice
2701(P)/19.

1205 Italy – Sardegna, Oristano and Approaches. 1:40,000 25 42


Oristano. 1:20,000

Includes significant safety-related information as follows: new light sectors


and obstruction area and amendments to buoyage, beacons and marine
farms.

Note: On publication of this New Edition former Notice 5573(P)/19 is


cancelled.

1516 United States - East Coast, Massachusetts, Boston Harbor. 1:25,000 81 130, 132

Includes significant safety-related information as follows: a new submarine


cable and changes to channel limits, project depths and legends.

Note: This chart is to be deleted from the list of charts affected by Notice
6022(P)/19.

1528 United States - East Coast, Massachusetts, Boston Inner Harbor. 1:10,000 81 130
Continuation of Boston Inner Harbor. 1:10,000

Includes significant safety-related information as follows: a new submarine


cable and changes to channel limits, project depths and legends.

Note: This chart is to be deleted from the list of charts affected by Notice
6022(P)/19.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.7 Wk49/19
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

New Editions of ADMIRALTY Charts published 05 December 2019 (continued)

Chart Title, limits and other remarks Scale Folio 2019 Catalogue
page

1568 China - South China Sea, Approaches to Zhuhai Gang and Taishan Coal 1:75,000 47 76, 78
Pier.

Includes general updating throughout.

Note: On publication of this New Edition former Notice 3959(T)/18 is


cancelled. This chart is to be deleted from the list of charts affected by Notice
5820(P)/17.

1940 Mexico - Pacific Ocean Coast, Salina Cruz and Approaches. 89 122
A Salina Cruz . 1:12,500
B Inner Approaches to Salina Cruz. 1:20,000
C Outer Approaches to Salina Cruz. 1:80,000

Includes significant safety-related information as follows: changes to


coastline, depths, lights, buoyage and prohibited area.

Note: On publication of this New Edition former Notice 5547(P)/19 is


cancelled.

3820 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to Inkoo. 1:50,000 11 36
INT 1252 Port of Inkoo. 1:25,000

Includes significant safety-related information as follows: a new submarine


pipeline.

Note: On publication of this New Edition former Notice 2033(P)/18 is


cancelled. This chart remains affected by Notice 5453(P)/18.

ADMIRALTY Publications

NP No. Title and other remarks Date Remarks

NP38 & ADMIRALTY Sailing Directions West Coast of India Pilot 05/12/2019 Updated to Week 31/19 (01/08/19)
e-NP38 Nineteenth Edition 2019. First updates in NM week 49/19. This
edition supersedes NP38 (Eighteenth
ISBN No: 978-0-70-774-5558 Edition 2016) which is cancelled.

NP42B & ADMIRALTY Sailing Directions Japan Pilot Volume 3 Twelfth 05/12/2019 Updated to Week 32/19 (08/08/19)
e-NP42B Edition 2019. First updates in NM week 49/19. This
edition supersedes NP42B (Eleventh
ISBN No: 978-0-70-774-5565 Edition 2016) which is cancelled.

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/19 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE

NEW EDITIONS OF ADMIRALTY CHARTS AND PUBLICATIONS

ADMIRALTY Publications (continued)

NP No. Title and other remarks Date Remarks

NP81 ADMIRALTY List of Lights and Fog Signals Volume H 2019/20 05/12/19 Updated to Week 43/19 (24/10/19).
Northern and Eastern Coasts of Canada Including River Saint First updates in week 49/19. Volume H
Lawrence and Saint Lawrence Seaway. 2018/19 is cancelled.

ISBN Number: 978-0-70-772-4058

NP88 ADMIRALTY List of Lights and Fog Signals Volume Q 2020/21 05/12/19 Updated to NM Week 42/19 (17/10/19).
Eastern Indian Ocean, South of the Equator Including Java, Banda First Amendments in NM Week 49/19.
and Timor Seas This Edition supersedes NP88 2019/20
Edition which is cancelled.
ISBN Number: 978-0-70-772-4119

ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 19 DECEMBER 2019

New Editions of ADMIRALTY Charts


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

1698 International Chart Series, England - South Coast, Dover. 1:6,250 1698 1
INT 1736 INT 1736
To include depths from the latest Dover Harbour Authority
surveys and developments to the Western Docks.

1827 Harbours on the South East Coast of England. 1827 1


A Approaches to Ramsgate. 1:12,500
B Pegwell Bay and the River Stour. 1:12,500
C Ramsgate. 1:5,000
D Broadstairs. 1:5,000
E Margate. 1:7,500

Includes significant safety-related information as follows: changes


to depths and the port entrance channel.

1872 North Sea, Dunkerque to Vlissingen. 1:100,000 1872 9


Blankenberge. 1:15,000

Includes significant safety-related information as follows: new


submarine cables. (A modified reproduction of Chart D11
published by Belgium).

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.9 Wk49/19
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED

ADMIRALTY CHARTS TO BE PUBLISHED 19 DECEMBER 2019

New Editions of ADMIRALTY Charts (continued)


Charts to be
Chart Title, limits and other remarks Scale WITHDRAWN Folio

1874 International Chart Series, North Sea, Westerschelde, Oostende to 1:60,000 1874 9
INT 1474 Westkapelle. INT 1474
A Zeebrugge. 1:20,000
B Brugge. 1:15,000

Includes significant safety-related information as follows: new


submarine cables. (A modified reproduction of INT1474 published
by Belgium).

3428 International Chart Series, France - West Coast, Brest. 1:7,500 3428 16
INT 1833 INT 1833
Includes changes to depths, buoyage, wrecks and submarine
cables. (A modified reproduction of INT1833 published by
France.)

5524 Mariners' Routeing Guide, Singapore Strait, Western Part. - 5524 45

Includes changes to anchorages, channels, pilots, radio reporting


points, coastline, depths and reclaimed areas.

5527 Mariners' Routeing Guide, Singapore Strait, Eastern Part. - 5527 45

Includes changes to anchorages, channels, pilots, radio reporting


points, coastline, depths and reclaimed areas.

ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

348 China - South Coast, Chiwan Gangqu to Dachanwan Gangqu. 348

499 West Indies, Windward Islands, Harbours in Saint Lucia. 499

1205 Italy – Sardegna, Oristano and Approaches. 1205

1516 United States - East Coast, Massachusetts, Boston Harbor. 1516

1528 United States - East Coast, Massachusetts, Boston Inner Harbor. 1528

1568 China - South China Sea, Approaches to Zhuhai Gang and Taishan Coal Pier. 1568

 denotes chart available in the ADMIRALTY Raster Chart Service series.

Wk49/19 1.10
I
ADMIRALTY CHARTS AND PUBLICATIONS PERMANENTLY WITHDRAWN

ADMIRALTY Charts (continued)

Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition

1940 Mexico - Pacific Ocean Coast, Salina Cruz and Approaches . 1940

3820 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to Inkoo. 3820
INT 1252 INT 1252

 denotes chart available in the ADMIRALTY Raster Chart Service series.

1.11 Wk49/19
II

GEOGRAPHICAL INDEX

(1) Miscellaneous . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7


(2) British Isles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.7 – 2.10
(3) North Russia, Norway, The Færoe Islands and Iceland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.10 – 2.11
(4) Baltic Sea and Approaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.11 – 2.13
(5) North Sea and North and West Coasts of Denmark, Germany, Netherlands and Belgium . . . . . . . . 2.13 – 2.15
(6) France and Spain, North and West Coasts, and Portugal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.16 – 2.17
(7) North Atlantic Ocean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(8) Mediterranean and Black Seas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.18 – 2.20
(9) Africa, West Coast and South Atlantic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21
(10) Africa, South and East Coasts, and Madagascar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(11) Red Sea, Arabia, Iraq and Iran. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.21 – 2.23
(12) Indian Ocean, Pakistan, India, Sri Lanka, Bangladesh and Burma . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.23 – 2.24
(13) Malacca Strait, Singapore Strait and Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.24
(14) China Sea with its West Shore and China . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.25 – 2.31
(15) Japan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.31 – 2.34
(16) Korea and the Pacific Coasts of Russia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.34 – 2.37
(17) Philippine Islands, Borneo and Indonesia except Sumatera . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.37 – 2.40
(18) Australia and Papua New Guinea . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41
(19) New Zealand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(20) Pacific Ocean . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41
(21) Aleutian Islands, Alaska and West Coast of North America including Mexico . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(22) West Coasts of Central and South America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
(23) Antarctica. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.41
(24) East Coast of South America and The Falkland Islands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.42
(25) Caribbean Sea, West Indies and the Gulf of Mexico. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.43 – 2.44
(26) East Coast of North America and Greenland . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.44
(27) T & P Notices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.45 – 2.69

2.1
Wk49/19
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
6126(P)/19 2.66 65 6183 2.13 9
6127 2.41 66, 67 6184* 2.8 3
6128 2.31 53 6185(P)/19 2.66 88
6129 2.32 54 6186(T)/19 2.45 6
6130 2.32 54 6187 2.16 17
6131 2.33 53 6188(T)/19 2.65 46, 60
6132 2.33 53 6189 2.38 59
6133 2.33 53 6190* 2.9 7
6134 2.33 53 6191 2.24 41
6135 2.34 53 6192* 2.9 8
6136(T)/19 2.60 55 6193 2.39 59, 60
6137(T)/19 2.61 53 6194 2.39 48
6138(T)/19 2.61 53 6195 2.16 18
6139(P)/19 2.61 53 6196 2.13 9
6140(P)/19 2.62 53 6197 2.18 24
6141(T)/19 2.62 53 6198 2.16 18
6142(T)/19 2.62 53 6199 2.35 52
6143(T)/19 2.63 54 6200(P)/19 2.63 56
6144* 2.7 6 6201 2.42 87, 95
6145 2.25 52 6202* 2.9 7
6146 2.24 45 6203 2.40 46, 60
6147* 2.8 5 6204 2.27 50
6148 2.26 52 6205 2.18 25
6149(P)/19 2.53 52 6206* 2.43 86
6150 2.41 96, 97 6207* 2.41 70
6151 2.7 98 6208(P)/19 2.54 47
6152(P)/19 2.66 66 6209(P)/19 2.67 83
6153* 2.8 3 6210(T)/19 2.47 7, 9
6154 2.37 48 6211 2.17 16
6155 2.34 52 6212 2.19 30
6156(P)/19 2.48 16 6213(P)/19 2.49 30
6157(T)/19 2.53 52 6214(T)/19 2.48 9
6158 2.34 52 6215(P)/19 2.55 50
6159 2.10 13 6216* 2.9 3
6160 2.34 92 6217 2.11 11
6161(P)/19 2.51 36 6218 2.27 47
6162(T)/19 2.52 40 6219 2.11 15
6163 2.11 14 6220(P)/19 2.46 15
6164 2.34 52 6221* 2.43 86
6165 2.26 47 6222 2.35 52
6166 2.26 47 6223(T)/19 2.55 47
6167 2.37 46, 60 6224 2.13 7
6168 2.44 81 6225 2.19 25
6169 2.38 48 6226 2.36 56
6170 2.23 41 6227* 2.10 1
6171 2.35 56 6228 2.7 9
6172* 2.21 40 6229 2.14 6, 7, 13, 19
6173(T)/19 2.65 48 6230 2.28 50
6174 2.38 58 6231(P)/19 2.68 86
6175(P)/19 2.45 7 6232(P)/19 2.63 52
6176 2.35 56 6233(P)/19 2.56 50
6177(P)/19 2.69 81 6234 2.43 19, 83, 86
6178 2.13 9 6235(P)/19 2.64 52
6179(P)/19 2.51 20 6236 2.28 47
6180(P)/19 2.54 47 6237(P)/19 2.56 50
6181* 2.18 30 6238 2.42 95
6182(P)/19 2.52 40 6239 2.23 40

2.2
Wk49/19
II

INDEX OF NOTICES AND CHART FOLIOS

Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
6240(P)/19 2.58 50
6241 2.28 50, 53
6242 2.29 48, 50
6243 2.23 40
6244(P)/19 2.64 52
6245 2.36 52
6246 2.19 31
6247 2.30 48, 50
6248 2.12 10
6249(P)/19 2.65 52
6250 2.36 56
6251 2.36 52
6252(P)/19 2.59 50
6253 2.42 95
6254* 2.10 5
6255 2.30 47
6256 2.36 52
6257(T)/19 2.60 50
6258 2.30 47
6259 2.30 52
6260 2.14 7, 9
6261 2.31 50
6262 2.19 25
6263(P)/19 2.50 25
6264 2.13 10
6265 2.20 25
6266 2.40 59
6267 2.44 86
6268 2.31 47
6269(P)/19 2.60 50
6270 2.37 52
6271(P)/19 2.45 1
6272 2.20 25
6273 2.31 50
6274* 2.10 6, 15
6275 2.20 29
6276 2.21 20
6277* 2.15 6, 13
6278 2.42 96

2.3
Wk49/19
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2 6229, 6274 1504 6260


54 6208P 1505 6157T
104 6190 1506 6157T
107 6175P, 6190 1603 6273
110 6214T 1630 6260
115 6144 1631 6210T
116 6214T 1632 6210T
120 6214T 1633 6210T
219 6274 1661 6179P
245 6274 1690 6179P
266 6224 1699 6179P
295 6277 1716 6230
468 6206 1721 6261
487 6267 1728 6268
497 6275 1737 6233P
520 6201 1754 6241, 6261
599 6238 1757 6147
611 6276 1759 6261
612 6276 1760 6230, 6247
663 6161P 1761 6204, 6230
707 6191 1775 6150
747 6207 1794 6147
748 6207 1844 6173T
775 6181 1852 6266
806 6149P 1872 6214T
838 6197 1874 6214T
871 6227 1902 6227
882 6226, 6250 1968 6247
896 6158 1975 6202
898 6232P 1990 6225
913 6245, 6251 2010 6184
918 6203 2011 6216
1008 6244P 2052 6202
1036 6255 2100 6194
1066 6188T 2101 6212
1147 6276 2106 6248
1183 6202 2108 6248
1186 6192 2109 6169
1190 6175P 2111 6169
1201 6149P 2134 6173T
1221 6259 2182A 6210T
1231 6160 2182B 6210T
1252 6145 2182C 6144, 6229
1253 6148 2182D 6229
1258 6199, 6251 2199 6153
1261 6165 2217 6246
1270 6249P 2271 6163
1286 6145 2376 6237P
1287 6145 2388 6254
1306 6257T 2409 6242
1312 6188T 2412 6241
1320 6184 2470 6188T
1338 6169 2488 6177P
1400 6185P 2523 6162T
1406 6260 2583 6264
1408 6260 2591 6248
1409 6144 2592 6248
1413 6216 2603 6168
1424 6265 2616 6217
1425 6272 2625 6271P
1427 6229, 6277 2628 6271P
1428 6159, 6277 2629 6271P
1429 6159 2631 6271P
1441 6231P 2632 6212
1450 6231P 2635 6147
1460 6205 2639 6189
1462 6186T 2664 6187
1501 6149P 2692 6202
1503 6175P 2794 6193

2.4
Wk49/19
II

INDEX OF CHARTS AFFECTED

Admiralty Chart No. Notices


Notices Admiralty
Admiralty Chart
Chart No.
No. Notices

2795 6193 3988 6218


2797 6167 3989 6223T, 6258
2832 6262 4012 6234
2837 6172 4014 6229
2862 6167 4101 6229
2872 6188T 4124 6269P
2887 6172 4140 6229
2888 6172 4213 6150
2889 6172 4216 6201
2905 6147 4400 6234
2976 6195 4401 6234
3001 6206 4410 6242
3015 6193 4620 6127
3029 6193 4621 6127
3034 6263P 8011 6214T
3035 6263P 8012 6214T
3041 6176 8053 6237P
3044 6171 8054 6182P
3057 6187 8063 6200P
3068 6187 8114 6180P
3069 6187 8119 6213P
3090 6151 8124 6215P
3092 6151 8125 6240P
3164 6184 8126 6252P
3176 6172 8152 6157T
3190 6209P 8167 6149P
3200 6150 8168 6149P
3230 6237P 8236 6209P
3232 6242
3324 6278 Australian
3329 6278 Notices
3365 6155, 6245, 6256 Chart No.
3391 6164, 6222, 6270
3412 6172 Aus 130 6126P
3427 6211 Aus 137 6126P
3428 6156P Aus 138 6126P
3429 6211 Aus 262 6152P
3480 6256 Aus 263 6152P
3482 6165, 6218 Aus 513 6127
3483 6169 Aus 519 6127
3488 6165, 6218 Aus 781 6126P
3489 6247
3518 6243 German
3523 6239 Notices
Chart No.
3569 6219, 6220P
3658 6204 DE 2 6183
3666 6158 DE 20 6183
3729 6167, 6203 DE 44 6228
3730 6167, 6203 DE 46 6196
3739 6172 DE 50 6178, 6210T
3747 6174 DE 87 6210T, 6228
3757 6188T DE 103 6228
3758 6188T
3764 6198
3837 6154 Indian
Notices
3862 6217 Chart No.
3883 6166, 6218, 6236
3901 6146 IN 206 6191
3902 6146 IN 207 6191
3907 6206 IN 211 6170
3908 6221 IN 253 6191
3928 6235P IN 254 6191
3940 6146 IN 255 6170
3945 6146 IN 292 6191
3962 6201 IN 2016 6170
3972 6238
3978 6253
3986 6165
3987 6165, 6218

2.5
Wk49/19
II

INDEX OF CHARTS AFFECTED

Japanese
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
JP 31 6136T INT 1452 6228
JP 66 6139P, 6140P INT 1453 6196
JP 67 6137T, 6138T INT 1456 6183
JP 77 6142T INT 1473 6214T
JP 90 6140P INT 1474 6214T
JP 123 6129 INT 1477 6214T
JP 135 6143T INT 1479 6214T
JP 179 6128, 6132, 6133 INT 1503 6144
JP 187 6133, 6135 INT 1504 6144
JP 198 6134 INT 1508 6175P
JP 201 6128 INT 1509 6175P
JP 213 6134, 6135 INT 1510 6260
JP 1056 6141T INT 1560 6202
JP 1061 6137T, 6139P, 6140P INT 1561 6202
JP 1062 6137T, 6139P, 6140P INT 1566 6190
JP 1085 6139P INT 1625 6147
JP 1107 6129, 6130 INT 1630 6147
JP 1228 6131, 6132, 6133 INT 1640 6184
JP 1262 6143T INT 1732 6271P
JP 1263 6143T INT 1804 6187
JP 5510 6139P INT 1832 6211
INT 1833 6156P
INT 1845 6187
Papua New Guinea INT 1846 6187
Notices
Chart No. INT 1847 6187
INT 1951 6179P
PNG 508 6127 INT 3657 6212
INT 4160 6206
International INT 4162 6221
Notices INT 5251 6158
Chart No.
INT 5252 6155, 6245, 6256
INT 12 6234 INT 5254 6245, 6251
INT 14 6229 INT 5355 6158
INT 101 6229 INT 5360 6164, 6222, 6270
INT 140 6229 INT 5363 6249P
INT 160 6229, 6274 INT 5709 6154
INT 400 6234 INT 7017 6172
INT 401 6234 INT 7021 6191
INT 407 6201 INT 7199 6172
INT 550 6165, 6218 INT 7211 6172
INT 551 6169 INT 7216 6172
INT 552 6165, 6218 INT 7219 6172
INT 553 6247 INT 7220 6172
INT 620 6127 INT 7232 6172
INT 621 6127 INT 7250 6162T
INT 1040 6229 INT 7328 6191
INT 1041 6144, 6229 INT 7331 6191
INT 1042 6210T INT 7334 6170
INT 1043 6210T INT 7336 6170
INT 1045 6178, 6210T INT 7698 6161P
INT 1060 6274 INT 11431 6217
INT 1061 6147
INT 1085 6276
INT 1143 6217
INT 1302 6248
INT 1303 6248
INT 1375 6248
INT 1377 6248
INT 1401 6229, 6277
INT 1402 6159, 6277
INT 1403 6159
INT 1412 6228
INT 1413 6210T, 6228
INT 1416 6260
INT 1417 6210T
INT 1418 6210T
INT 1420 6210T
INT 1424 6183

2.6
Wk49/19
II
6151 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

3090 4401/19 Effective from 28/11/19


Amend reference in N border at longitude 76° 30´·0W. to read, Adjoining Chart 3086.

3092 2411/19 Effective from 28/11/19


Amend reference in S border at longitude 79° 40´·0W. to read, Adjoining Chart 3087.

6228 MISCELLANEOUS UPDATES TO CHARTS

Source: UKHO

Chart Previous Update Details

DE 44 5920/19 Amend reference in W border at latitude 53° 59´·0N. to read, Adjoining Chart DE2
INT 1452 Delete reference, Adjoining chart 3617, in S border at 8° 28´·15E.

DE 87 5936/19 Insert magenta limit and chart number, DE2 (INT 1456), as follows:
INT 1413
North: 54° 05´·79N. East: 8° 20´·00E.
South: 53° 45´·55N. West: 7° 30´·00E.
Delete magenta limit and chart number, 3617 (INT 1456), in the following positions:
54° 00´·22N., 8° 29´·00E.
53° 40´·96N., 7° 42´·90E.

DE 103 5936/19 Insert magenta limit and chart number, DE2 (INT 1456), as follows:
INT 1412
North: 54° 05´·79N. East: 8° 20´·00E.
South: - West: 7° 30´·00E.
Delete magenta limit and chart number, 3617, in the following positions:
54° 00´·18N., 7° 41´·80E.
53° 45´·82N., 8° 30´·13E.

6144* SCOTLAND - East Coast - NM Blocks. Legend.


Source: Northern Lighthouse Board

Chart 115 (INT 1503) [ previous update 5763/19 ] ETRS89 DATUM


Insert the accompanying block, centred on: 58° 15´·6N., 2° 53´·6W.

Chart 1409 (INT 1504) [ previous update 5735/19 ] ETRS89 DATUM


Insert the accompanying block, centred on: 58° 11´·2N., 2° 57´·0W.

Chart 2182C (INT 1041) [ previous update 6026/19 ] WGS84 DATUM


Delete legend, Under Construction (see Note), centred on: 58° 17´·0N., 3° 02´·0W.

2.7
Wk49/19
II

6147* SCOTLAND - West Coast - Light.


Source: Northern Lighthouse Board

Chart 1757 (INT 1630) [ previous update 3952/19 ] ETRS89 DATUM


Amend range of light to, 18M 57° 51´·42N., 6° 38´·51W.

Chart 1794 (INT 1625) [ previous update 5959/19 ] ETRS89 DATUM


Amend range of light to, 18M 57° 51´·41N., 6° 38´·52W.

Chart 2635 (INT 1061) [ previous update 3852/19 ] ETRS89 DATUM


Amend range of light to, 18M 57° 51´·4N., 6° 38´·7W.

Chart 2905 [ previous update 3999/19 ] ETRS89 DATUM


Amend range of light to, 18M 57° 51´·410N., 6° 38´·515W.

6153* SCOTLAND - West Coast - Wrecks.


Source: ms Lode

Chart 2199 [ previous update 6015/19 ] ETRS89 DATUM


Insert
20),Wk (a) 55° 10´·04N., 5° 04´·07W.
Delete
20,ûWk PA, close NW of: (a) above

6184* ENGLAND - West Coast - Wrecks.


Source: ABP Barrow

Chart 1320 [ previous update 4588/19 ] ETRS89 DATUM


Replace
6$+ Wk with 5(+ Wk 53° 59´·93N., 3° 14´·23W.

Chart 2010 (INT 1640) [ previous update 4485/19 ] ETRS89 DATUM


Replace
6$+ Wk with 5(+ Wk 53° 59´·93N., 3° 14´·23W.

Chart 3164 [ previous update 5968/19 ] ETRS89 DATUM


Replace
6$+ Wk with 5(+ Wk 53° 59´·935N., 3° 14´·228W.

2.8
Wk49/19
II

6190* ENGLAND - East Coast - Depths.


Source: ABP Humber

Chart 104 (INT 1566) [ previous update 4740/19 ] ETRS89 DATUM


Insert depth, 82, and extend 10m contour SE to enclose 53° 33´·24N., 0° 11´·99E.
depth, 96, and extend 10m contour S to enclose (a) 53° 33´·14N., 0° 11´·64E.
Delete depth, 114, close W of: (a) above

Chart 107 [ previous update 5020/19 ] ETRS89 DATUM


Insert depth, 82, and extend 10m contour SE to enclose 53° 33´·24N., 0° 11´·99E.
depth, 96, and extend 10m contour S to enclose (a) 53° 33´·14N., 0° 11´·64E.
Delete depth, 114, close W of: (a) above

6192* ENGLAND - East Coast - Depths.


Source: Port of London Authority

Chart 1186 (Panel A, Canvey Island to Coalhouse Point) [ previous update 5068/19 ] ETRS89 DATUM
Insert depth, 109 (a) 51° 30´·357N., 0° 33´·105E.
Delete depth, 111, close W of: (a) above

6202* ENGLAND - East Coast - Depth.


Source: British Government Survey

Chart 1183 (INT 1561) [ previous update 6106/19 ] ETRS89 DATUM


Replace depth, 143, with depth, 142 51° 49´·20N., 1° 37´·05E.

Chart 1975 [ previous update 6106/19 ] ETRS89 DATUM


Replace depth, 143, with depth, 142 51° 49´·20N., 1° 37´·05E.

Chart 2052 (INT 1560) [ previous update 6106/19 ] ETRS89 DATUM


Replace depth, 143, with depth, 142 51° 49´·20N., 1° 37´·05E.

Chart 2692 [ previous update 6106/19 ] ETRS89 DATUM


Replace depth, 143, with depth, 142 51° 49´·20N., 1° 37´·05E.

6216* WALES - North Coast - NM Block. Note.


Source: Stena Ports Ltd

Chart 1413 [ previous update 5228/18 ] ETRS89 DATUM


Insert the accompanying block, centred on: 53° 18´·5N., 4° 36´·9W.

Chart 2011 [ previous update 2654/17 ] ETRS89 DATUM


Insert the accompanying block, centred on: 53° 18´·7N., 4° 37´·4W.
Replace the existing note, MAINTAINED DEPTHS, with the
accompanying note, DREDGED DEPTHS, centred on: 53° 18´·694N., 4° 39´·390W.

2.9
Wk49/19
II

6227* ENGLAND - South Coast - Wreck. Depths.


Source: MST (FHMU)

Chart 871 [ previous update 5837/19 ] ETRS89 DATUM


Insert depth, 1, and extend 2m contour W to enclose 50° 25´·452N., 4° 12´·118W.
depth, 11, and extend 2m contour W to enclose 50° 25´·397N., 4° 12´·125W.
depth, 17, and extend 2m contour W to enclose 50° 25´·338N., 4° 12´·142W.
depth, 1, and extend 2m contour W to enclose 50° 25´·266N., 4° 12´·154W.

Chart 1902 (Continuation to Ernesettle Pier) [ previous update 2780/16 ] ETRS89 DATUM
Insert
1+ Wk 50° 24´·424N., 4° 12´·124W.

6254* SCOTLAND - West Coast - Buoyage.


Source: Dunstaffnage Marina Ltd

Chart 2388 (Panel B, Dunstaffnage Bay to Connel Bridge) [ previous update 2448/19 ] ETRS89 DATUM
Move
B\Fl.R.3s,
d from:
56° 27´·180N., 5° 26´·078W.
to: 56° 27´·215N., 5° 26´·085W.

C]Fb l(2)G.6s, from: 56° 27´·166N., 5° 26´·113W.


to: 56° 27´·183N., 5° 26´·098W.

6274* SCOTLAND - Shetland Islands - Obstruction.


Source: UKHO

Chart 2 (INT 160) [ previous update 6229/19 ] WGS84 DATUM


Insert
120- Obstn Rep (2017) 59° 58´·0N., 5° 28´·4W.

Chart 219 (INT 1060) [ previous update 6013/19 ] ETRS89 DATUM


Insert
120- Obstn Rep (2017) 59° 58´·0N., 5° 28´·4W.

Chart 245 [ previous update 6013/19 ] WGS84 DATUM


Insert
120- Obstn Rep (2017) 59° 58´·0N., 5° 28´·4W.

6159 NORWAY - West Coast - NM Block.


Source: Norwegian Notice 20/60750/19

Chart 1428 (INT 1402) [ previous update 2463/19 ] WGS84 DATUM


Insert the accompanying block, centred on: 63° 17´·6N., 7° 33´·0E.

Chart 1429 (INT 1403) [ previous update 2463/19 ] WGS84 DATUM


Insert the accompanying block, centred on: 63° 17´·6N., 7° 33´·0E.

2.10
Wk49/19
II

6163 RUSSIA - White Sea Coast - Wreck.


Source: Russian Notice 45/5162/19

Chart 2271 [ previous update 4882/19 ] PULKOVO 1942 DATUM


Insert
20,û Wk 66° 27´·95N., 40° 48´·65E.

6219 FØROYAR - Buoyage.


Source: Danish Chart Correction 43/535/19

Chart 3569 (Panel A, Tórshavn (Thorshavn)) [ previous update 4313/19 ] WGS84 DATUM
Delete
D;Fl.Y.3s
f 62° 00´·330N., 6° 45´·270W.
62° 00´·110N., 6° 45´·410W.

Chart 3569 (Panel B, Nólsoyarfjørđur (Nolsø Fjord)) [ previous update 4313/19 ] WGS84 DATUM
Delete
D;Fl.Y.3s
f 62° 00´·33N., 6° 45´·27W.
62° 00´·11N., 6° 45´·41W.

6217 FINLAND - West Coast - Buoyage. Fairways. Depths.


Source: Finnish Notice 30/250/19
Note: Limit of restricted area, anchoring prohibited remains unchanged.

Chart 2616 (INT 11431) (Panel A, Kokkola) [ previous update 5550/19 ] WGS84 DATUM
Insert
I{’K\d 19’ (a) 63° 52´·54N., 23° 00´·36E.

I{Wf 63° 52´·28N., 22° 59´·87E.


limit of fairway, pecked line, joining: (a) above
(c) 63° 52´·00N., 23° 01´·06E.
Replace depth, 148, with I{b] 63° 52´·51N., 23° 00´·13E.
Delete former I{\ ’K 19’ (b) 63° 52´·28N., 23° 00´·57E.
depth, 125 63° 52´·27N., 23° 00´·67E.
depth, 127 63° 52´·17N., 23° 00´·82E.
former limit of fairway, pecked line, joining: (a) above
(b) above
(c) above

2.11
Wk49/19
II
6217 FINLAND - West Coast - Buoyage. Fairways. Depths. (continued)

Chart 3862 (INT 1143) [ previous update 5550/19 ] WGS84 DATUM


Insert
I{b] 63° 52´·51N., 23° 00´·13E.

I{fW 63° 52´·28N., 22° 59´·87E.


limit of fairway, pecked line, joining: (a) 63° 52´·54N., 23° 00´·36E.
(c) 63° 52´·00N., 23° 01´·06E.
Move
I{K\ 19, from: (b) 63° 52´·28N., 23° 00´·56E.
to: (a) above
Delete former limit of fairway, pecked line, joining: (a) above
(b) above
(c) above

6248 DENMARK - Islands - Submarine cable.


Source: Danish Chart Correction 43/536/19

Chart 2106 (INT 1303) [ previous update 5692/19 ] WGS84 DATUM


Insert submarine cable, É, joining: 55° 42´·09N., 10° 00´·32E.
55° 35´·79N., 10° 03´·17E.
55° 34´·51N., 10° 02´·81E.
55° 34´·03N., 10° 03´·26E.
55° 33´·66N., 10° 04´·05E.

Chart 2108 (INT 1302) [ previous update 4552/19 ] WGS84 DATUM


Insert submarine cable, É, joining: 55° 42´·09N., 10° 00´·32E.
55° 38´·00N., 10° 02´·17E.

Chart 2591 (INT 1377) [ previous update 4552/19 ] WGS84 DATUM


Insert submarine cable, É, joining: 55° 42´·09N., 10° 00´·32E.
55° 35´·79N., 10° 03´·17E.
55° 34´·51N., 10° 02´·81E.
55° 34´·03N., 10° 03´·26E.
55° 33´·66N., 10° 04´·05E.

Chart 2592 (INT 1375) [ previous update 4651/19 ] WGS84 DATUM


Insert submarine cable, É, joining: 55° 38´·00N., 10° 02´·17E.
55° 35´·79N., 10° 03´·17E.
55° 34´·51N., 10° 02´·81E.
55° 34´·03N., 10° 03´·26E.
55° 33´·66N., 10° 04´·05E.

2.12
Wk49/19
II

6264 DENMARK - Islands - NM Block. Buoyage.


Source: Danish Chart Corrections 43/541-542/19

Chart 2583 (Panel B, Bandholm) [ previous update New Edition 17/10/2019 ] WGS84 DATUM
Insert the accompanying block, centred on: 54° 50´·3N., 11° 29´·5E.

Chart 2583 [ previous update New Edition 17/10/2019 ] WGS84 DATUM


Insert
J\ 54° 52´·28N., 11° 28´·48E.

JU (a) 54° 51´·27N., 11° 30´·27E.


Delete
J\, close NE of: (a) above

J\, close SE of: (a) above

6178 NORTH SEA - German Sector - Fouls.


Source: German Notice 44/50/19

Chart DE 50 (INT 1045) [ previous update 5472/19 ] WGS84 DATUM


Insert
« 54° 32´·5N., 6° 13´·4E.
54° 25´·1N., 6° 16´·5E.

6183 GERMANY - North Sea Coast - Depths.


Source: German Notice 44/20/19

Chart DE 2 (INT 1456) [ previous update New Chart 14/11/2019 ] WGS84 DATUM
Replace depth, 172, with depth, 164 53° 47´·23N., 8° 01´·53E.

Chart DE 20 (INT 1424) [ previous update New Edition 14/11/2019 ] WGS84 DATUM
Replace depth, 172, with depth, 164 53° 47´·23N., 8° 01´·53E.

6196 GERMANY - North Sea Coast - NM Blocks.


Source: German Notice 44/46/19 and ENC DE5NOBRB

Chart DE 46 (INT 1453) (Panel, Brunsbüttel) [ previous update 5920/19 ] WGS84 DATUM
Insert the accompanying block A, centred on: 53° 53´·2N., 9° 13´·1E.

Chart DE 46 (INT 1453) [ previous update 5920/19 ] WGS84 DATUM


Insert the accompanying block B, centred on: 53° 53´·1N., 9° 13´·4E.

6224 NORTH SEA - Netherlands Sector - Wreck.


Source: Netherlands Notice 45/393/19

Chart 266 [ previous update 5255/19 ] WGS84 DATUM


Insert
39,Wk 54° 34´·17N., 3° 29´·65E.

2.13
Wk49/19
II

6229 NORTH SEA - Norwegian Sector - Platform. Restricted area.


Source: Norwegian Notice 20/60787/19

Chart 2 (INT 160) [ previous update 6026/19 ] WGS84 DATUM


Delete
¼{Huldra 60° 51´·0N., 2° 38´·9E.

Chart 1427 (INT 1401) [ previous update 5644/19 ] WGS84 DATUM


Delete
¼ Huldra Fl R, and associated circular limit of restricted area,
Ç, centred on: 60° 51´·3N., 2° 38´·9E.

Chart 2182C (INT 1041) [ previous update 6144/19 ] WGS84 DATUM


Delete
¼{Huldra Gas Field 60° 51´·3N., 2° 39´·2E.

Chart 2182D (INT 1040) [ previous update 5057/19 ] WGS84 DATUM


Delete
¼{Huldra Gas Field 60° 51´·4N., 2° 39´·0E.

Chart 4014 (INT 14) [ previous update 5351/18 ] WGS84 DATUM


Delete
¼{ 60° 51´·1N., 2° 39´·0E.

Chart 4101 (INT 101) [ previous update 5351/18 ] WGS84 DATUM


Delete
¼{ Huldra 60° 51´·3N., 2° 39´·2E.

Chart 4140 (INT 140) [ previous update 5076/19 ] WGS84 DATUM


Delete
¼{ Huldra 60° 51´·3N., 2° 39´·0E.

6260 NORTH SEA - Netherlands Sector - Fouls.


Source: Netherlands Notice 45/392/19

Chart 1406 [ previous update 5911/19 ] WGS84 DATUM


Insert
« 52° 06´·90N., 2° 44´·00E.
52° 07´·40N., 2° 46´·33E.
52° 07´·48N., 2° 49´·36E.
52° 05´·11N., 2° 47´·47E.
52° 04´·26N., 2° 44´·57E.

Chart 1408 [ previous update 5056/19 ] WGS84 DATUM


Insert
« 52° 06´·9N., 2° 44´·0E.
52° 07´·4N., 2° 46´·3E.
52° 07´·5N., 2° 49´·4E.
52° 05´·1N., 2° 47´·5E.
52° 04´·3N., 2° 44´·6E.

2.14
Wk49/19
II
6260 NORTH SEA - Netherlands Sector - Fouls. (continued)

Chart 1504 (INT 1510) [ previous update 4708/19 ] ETRS89 DATUM


Insert
« 52° 06´·90N., 2° 44´·00E.
52° 07´·40N., 2° 46´·33E.
52° 08´·03N., 2° 47´·94E.
52° 07´·48N., 2° 49´·36E.
52° 06´·97N., 2° 48´·37E.
52° 07´·03N., 2° 47´·29E.
52° 06´·10N., 2° 48´·77E.
52° 05´·11N., 2° 47´·47E.

Chart 1630 (INT 1416) [ previous update 5725/19 ] WGS84 DATUM


Insert
« 52° 06´·90N., 2° 44´·00E.
52° 07´·40N., 2° 46´·33E.
52° 08´·03N., 2° 47´·94E.
52° 07´·48N., 2° 49´·36E.
52° 06´·97N., 2° 48´·37E.
52° 07´·03N., 2° 47´·29E.
52° 06´·10N., 2° 48´·77E.
52° 05´·11N., 2° 47´·47E.
52° 04´·26N., 2° 44´·57E.

6277* NORTH SEA - United Kingdom Sector - Well.


Source: Shell UK

Chart 295 [ previous update 4385/19 ] WGS84 DATUM


Insert
188-Well 61° 40´·30N., 1° 29´·07E.

Chart 1427 (INT 1401) [ previous update 6229/19 ] WGS84 DATUM


Insert
188-Well 61° 40´·3N., 1° 29´·1E.

Chart 1428 (INT 1402) [ previous update 6159/19 ] WGS84 DATUM


Insert
188-Well 61° 40´·3N., 1° 29´·1E.

2.15
Wk49/19
II

6187 FRANCE - West Coast - Safe vertical clearance. Vertical clearances. Depths.
Source: French Notice 44/60/19

Chart 2664 (INT 1804) [ previous update 5818/19 ] WGS84 DATUM


Replace depth, 61, with depth, 5, enclosed by 5m contour 45° 38´·53N., 1° 15´·05W.

Chart 3057 (INT 1845) [ previous update 4308/19 ] WGS84 DATUM


Insert depth, 54 (a) 45° 25´·52N., 0° 52´·35W.
Delete depth, 75, close NE of: (a) above
Insert depth, 5, enclosed by 5m contour (b) 45° 38´·53N., 1° 15´·05W.
Delete depth, 58, close W of: (b) above

Chart 3068 (INT 1846) (Panel A) [ previous update 530/19 ] WGS84 DATUM
Insert depth, 54 (a) 45° 25´·52N., 0° 52´·35W.
Delete depth, 75, close NE of: (a) above

Chart 3068 (INT 1846) (Panel B) [ previous update 530/19 ] WGS84 DATUM
Amend safe vertical clearance to, 52 44° 54´·96N., 0° 32´·85W.
vertical clearance to, 52 44° 52´·82N., 0° 32´·69W.
vertical clearance to, 6,6 44° 51´·49N., 0° 33´·23W.

Chart 3069 (INT 1847) (Panel B, La Garonne) [ previous update 941/19 ] WGS84 DATUM
Amend safe vertical clearance to, 52 44° 55´·10N., 0° 32´·81W.
vertical clearance to, 52 44° 52´·81N., 0° 32´·16W.
vertical clearance to, 6,6 44° 51´·46N., 0° 33´·03W.

6195 SPAIN - South West Coast - Light.


Source: Spanish Lights List

Chart 2976 (Panel, Río Guadalquivir Bonanza to Salina de Santa Teresa) [ previous update 3698/19 ] WGS84 DATUM
Insert
· 2Fl.Y.5s1M 36° 50´·1N., 6° 21´·5W.

6198 SPAIN - West Coast - Breakwater. Light.


Source: Spanish Notice 44/342/19

Chart 3764 [ previous update 604/18 ] WGS84 DATUM


Insert breakwater, single firm line, joining: (a) 42° 54´·52N., 9° 15´·49W.
(b) 42° 54´·56N., 9° 15´·53W.
Move
¶ Fl(4)R.11s8m1M, from: (a) above
to: (b) above

2.16
Wk49/19
II

6211 FRANCE - West Coast - Submarine cable. Buoy.


Source: French Notice 44/50/19

Chart 3427 (INT 1832) [ previous update 456/19 ] WGS84 DATUM


Insert submarine cable, É, joining: (a) 48° 21´·88N., 4° 31´·43W.
48° 21´·76N., 4° 31´·28W.
48° 21´·02N., 4° 31´·01W.
(b) 48° 20´·94N., 4° 31´·09W.
Delete former submarine cable, É, joining: (a)-(b) above
Insert submarine cable, É , joining:
(c) 48° 19´·64N., 4° 31´·64W.
48° 19´·52N., 4° 31´·68W.
48° 19´·44N., 4° 31´·62W.
(d) 48° 19´·30N., 4° 31´·69W.
Delete former submarine cable, É, joining: (c)-(d) above
Insert submarine cable, É, joining: (e) 48° 18´·87N., 4° 31´·83W.
48° 18´·73N., 4° 31´·55W.
48° 18´·34N., 4° 31´·30W.
(f) 48° 18´·14N., 4° 31´·29W.
Delete former submarine cable, É , joining:
(e)-(f) above

Chart 3429 [ previous update 3195/19 ] WGS84 DATUM


Insert submarine cable, É, joining: (a) 48° 21´·88N., 4° 31´·43W.
48° 21´·76N., 4° 31´·28W.
48° 21´·02N., 4° 31´·01W.
(b) 48° 20´·94N., 4° 31´·09W.
Delete former submarine cable, É , joining:
(a)-(b) above
Insert submarine cable, É, joining: (c) 48° 19´·64N., 4° 31´·64W.
48° 19´·52N., 4° 31´·68W.
48° 19´·44N., 4° 31´·62W.
(d) 48° 19´·30N., 4° 31´·69W.
Delete former submarine cable, É, joining: (c)-(d) above
Insert submarine cable, É, joining: (e) 48° 18´·87N., 4° 31´·83W.
48° 18´·73N., 4° 31´·55W.
48° 18´·34N., 4° 31´·30W.
(f) 48° 18´·14N., 4° 31´·29W.
Delete former submarine cable, É, joining: (e)-(f) above
Insert
Bd No22
48° 16´·86N., 4° 15´·91W.

2.17
Wk49/19
II

6181* CYPRUS - Buoy. Outfall.


Source: Cyprus Department of Lands and Surveys

Chart 775 [ previous update 2014/18 ] WGS84 DATUM


Insert
G;Fl.Y.4s
f (2 buoys) (a) 34° 41´·34N., 32° 32´·85E.
outfall, È, joining:
(a) above
34° 41´·73N., 32° 33´·00E.
34° 41´·80N., 32° 32´·99E.

6197 ALGERIA - Buoy.


Source: Algerian Notice 18/01/19

Chart 838 [ previous update 3097/18 ] WGS84 DATUM


Move
BdFl.R.4s, from: 35° 49´·66N., 0° 15´·72W.
to: 35° 49´·65N., 0° 15´·60W.

6205 SPAIN - Mediterranean Sea Coast - Buoyage. Marine farm.


Source: Spanish Notice 44/343/19

Chart 1460 [ previous update 1240/16 ] WGS84 DATUM


Delete
G;Ff l(4)Y.11s3M (a) 39° 39´·225N., 0° 10´·757W.
(b) 39° 39´·099N., 0° 10´·489W.
(c) 39° 38´·933N., 0° 10´·620W.
(d) 39° 39´·058N., 0° 10´·890W.
limit of marine farm, pecked line, joining: (a)-(d) above

Ì, within: (a)-(d) above

2.18
Wk49/19
II

6212 TURKEY - South Coast - Anchorage areas.


Source: Turkish Notice 43/205/19 & UKHO

Chart 2101 (INT 3657) [ previous update 6109/19 ] WGS84 DATUM


Delete limit of anchorage area, pecked line, and associated legends,
½ No 2 quarantine and dangerous cargo, joining:
36° 44´·830N., 34° 41´·004E.
36° 44´·998N., 34° 41´·004E.
36° 44´·998N., 34° 43´·500E.

Chart 2632 [ previous update 6109/19 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: (a) 36° 44´·0N., 34° 42´·7E.
(b) 36° 44´·0N., 34° 46´·7E.
(c) 36° 40´·0N., 34° 46´·7E.
(d) 36° 40´·0N., 34° 42´·7E.
legend, ½No 2 quarantine and dangerous cargo, within: (a)-(d) above
Delete former limit of anchorage area, pecked line, and associated
½
legend, No 2 quarantine and dangerous cargo, close NW of:
(a)-(d) above

6225 ITALY - Sardegna - Depth.


Source: UKHO

Chart 1990 [ previous update 3364/18 ] WGS84 DATUM


Insert depth, 375 38° 34´·4N., 9° 28´·6E.

6246 UKRAINE - Light.


Source: Ukrainian Notice 41/523/19

Chart 2217 (Panel, Sevastopol’) [ previous update 1045/19 ] PULKOVO 1942 DATUM
Insert
¶F 44° 36´·50N., 33° 28´·18E.

6262 SPAIN - Islas Baleares - NM Block.


Source: Spanish Notice 44/347/19

Chart 2832 [ previous update 5927/19 ] WGS84 DATUM


Insert the accompanying block, centred on: 39° 33´·2N., 2° 38´·8E.

2.19
Wk49/19
II

6265 FRANCE - Corse - Light. Restricted area. Legend.


Source: French Notice 45/93/19

Chart 1424 (Panel, Ajaccio) [ previous update 5409/19 ] WGS84 DATUM


Delete
¶ Fl.R.4s7m3M 41° 55´·677N., 8° 44´·595E.

Chart 1424 (Panel, Propriano) [ previous update 5409/19 ] WGS84 DATUM


Insert limit of restricted area, Ç, joining: (a) 41° 40´·646N., 8° 54´·113E.
(b) 41° 40´·719N., 8° 54´·023E.
(c) 41° 40´·770N., 8° 53´·830E.
(d) 41° 40´·770N., 8° 53´·021E.
(e) 41° 41´·099N., 8° 53´·100E.
(f) 41° 41´·100N., 8° 54´·366E.
(g) 41° 40´·688N., 8° 54´·367E.
(h) 41° 40´·687N., 8° 54´·199E.
legend, Regulated Area (see Note), within: (a)-(h) above

6272 FRANCE - Corse - Restricted area. Legend. Note.


Source: French Notice 45/93/19

Chart 1425 (Panel C, Bastia) [ previous update 2482/19 ] WGS84 DATUM


Insert circular limit of restricted area, entry prohibited, pecked line,
radius 500m, centred on: 42° 39´·628N., 9° 27´·448E.
legend, Gas terminal (see Note), centred on: 42° 39´·643N., 9° 27´·609E.
the accompanying note, GAS TERMINAL, centred on: 42° 39´·043N., 9° 26´·436E.

6275 TURKEY - Marmara Denizi - Anchorage areas.


Source: Turkish Notice 44/208/19

Chart 497 (Panel A, Tuzla to İzmİt) [ previous update 5844/19 ]


Insert limit of anchorage area, pecked line, joining: (a) 40° 41´·73N., 29° 21´·78E.
(b) 40° 42´·63N., 29° 21´·88E.
Delete former limit of anchorage area, pecked line, joining: (a) above
40° 42´·34N., 29° 22´·83E.
40° 42´·85N., 29° 22´·55E.
(b) above
Insert limit of anchorage area, pecked line, joining: 40° 40´·89N., 29° 20´·22E.
40° 42´·04N., 29° 20´·11E.
Delete former limit of anchorage area, pecked line, joining: 40° 40´·96N., 29° 20´·47E.
40° 42´·16N., 29° 20´·47E.

2.20
Wk49/19
II

6276 GUINEA - Depths.


Source: French Notice 45/168/19

Chart 611 [ previous update 4580/19 ] WGS84 DATUM


Insert depth, 91, enclosed by 10m contour 10° 20´·7N., 15° 23´·2W.
depth, 106, and extend 20m approximate contour SE to enclose(a) 10° 15´·2N., 15° 22´·4W.
Delete depth, 20, close NW of: (a) above

Chart 612 [ previous update 1171/19 ] UNDETERMINED DATUM


Insert depth, 91, enclosed by 10m contour (a) 10° 20´·7N., 15° 23´·2W.
Delete depth, 14, close NE of: (a) above
Insert depth, 106, and extend 20m approximate contour SE to enclose(b) 10° 15´·2N., 15° 22´·4W.
Delete depth, 20, close NW of: (b) above

Chart 1147 (INT 1085) [ previous update 4580/19 ] UNDETERMINED DATUM


Insert depth, 91, and extend 10m contour SE to enclose 10° 20´·7N., 15° 23´·2W.
depth, 106, and extend 20m contour SE to enclose 10° 15´·2N., 15° 22´·4W.

6172* UNITED ARAB EMIRATES - Restricted area.


Source: Dubai Maritime City Authority

Chart 2837 (INT 7017) [ previous update 5830/19 ] WGS84 DATUM


Delete circular limit of restricted area, entry prohibited, centred on: 25° 07´·8N., 55° 07´·0E.

Chart 2887 (INT 7232) [ previous update 5717/19 ] WGS84 DATUM


Delete limit of restricted area, entry prohibited, pecked line, joining: 25° 06´·5N., 55° 09´·3E.
25° 07´·7N., 55° 09´·7E.
25° 09´·7N., 55° 08´·8E.
25° 10´·3N., 55° 06´·7E.
25° 09´·2N., 55° 04´·6E.
25° 07´·6N., 55° 04´·2E.
25° 06´·1N., 55° 05´·0E.

Chart 2888 (INT 7199) [ previous update 5830/19 ] WGS84 DATUM


Delete limit of restricted area, Ç, joining: 25° 10´·0N., 55° 05´·6E.
25° 10´·4N., 55° 06´·8E.
25° 10´·0N., 55° 08´·4E.

Chart 2889 (INT 7211) [ previous update 6035/19 ] WGS84 DATUM


Delete circular limit of restricted area, entry prohibited, centred on: 25° 07´·8N., 55° 07´·0E.

2.21
Wk49/19
II
6172* UNITED ARAB EMIRATES - Restricted area. (continued)

Chart 3176 (INT 7216) [ previous update 5546/19 ] WGS84 DATUM


Delete limit of restricted area, entry prohibited, pecked line, joining: 25° 05´·63N., 55° 08´·58E.
25° 06´·38N., 55° 09´·20E.
25° 07´·03N., 55° 09´·58E.
25° 08´·89N., 55° 09´·50E.
25° 10´·27N., 55° 07´·78E.
25° 09´·90N., 55° 05´·39E.
25° 07´·64N., 55° 04´·24E.
25° 05´·65N., 55° 05´·67E.
25° 05´·21N., 55° 07´·66E.
25° 05´·36N., 55° 08´·02E.

Chart 3412 (INT 7219) [ previous update 3953/19 ] WGS84 DATUM


Delete limit of restricted area, entry prohibited, pecked line, joining: 25° 10´·20N., 55° 08´·00E.
25° 09´·64N., 55° 08´·99E.
25° 08´·35N., 55° 09´·72E.
25° 07´·01N., 55° 09´·58E.
25° 06´·91N., 55° 09´·75E.
and
25° 06´·48N., 55° 09´·42E.
25° 06´·55N., 55° 09´·32E.
25° 05´·91N., 55° 08´·72E.
25° 05´·78N., 55° 08´·73E.
25° 05´·63N., 55° 08´·58E.

Chart 3739 (INT 7220) [ previous update New Edition 28/03/2019 ] WGS84 DATUM
Delete limit of restricted area, entry prohibited, pecked line, joining: 25° 08´·93N., 55° 09´·50E.
25° 10´·26N., 55° 07´·77E.
25° 09´·89N., 55° 05´·37E.
25° 07´·63N., 55° 04´·24E.
25° 05´·65N., 55° 05´·66E.
25° 05´·21N., 55° 07´·69E.
25° 05´·35N., 55° 08´·04E.

2.22
Wk49/19
II

6239 OMAN - Anchorage areas.


Source: Omani Notice 10/41/19

Chart 3523 [ previous update 3398/19 ] WGS84 DATUM


Insert limit of anchorage area, pecked line, joining: (a) 23° 58´·40N., 57° 23´·40E.
(b) 23° 56´·00N., 57° 23´·40E.
(c) 23° 56´·00N., 57° 26´·00E.
(d) 23° 58´·40N., 57° 26´·00E.
legend, ½C DW, within: (a)-(d) above
limit of anchorage area, pecked line, joining: (e) 23° 54´·80N., 57° 24´·40E.
(f) 23° 53´·20N., 57° 24´·40E.
(g) 23° 53´·20N., 57° 26´·00E.
(h) 23° 54´·80N., 57° 26´·00E.
legend, ½B Medium Size Ships, within: (e)-(h) above
limit of anchorage area, pecked line, joining: (i) 23° 53´·20N., 57° 24´·90E.
(j) 23° 52´·20N., 57° 24´·90E.
(k) 23° 52´·20N., 57° 26´·00E.
(l) 23° 53´·20N., 57° 26´·00E.
legend, ½A Yachts, within: (i)-(l) above

6243 OMAN - Obstruction. Wreck.


Source: Omani Notice 10/38/19

Chart 3518 (Panel B, Port Sultan Qāboos and Muscaṭ (Masqaṭ)) [ previous update 6024/19 ] WGS84 DATUM
Insert
å Obstn 23° 37´·853N., 58° 34´·419E.
Replace
6+ Wk with 1Ó+ Wk 23° 37´·517N., 58° 34´·807E.

6170 INDIA - West Coast - Wreck.


Source: Indian Notice 21/233/19

Chart IN 211 [ previous update 5958/19 ] WGS84 DATUM


Insert
´PA 18° 54´·55N., 72° 47´·16E.

Chart IN 255 (INT 7334) [ previous update 5958/19 ] WGS84 DATUM


Insert
´PA 18° 54´·6N., 72° 47´·2E.

Chart IN 2016 (INT 7336) [ previous update 5209/19 ] WGS84 DATUM


Insert
´PA 18° 54´·55N., 72° 47´·16E.

2.23
Wk49/19
II

6191 INDIA - West Coast - Wreck. Obstruction.


Source: Indian Notices 21/231-232/19

Chart IN 206 [ previous update 3972/19 ] WGS84 DATUM


Insert
´PA 20° 22´·09N., 71° 11´·20E.

Chart IN 207 [ previous update 5658/19 ] WGS84 DATUM


Insert
´PA 20° 22´·09N., 71° 11´·20E.

Chart IN 253 (INT 7328) [ previous update 5209/19 ] WGS84 DATUM


Insert
´PA 20° 22´·1N., 71° 11´·2E.

Chart IN 254 (INT 7331) [ previous update 5658/19 ] UNDETERMINED DATUM


Insert
´PA 20° 22´·1N., 71° 11´·2E.

Chart IN 292 (INT 7021) [ previous update 5658/19 ] WGS84 DATUM


Insert
´PA 20° 22´·1N., 71° 11´·2E.
Delete
11, Diffuser 21° 28´·2N., 72° 33´·7E.

Chart 707 [ previous update 4300/19 ] WGS84 DATUM


Insert
´PA 20° 22´·1N., 71° 11´·2E.

6146 MALACCA STRAIT - NM Block. Depths. Obstruction.


Source: ENC MS3OF2TT
Note: This update is included in New Edition 3946, published late 2019.

Chart 3901 [ previous update 3192/19 ] WGS84 DATUM


Insert depth, 41, enclosed by 5m contour (a) 2° 57´·3N., 100° 32´·5E.
Delete depth, 9, and associated 10m contour, close SE of: (a) above

Chart 3902 [ previous update 6082/19 ] WGS84 DATUM


Insert depth, 41, enclosed by 5m contour (a) 2° 57´·3N., 100° 32´·5E.
Delete depth, 9, and associated 10m contour, close SE of: (a) above
Insert
2$+ Obstn (b) 2° 46´·4N., 100° 40´·6E.
Delete depth, 55, and associated 10m contour, close SW of: (b) above
Insert depth, 53, and extend 10m contour S to enclose 2° 16´·4N., 101° 31´·8E.
depth, 173, enclosed by 20m contour 2° 15´·8N., 101° 34´·3E.
depth, 27 2° 11´·5N., 101° 36´·4E.
Replace depth, 146, with depth, 115 2° 45´·8N., 100° 33´·3E.
depth, 188, and associated 20m contour, with depth, 28 2° 21´·8N., 101° 37´·1E.

2.24
Wk49/19
II
6146 MALACCA STRAIT - NM Block. Depths. Obstruction. (continued)

Chart 3940 [ previous update New Edition 15/08/2019 ] WGS84 DATUM


Insert the accompanying block, centred on: 2° 56´·8N., 100° 34´·2E.
depth, 24, and extend 30m contour E to enclose (a) 2° 56´·67N., 100° 38´·54E.
Delete depth, 32, close N of: (a) above
Insert depth, 265, and extend 30m contour NE to enclose (b) 2° 55´·99N., 100° 39´·39E.
Delete depth, 34, close S of: (b) above
Insert depth, 136, enclosed by 15m contour (c) 2° 51´·73N., 100° 40´·68E.
Delete depth, 186, close S of: (c) above
Insert
2$+ Obstn (d) 2° 46´·39N., 100° 40´·65E.
Delete depth, 143, close NW of: (d) above
Replace depth, 175, with depth, 126, and extend 15m approximate
contour S to enclose 2° 52´·40N., 100° 33´·59E.

Chart 3945 [ previous update 3314/19 ] WGS84 DATUM


Insert depth, 169, and extend 20m contour NE to enclose (a) 3° 00´·05N., 100° 32´·90E.
Delete depth, 25, close NE of: (a) above
Insert depth, 41, enclosed by 5m contour (b) 2° 57´·34N., 100° 32´·48E.
Delete depth, 11, close NW of: (b) above
Insert depth, 265, and extend 30m contour NE to enclose (c) 2° 55´·99N., 100° 39´·39E.
Delete depth, 34, close E of: (c) above
Insert depth, 55 (d) 2° 53´·48N., 100° 33´·84E.
Delete depth, 65, close W of: (d) above
Insert depth, 136 (e) 2° 51´·73N., 100° 40´·68E.
Delete depth, 186, close SE of: (e) above
Replace depth, 175, with depth, 126 2° 52´·40N., 100° 33´·59E.
Delete depth, 9, and associated 10m contour 2° 56´·42N., 100° 33´·19E.

6145 CHINA - Bo Hai - Anchorage area.


Source: Chinese Notice 42/1346/19
Note: Former Notice 558(T)/18 is cancelled.

Chart 1252 [ previous update 5660/19 ] CGCS 2000 DATUM


Delete limit of anchorage area, pecked line, and associated legend,
½ , joining:
40° 37´·32N., 121° 57´·14E.
40° 39´·00N., 121° 57´·14E.
40° 38´·57N., 121° 59´·13E.
40° 37´·28N., 121° 59´·13E.

2.25
Wk49/19
II
6145 CHINA - Bo Hai - Anchorage area. (continued)

Chart 1286 [ previous update 5761/19 ] CGCS 2000 DATUM


Delete limit of anchorage area, pecked line, and associated legend,
½
Lightering , joining:
40° 37´·29N., 121° 57´·14E.
40° 39´·02N., 121° 57´·15E.
40° 38´·57N., 121° 59´·13E.
40° 37´·29N., 121° 59´·13E.

Chart 1287 [ previous update 5327/19 ] CGCS 2000 DATUM


Delete limit of anchorage area, pecked line, and associated legend,
½
Lightering , joining:
40° 37´·29N., 121° 57´·15E.
40° 39´·02N., 121° 57´·15E.
40° 38´·57N., 121° 59´·13E.
40° 37´·29N., 121° 59´·13E.

6148 CHINA - Yellow Sea Coast - NM Block.


Source: Chinese Notices 42/1348-1350/19

Chart 1253 [ previous update 5067/19 ] CGCS 2000 DATUM


Insert the accompanying block, centred on: 35° 17´·9N., 119° 41´·5E.

6165 VIETNAM - Light.


Source: VMS South Notice 220/19

Chart 1261 [ previous update 5577/19 ] WGS84 DATUM


Amend light to, Fl(3+1)20s65m24M 10° 41´·58N., 107° 59´·40E.

Chart 3482 (INT 550) [ previous update 6081/19 ] WGS84 DATUM


Amend range of light to, 24M 10° 42´·2N., 107° 59´·7E.

Chart 3488 (INT 552) [ previous update 6081/19 ] WGS84 DATUM


Amend range of light to, 24M 10° 42´·0N., 107° 59´·5E.

Chart 3986 [ previous update 6081/19 ] WGS84 DATUM


Amend range of light to, 24M 10° 41´·7N., 107° 59´·5E.

Chart 3987 [ previous update 6081/19 ] WGS84 DATUM


Amend range of light to, 24M 10° 41´·7N., 107° 59´·5E.

6166 VIETNAM - NM Block.


Source: VMS South Notices 228-229/19

Chart 3883 [ previous update 6071/19 ] WGS84 DATUM


Insert the accompanying block, centred on: 12° 28´·7N., 109° 22´·2E.

2.26
Wk49/19
II

6204 CHINA - East Coast - Depths. Wreck. Obstructions. Buoy. Submarine pipeline.
Source: UKHO

Chart 1761 [ previous update 5806/19 ] WGS84 DATUM


Insert submarine pipeline, È, joining: 25° 00´·6N., 120° 53´·4E.
25° 02´·8N., 120° 58´·9E.
25° 02´·0N., 121° 00´·3E.
25° 01´·0N., 121° 01´·9E.
Replace depth, 271, with depth, 257 25° 11´·4N., 121° 17´·8E.
depth, 30, with depth, 282 25° 12´·1N., 121° 19´·5E.

Chart 3658 [ previous update 6004/19 ] WGS84 DATUM


Insert submarine pipeline, È, joining: (a) 25° 00´·62N., 120° 53´·42E.
(b) 25° 02´·84N., 120° 58´·86E.
25° 01´·99N., 121° 00´·35E.
25° 00´·96N., 121° 01´·87E.
legend, Gas, along: (a)-(b) above

® 25° 14´·00N., 121° 26´·00E.


depth, 138, and extend 20m contour NE to enclose (c) 25° 09´·17N., 121° 17´·46E.
Delete depth, 187, close NW of: (c) above
Replace depth, 271, with depth, 257 25° 11´·37N., 121° 17´·78E.
depth, 30, with depth, 282 25° 12´·08N., 121° 19´·45E.

Chart 3658 (Panel, T’aipei Kang) [ previous update 6004/19 ] WGS84 DATUM
Insert
4+ Obstn (a) 25° 09´·00N., 121° 22´·23E.
Delete depth, 61, close W of: (a) above
Replace
BdFl.R.5s with åObstn 25° 09´·03N., 121° 20´·08E.

6218 VIETNAM - Light.


Source: VMS-South Notice 223/19

Chart 3482 (INT 550) [ previous update 6165/19 ] WGS84 DATUM


Amend range of light to, 23M 12° 53´·7N., 109° 27´·6E.

Chart 3488 (INT 552) [ previous update 6165/19 ] WGS84 DATUM


Amend range of light to, 23M 12° 53´·6N., 109° 27´·5E.

Chart 3883 [ previous update 6166/19 ] WGS84 DATUM


Amend range of light to, 23M 12° 53´·80N., 109° 27´·42E.

Chart 3987 [ previous update 6165/19 ] WGS84 DATUM


Amend range of light to, 23M 12° 53´·8N., 109° 27´·5E.

Chart 3988 [ previous update 4798/19 ] WGS84 DATUM


Amend range of light to, 23M 12° 53´·9N., 109° 27´·6E.

2.27
Wk49/19
II

6230 CHINA - South Coast - Depths. Rock.


Source: Chinese Chart 14181

Chart 1716 [ previous update 6125/19 ] CGCS 2000 DATUM


Insert depth, 22, with seabed type, St (a) 24° 51´·35N., 118° 54´·09E.
Delete depth, 33, with seabed type, St close E of: (a) above

Chart 1760 [ previous update 6062/19 ] WGS84 DATUM


Replace depth, 33, with seabed type, R, with depth, 22, with seabed
type, R 24° 51´·4N., 118° 54´·1E.

Chart 1761 [ previous update 6204/19 ] WGS84 DATUM


Replace depth, 33, with seabed type, R, with depth, 22, with seabed
type, R 24° 51´·4N., 118° 54´·1E.

6236 VIETNAM - Light.


Source: VMS-South Notice 229/19

Chart 3883 [ previous update 6218/19 ] WGS84 DATUM


Delete sector at light, Fl(3)10s102m26M 12° 11´·65N., 109° 20´·11E.

6241 CHINA - East Coast - Wreck.


Source: Chinese Notice 43/1391/19

Chart 1754 [ previous update 5806/19 ] WGS84 DATUM


Insert
´Rep (2018) PA 27° 07´·0N., 121° 31´·0E.

Chart 2412 [ previous update 5970/19 ] WGS84 DATUM


Insert
´Rep (2018) PA 27° 07´·0N., 121° 31´·0E.

2.28
Wk49/19
II

6242 TAIWAN - Buoyage. Radar beacons. Virtual aids to navigation. Anchorage areas. Wreck.
Depth.
Source: UKHO

Chart 2409 [ previous update 6062/19 ] WGS84 DATUM


Replace
GFl(2)5s, and associated radar beacon, Racon(Z), with
symbol, Virtual aid to navigation, special topmark, V-AIS 22° 37´·86N., 120° 12´·33E.

GFl.5s, with symbol, Virtual aid to navigation, special


topmark, V-AIS 22° 37´·63N., 120° 13´·37E.

Chart 3232 [ previous update 6000/19 ] WGS84 DATUM


Insert symbol, Virtual aid to navigation, special topmark, V-AIS (a) 22° 32´·63N., 120° 15´·86E.
Delete
G Mo(Q)15s, close W of:
(a) above
Insert symbol, Virtual aid to navigation, special topmark, V-AIS (b) 22° 32´·31N., 120° 14´·19E.
Delete
DMo(B)15s and associated radar beacon, Racon(S), close
W of: (b) above
Insert limit of anchorage area, pecked line, joining: 22° 32´·57N., 120° 17´·21E.
22° 31´·55N., 120° 17´·99E.
Delete former limit of anchorage area, pecked line, joining: 22° 32´·85N., 120° 17´·93E.
22° 31´·77N., 120° 18´·59E.
22° 31´·69N., 120° 18´·37E.
Insert
24,Wk (c) 22° 31´·47N., 120° 16´·37E.
Delete depth, 255, close S of: (c) above
Replace
DFl.5s and associated radar beacon, Racon(Z), with
symbol, Virtual aid to navigation, special topmark, V-AIS 22° 37´·86N., 120° 12´·31E.

DFl(2)5s, with symbol, Virtual aid to navigation, special


topmark, V-AIS 22° 37´·63N., 120° 13´·37E.

Chart 4410 [ previous update 6116/19 ] WGS84 DATUM


Insert symbol, Virtual aid to navigation,special topmark, V-AIS (a) 22° 32´·3N., 120° 14´·2E.
Delete
DMo(B) and associated radar beacon, Racon(S), close W
of: (a) above
Replace
GFl(2) and associated radar beacon, Racon(Z), with
symbol, Virtual aid to navigation, special topmark, V-AIS 22° 37´·8N., 120° 12´·3E.

2.29
Wk49/19
II

6247 CHINA - South Coast - Obstruction.


Source: Chinese Notice 43/1392/19

Chart 1760 [ previous update 6230/19 ] WGS84 DATUM


Insert
åObstn PA 23° 52´·0N., 118° 34´·5E.

Chart 1968 [ previous update 6116/19 ] WGS84 DATUM


Insert
åObstn PA 23° 52´·0N., 118° 34´·5E.

Chart 3489 (INT 553) [ previous update 6116/19 ] WGS84 DATUM


Insert
åObstn PA 23° 52´·0N., 118° 34´·5E.

6255 VIETNAM - Depth.


Source: VMS-South Notice 242/19

Chart 1036 [ previous update 5997/19 ] WGS84 DATUM


Insert depth, 54 10° 40´·08N., 106° 45´·13E.

6258 VIETNAM - Wreck. Depth.


Source: VMS-North Notice 256/19

Chart 3989 [ previous update 5741/19 ] WGS84 DATUM


Insert
10, Wk (a) 18° 07´·6N., 106° 29´·3E.
Delete depth, 27, close W of: (a) above

6259 CHINA - Bo Hai - NM Block. Maritime limits.


Source: Chinese Chart 11552

Chart 1221 [ previous update 5324/19 ] CGCS 2000 DATUM


Insert the accompanying block, centred on: 40° 47´·8N., 121° 02´·7E.
maritime limit, pecked line, joining: 40° 43´·59N., 121° 01´·36E.
40° 43´·59N., 121° 02´·15E.
40° 42´·66N., 121° 02´·15E.
40° 42´·66N., 121° 01´·61E.
Delete former maritime limit, pecked line, joining: 40° 43´·44N., 121° 01´·83E.
40° 43´·44N., 121° 01´·99E.
40° 42´·96N., 121° 01´·98E.
40° 42´·96N., 121° 01´·89E.

2.30
Wk49/19
II

6261 CHINA - East Coast - Wreck.


Source: Chinese Notice 43/1390/19

Chart 1721 [ previous update 5523/19 ] CGCS 2000 DATUM


Insert
´Rep (2018) PA 27° 50´·18N., 121° 17´·00E.

Chart 1754 [ previous update 6241/19 ] WGS84 DATUM


Insert
´Rep (2018) PA 27° 50´·2N., 121° 17´·0E.

Chart 1759 [ previous update 5523/19 ] CGCS 2000 DATUM


Insert
´Rep (2018) PA 27° 50´·2N., 121° 17´·0E.

6268 CHINA - South Coast - Virtual aids to navigation.


Source: Chinese Notice 43/1396/19

Chart 1728 [ previous update 6031/19 ] CGCS 2000 DATUM


Insert symbol, Virtual aid to navigation, special topmark, V-AIS 21° 15´·76N., 109° 27´·39E.
21° 15´·86N., 109° 28´·68E.
21° 17´·56N., 109° 29´·42E.

6273 CHINA - East Coast - Wreck.


Source: Chinese Notice 43/1386/19

Chart 1603 [ previous update New Edition 31/10/2019 ] CGCS 2000 DATUM
Delete
´Rep (2018) PA 31° 21´·68N., 121° 40´·57E.

6128 JAPAN - Kyūshū - Breakwaters. Fish havens. Jetties.


Source: Japanese Notice 44/883/19

Chart JP 179 [ previous update 4029/19 ] WGS84 DATUM


Insert
Á 34° 09´·88N., 130° 54´·80E.

2.31
Wk49/19
II
6128 JAPAN - Kyūshū - Breakwaters. Fish havens. Jetties. (continued)

Chart JP 201 [ previous update 1984/19 ] WGS84 DATUM


Insert limit of fish haven, dotted line, joining: (a) 34° 09´·87N., 130° 54´·65E.
(b) 34° 10´·00N., 130° 54´·87E.
(c) 34° 09´·90N., 130° 54´·95E.
(d) 34° 09´·77N., 130° 54´·73E.

À within: (a)-(d) above


jetty, single firm line, joining: 34° 09´·73N., 130° 55´·08E.
34° 09´·78N., 130° 55´·02E.
and
34° 09´·52N., 130° 54´·88E.
34° 09´·60N., 130° 54´·85E.
Delete breakwater, single firm line, joining: 34° 09´·57N., 130° 54´·92E.
34° 09´·54N., 130° 54´·89E.
and
34° 09´·53N., 130° 54´·86E.
34° 09´·52N., 130° 54´·80E.

6129 JAPAN - Seto Naikai - Legends. Berth.


Source: Japanese Notice 44/887/19

Chart JP 123 [ previous update 4602/19 ] WGS84 DATUM


Insert legend, Ruins, centred on: 34° 40´ 05·6"N., 135° 24´ 38·0"E.
Amend legend to, Ruins, centred on: (a) 34° 40´ 04·6"N., 135° 24´ 40·2"E.
Delete berth number, 28, close SW of: (a) above

Chart JP 1107 [ previous update New Edition 04/04/2019 ] WGS84 DATUM


Insert legend, Ruins, centred on: 34° 40´ 05·7"N., 135° 24´ 37·8"E.
Amend legend to, Ruins, centred on: 34° 40´ 03·8"N., 135° 24´ 37·0"E.
(a) 34° 40´ 04·6"N., 135° 24´ 41·3"E.
Delete berth number, 28, close W of: (a) above

6130 JAPAN - Seto Naikai - Buoyage.


Source: Japanese Notice 44/888/19

Chart JP 1107 [ previous update 6129/19 ] WGS84 DATUM


Insert
Jf(Y Lt) 34° 42´ 32·1"N., 135° 21´ 19·6"E.
34° 42´ 29·9"N., 135° 21´ 19·6"E.
34° 42´ 24·3"N., 135° 21´ 25·8"E.
34° 42´ 18·8"N., 135° 21´ 31·9"E.
34° 42´ 12·9"N., 135° 21´ 37·9"E.

2.32
Wk49/19
II

6131 JAPAN - Kyūshū - Jetty. Legend.


Source: Japanese Notice 44/889/19

Chart JP 1228 [ previous update 4027/19 ] WGS84 DATUM


Insert submerged jetty, double dotted line, width 64m, joining: (a) 33° 35´·15N., 130° 06´·33E.
(b) 33° 35´·20N., 130° 06´·43E.
legend, Submerged Jetty, close N of: (a)-(b) above

6132 JAPAN - Kyūshū - Fish haven.


Source: Japanese Notice 44/890/19

Chart JP 179 [ previous update 6128/19 ] WGS84 DATUM


Insert
Á 33° 51´·76N., 129° 43´·26E.

Chart JP 1228 [ previous update 6131/19 ] WGS84 DATUM


Insert
Á 33° 51´·76N., 129° 43´·26E.

6133 JAPAN - Kyūshū - Wreck.


Source: Japanese Notice 44/891/19

Chart JP 179 [ previous update 6132/19 ] WGS84 DATUM


Insert
^PA 33° 46´·50N., 129° 37´·22E.

Chart JP 187 [ previous update 4605/19 ] WGS84 DATUM


Insert
^PA 33° 46´·5N., 129° 37´·2E.

Chart JP 1228 [ previous update 6132/19 ] WGS84 DATUM


Insert
^PA 33° 46´·50N., 129° 37´·22E.

6134 JAPAN - Kyūshū - Light.


Source: Japanese Notice 44/892/19

Chart JP 198 [ previous update 4604/19 ] WGS84 DATUM


Delete
·{ 33° 10´·28N., 129° 35´·60E.

Chart JP 213 [ previous update 4605/19 ] WGS84 DATUM


Delete
·{{ 33° 10´·28N., 129° 35´·60E.

2.33
Wk49/19
II

6135 JAPAN - Kyūshū - Wreck.


Source: Japanese Notice 44/893/19

Chart JP 187 [ previous update 6133/19 ] WGS84 DATUM


Delete
^PA 32° 40´·3N., 129° 46´·8E.

Chart JP 213 [ previous update 6134/19 ] WGS84 DATUM


Delete
^PA 32° 40´·30N., 129° 46´·80E.

6155 KOREA - South Coast - Rock.


Source: ENC KR4F4K20

Chart 3365 (INT 5252) [ previous update 6083/19 ] WGS84 DATUM


Replace depth, 87, with seabed type, R, with depth, 79, with seabed
type, R 33° 48´·64N., 126° 57´·93E.

6158 KOREA - East Coast - Tidal streams.


Source: ENC KR4G3B30

Chart 896 (INT 5355) [ previous update 5963/19 ] WGS84 DATUM


Delete symbol, ebb tide stream arrow, 1·5kn, centred on: 35° 07´·63N., 129° 13´·68E.
symbol, flood tide stream arrow, 1·1kn, centred on: 35° 07´·45N., 129° 13´·19E.

Chart 3666 (INT 5251) [ previous update 5963/19 ] WGS84 DATUM


Delete symbol, ebb tide stream arrow, 1·5kn, centred on: 35° 07´·64N., 129° 14´·15E.
symbol, flood tide stream arrow, 1·1kn, centred on: 35° 07´·06N., 129° 12´·75E.

6160 RUSSIA - Pacific Ocean Coast - Light.


Source: Russian Notice 45/5232/19

Chart 1231 (Panel A, Portovyy Punkt Korf) [ previous update 3324/19 ] UNDETERMINED DATUM
Amend light to, Fl.5s62m9M 60° 26´·55N., 166° 09´·39E.

Chart 1231 (Panel B, Zaliv Korfa) [ previous update 3324/19 ] UNDETERMINED DATUM
Amend light to, Fl.5s9M 60° 26´·62N., 166° 09´·48E.

6164 KOREA - South Coast - Obstruction.


Source: ENC KR4G3E10

Chart 3391 (INT 5360) [ previous update 5604/19 ] WGS84 DATUM


Insert
19(,Obstn 34° 48´·38N., 128° 07´·93E.

2.34
Wk49/19
II

6171 RUSSIA - Pacific Ocean Coast - Obstruction.


Source: Russian Notice 45/5237/19

Chart 3044 [ previous update 3702/19 ] WGS84 DATUM


Insert
å 43° 06´·34N., 131° 55´·21E.

6176 RUSSIA - Pacific Ocean Coast - Coastline. Reclamation area. Legend.


Source: Russian Notice 45/5239/19

Chart 3041 [ previous update 1138/19 ] WGS84 DATUM


Insert coastline, single firm line, joining: (a) 42° 44´·75N., 133° 04´·79E.
(b) 42° 44´·74N., 133° 04´·75E.
(c) 42° 44´·61N., 133° 04´·67E.
(d) 42° 44´·70N., 133° 04´·41E.
(e) 42° 45´·00N., 133° 04´·32E.
Delete former coastline, joining: (a) above
(e) above
charted detail, within: (a)-(e) above
limit of reclamation area, pecked line, joining: 42° 44´·81N., 133° 04´·39E.
42° 44´·78N., 133° 04´·55E.
legend, Being reclaimed (2016), centred on: 42° 44´·71N., 133° 04´·56E.

6199 KOREA - West Coast - Depths.


Source: ENC KR4F2K30

Chart 1258 [ previous update 5798/19 ] WGS84 DATUM


Insert depth, 29, enclosed by 5m contour (a) 37° 07´·03N., 126° 04´·56E.
Delete depth, 67, and associated 10m contour close E of: (a) above
Replace depth, 4, with depth, 31 37° 11´·36N., 126° 10´·47E.
depth, 131, with depth, 124 37° 06´·49N., 126° 11´·73E.

6222 KOREA - South Coast - Obstructions. Depth. Drying height.


Source: Korean Chart 2518

Chart 3391 (INT 5360) [ previous update 6164/19 ] WGS84 DATUM


Insert
13), Obstn 34° 50´·33N., 128° 14´·57E.

6Ó+ Obstn 34° 50´·15N., 128° 16´·71E.


Replace depth, 42, with depth, 12 34° 52´·84N., 128° 15´·43E.
drying height, 03, with drying height, (1) 34° 52´·83N., 128° 15´·65E.

2.35
Wk49/19
II

6226 KOREA - East Coast - Wreck.


Source: Korean Notice 44/1029/19

Chart 882 [ previous update 6057/19 ] WGS84 DATUM


Insert
´PA 37° 46´·50N., 129° 01´·10E.

6245 KOREA - West Coast - Depths.


Source: Korean Chart 3489

Chart 913 (INT 5254) [ previous update 6083/19 ] WGS84 DATUM


Insert depth, 156 (a) 34° 54´·86N., 125° 59´·34E.
Delete depth, 185, close NE of: (a) above
Replace depth, 154, with depth, 119 35° 07´·97N., 125° 59´·49E.

Chart 3365 (INT 5252) [ previous update 6155/19 ] WGS84 DATUM


Replace depth, 43, with depth, 14 34° 34´·80N., 125° 53´·77E.

6250 KOREA - East Coast - Light.


Source: Korean Notice 44/1026/19

Chart 882 [ previous update 6226/19 ] WGS84 DATUM


Amend range of light to, 12M 38° 01´·31N., 128° 44´·09E.

6251 KOREA - West Coast - Light.


Source: Korean Notice 44/1035/19

Chart 913 (INT 5254) [ previous update 6245/19 ] WGS84 DATUM


Amend light to, Q.12m8M 36° 41´·01N., 126° 04´·51E.

Chart 1258 [ previous update 6199/19 ] WGS84 DATUM


Amend light to, Q.12m8M 36° 41´·01N., 126° 04´·51E.

6256 KOREA - South Coast - Depths. Rock.


Source: Korean Chart 2415

Chart 3365 (INT 5252) [ previous update 6245/19 ] WGS84 DATUM


Insert depth, 37, with seabed type, R, and extend 50m contour S to
enclose (a) 33° 59´·78N., 126° 48´·56E.
Delete depth, 51, close S of: (a) above

Chart 3480 [ previous update 6083/19 ] WGS84 DATUM


Insert depth, 37, with seabed type, R, and extend 50m contour SE to
enclose (a) 33° 59´·8N., 126° 48´·6E.
Delete depth, 52, close E of: (a) above

2.36
Wk49/19
II

6270 KOREA - South Coast - Legend. Overhead cable. Pylons. Safe vertical clearances.
Source: Korean Chart 2235

Chart 3391 (INT 5360) [ previous update 6222/19 ] WGS84 DATUM


Insert legend, Under construction (2019), centred on: 34° 53´·71N., 128° 07´·08E.
Delete
è Pyl (a) 34° 55´·44N., 128° 04´·43E.
(b) 34° 54´·52N., 128° 04´·51E.

è 34° 54´·91N., 128° 04´·48E.


symbol, overhead power cable, pecked line and associated safe
vertical clearance, 19m, joining: (a)-(b) above
symbol, safe vertical clearance, 30m, centred on: 34° 55´·22N., 128° 04´·68E.

6154 MALAYSIA - Sarawak - Light.


Source: Marine Department, Sarawak Notice 141/19

Chart 3837 (INT 5709) [ previous update 4164/19 ] WGS84 DATUM


Amend range of light to, 8M 3° 47´·55N., 113° 29´·45E.

6167 INDONESIA - Jawa - Buoyage. Platform.


Source: ENC ID5088R5

Chart 2797 [ previous update 4739/19 ] WGS84 DATUM


Delete
¼{ 6° 20´·7S., 108° 26´·4E.

Chart 2862 [ previous update 5956/19 ] WGS84 DATUM


Delete
¼{ 6° 20´·7S., 108° 26´·4E.

Chart 3729 [ previous update 4462/19 ] WGS84 DATUM


Insert
EfF; l.Y.5s 6° 20´·14S., 108° 25´·77E.
(a) 6° 20´·70S., 108° 26´·43E.
Delete
¼ Fl.10s10M, close SW of:
(a) above

Chart 3730 [ previous update 5046/19 ] WGS84 DATUM


Insert
EfFl.Y.5s
; 6° 20´·14S., 108° 25´·77E.
(a) 6° 20´·70S., 108° 26´·43E.
Delete
¼ Fl.10s10M, close SW of: (a) above

2.37
Wk49/19
II

6169 MALAYSIA - Sabah - Light.


Source: ENC MY3C0864

Chart 1338 [ previous update New Edition 19/09/2019 ] WGS84 DATUM


Insert
¶ Fl(2)15s15M 5° 24´·7N., 115° 14´·8E.

Chart 2109 [ previous update New Edition 05/09/2019 ] WGS84 DATUM


Insert
¶ Fl(2)15s15M 5° 24´·72N., 115° 14´·83E.

Chart 2111 [ previous update 4781/19 ] WGS84 DATUM


Insert
¶ Fl(2)15s15M 5° 24´·72N., 115° 14´·83E.

Chart 3483 (INT 551) [ previous update 5159/19 ] WGS84 DATUM


Insert
¶ Fl(2)15M 5° 24´·7N., 115° 14´·8E.

6174 INDONESIA - Papua - Buoy. Light-beacons.


Source: ENC ID50206A

Chart 3747 (Panel A, Tangguh Terminal) [ previous update 1788/19 ] WGS84 DATUM
Insert
C]Fl.G.4s
b 2° 22´·84S., 133° 06´·43E.

ThF¨ l.G.5m5M (a) 2° 23´·82S., 133° 06´·98E.


Delete
ThQ© .G.5m5M, close SE of: (a) above

Chart 3747 [ previous update 1788/19 ] WGS84 DATUM


Insert
C]Fb l.G.4s 2° 22´·84S., 133° 06´·43E.
Replace
¶ Q.G.5m5M with ¶ Fl.G.5m5M 2° 23´·82S., 133° 06´·98E.

6189 INDONESIA - Kalimantan - Depths.


Source: ENC ID400157

Chart 2639 (Panel A, Balikpapan) [ previous update New Edition 13/06/2019 ] WGS84 DATUM
Insert depth, 113 (a) 1° 16´·62S., 116° 48´·22E.
Delete depth, 182, close NW of: (a) above

2.38
Wk49/19
II
6189 INDONESIA - Kalimantan - Depths. (continued)

Chart 2639 (Panel C, Approaches to Balikpapan) [ previous update New Edition 13/06/2019 ] WGS84 DATUM
Insert depth, 51 (a) 1° 18´·60S., 116° 52´·29E.
Delete depth, 57, close SW of: (a) above
Insert depth, 48, enclosed by 5m contour (b) 1° 18´·14S., 116° 52´·10E.
Delete depth, 53, close E of: (b) above
Insert depth, 49, enclosed by 5m contour (c) 1° 17´·54S., 116° 52´·29E.
Delete depth, 55, close W of: (c) above
Insert depth, 61 (d) 1° 17´·30S., 116° 52´·99E.
Delete depth, 73, close N of: (d) above
Insert depth, 48, enclosed by 5m contour 1° 17´·73S., 116° 53´·15E.

6193 INDONESIA - Kalimantan - Wreck. Platform.


Source: ENC ID400017

Chart 2794 [ previous update New Edition 24/10/2019 ] WGS84 DATUM


Delete
¼{ 3° 38´·5S., 114° 29´·9E.

Chart 2795 [ previous update 5895/19 ] WGS84 DATUM


Delete
¼{ 3° 38´·5S., 114° 29´·9E.

Chart 3015 (Panel B, Banjarmasin) [ previous update New Edition 14/11/2019 ] WGS84 DATUM
Insert
´ 3° 20´·00S., 114° 33´·08E.

Chart 3015 (Panel A, Sungai Barito) [ previous update New Edition 14/11/2019 ] WGS84 DATUM
Insert
´ 3° 20´·00S., 114° 33´·08E.
Delete
¼{ 3° 38´·51S., 114° 29´·97E.

Chart 3029 [ previous update 5296/19 ] WGS84 DATUM


Delete
¼{ 3° 38´·5S., 114° 30´·0E.

6194 MALAYSIA - Sarawak - Platform.


Source: UKHO

Chart 2100 [ previous update New Edition 29/08/2019 ] WGS84 DATUM


Move
¼{ GOPB, from: 3° 20´·45N., 112° 47´·21E.
to: 3° 20´·50N., 112° 47´·02E.

2.39
Wk49/19
II

6203 INDONESIA - Jawa - Depths.


Source: ENC ID300079

Chart 918 (Panel A, Cirebon) [ previous update 5956/19 ] WGS84 DATUM


Insert depth, 68 6° 39´·36S., 108° 38´·17E.

Chart 3729 [ previous update 6167/19 ] WGS84 DATUM


Insert depth, 68 (a) 6° 39´·36S., 108° 38´·17E.
Delete depth, 85, close SE of: (a) above
Replace depth, 175, with depth, 161 6° 17´·36S., 108° 26´·79E.

Chart 3730 [ previous update 6167/19 ] WGS84 DATUM


Insert depth, 68 (a) 6° 39´·36S., 108° 38´·17E.
Delete depth, 85, close SE of: (a) above
Replace depth, 175, with depth, 161 6° 17´·36S., 108° 26´·79E.

6266 INDONESIA - Kalimantan - Depths. Wrecks.


Source: Indonesian Chart 259

Chart 1852 (Panel C, Lingkas) [ previous update 5921/19 ] WGS84 DATUM


Insert depth, 72, and extend 10m contour SW to enclose (a) 3° 16´·11N., 117° 36´·33E.
Delete depth, 123, close NW of: (a) above
Insert depth, 111 (b) 3° 16´·02N., 117° 35´·88E.
Delete depth, 12, close E of: (b) above
Insert depth, 102 (c) 3° 16´·02N., 117° 35´·69E.
Delete depth, 13, close W of: (c) above
Replace
^ with ´ 3° 17´·28N., 117° 34´·92E.
3° 17´·44N., 117° 34´·82E.

Chart 1852 (Panel B, Approaches to Lingkas and Bunyu) [ previous update 5921/19 ] WGS84 DATUM
Insert depth, 56, and extend 10m contour SE to enclose (a) 3° 15´·46N., 117° 35´·91E.
Delete depth, 11, close N of: (a) above
Insert depth, 111 (b) 3° 16´·02N., 117° 35´·88E.
Delete depth, 12, close N of: (b) above
Insert depth, 127 (c) 3° 15´·46N., 117° 36´·52E.
Delete depth, 127, close SW of: (c) above
Insert depth, 86, and extend 10m contour SW to enclose 3° 14´·86N., 117° 36´·95E.
Replace depth, 87, with depth, 77 3° 13´·73N., 117° 35´·15E.

Chart 1852 (Panel A, Tanjung Mangkapadie to Tawau) [ previous update 5921/19 ] WGS84 DATUM
Insert depth, 56, and extend 10m contour SE to enclose (a) 3° 15´·5N., 117° 35´·9E.
Delete depth, 11, close N of: (a) above

2.40
Wk49/19
II

6127 PAPUA NEW GUINEA - Miscellaneous corrections.


Source: Australian Notice 22/1141/19

Chart PNG 508 [ previous update 4057/19 ] WGS84 DATUM


Amend legend to, Adjoining Chart PNG 518 in N border at longitude 150° 42´·6E.

Chart Aus 513 [ previous update 5859/19 ] WGS84 DATUM


Amend legend to, Adjoining Chart PNG 518 in W border at latitude 9° 47´·5S.

Chart Aus 519 [ previous update 3080/19 ] WGS84 DATUM


Amend legend to, Adjoining Chart PNG 518 in S border at longitude 150° 05´·0E.

Chart 4620 (INT 620) [ previous update 4644/19 ] WGS84 DATUM


Amend legend to, PNG 518, centred on: 10° 07´·0S., 149° 48´·3E.

Chart 4621 (INT 621) [ previous update 5859/19 ] WGS84 DATUM


Amend legend to, PNG 518, centred on: 9° 17´·3S., 151° 01´·0E.

6207* SOUTH PACIFIC OCEAN - Fiji Islands - Depths.


Source: ms Island Sky

Chart 747 [ previous update 6055/19 ] WGS84 DATUM


Insert depth, 4, enclosed by 5m contour, Rep (2019) (a) 16° 51´·85S., 177° 27´·92E.
Delete depth, 42, close NE of: (a) above

Chart 748 [ previous update 1535/18 ] FIJI 1986 DATUM


Insert depth, 4, enclosed by 5m contour, Rep (2019) (a) 16° 51´·86S., 177° 27´·91E.
Delete depth, 42, close NE of: (a) above

6150 ANTARCTICA - Depth. Rock.


Source: ENC AR306110

Chart 1775 [ previous update 2521/17 ] UNDETERMINED DATUM


Insert depth, 7, enclosed by 10 fm contour 60° 38´·05S., 44° 31´·65W.

²ED 60° 22´·89S., 45° 00´·06W.

Chart 3200 [ previous update 5717/17 ] WGS84 DATUM


Insert
²ED 60° 22´·7S., 45° 00´·7W.

Chart 4213 [ previous update 358/16 ] WGS84 DATUM


Insert
²ED 60° 22´·7S., 45° 00´·7W.

2.41
Wk49/19
II

6201 BRAZIL - North Coast - Depths.


Source: Brazilian Chart 21200

Chart 520 [ previous update 4869/19 ] WGS84 DATUM


Insert depth, 86, and extend 100m contour NW to enclose 3° 01´·9N., 48° 33´·2W.
depth, 79 (a) 2° 55´·0N., 48° 27´·2W.
Delete depth, 95, close SE of: (a) above

Chart 3962 [ previous update 5964/19 ] WGS84 DATUM


Insert depth, 86, and extend 100m approximate contour NW to
enclose 3° 01´·9N., 48° 33´·2W.
depth, 79 (a) 2° 55´·0N., 48° 27´·2W.
Delete depth, 95, close SE of: (a) above

Chart 4216 (INT 407) [ previous update 4869/19 ] UNDETERMINED DATUM


Insert depth, 79 (a) 2° 55´·0N., 48° 27´·2W.
Delete depth, 95, close E of: (a) above

6238 BRAZIL - East Coast - Platform.


Source: Hydrolant 3372/19(24)

Chart 599 [ previous update 2564/19 ] WGS84 DATUM


Insert
¼{ 20° 24´·54S., 40° 06´·01W.

Chart 3972 [ previous update 5739/19 ] WGS84 DATUM


Insert
¼{ 20° 24´·5S., 40° 06´·0W.

6253 BRAZIL - East Coast - Wreck.


Source: Brazilian Notice 20/213/19

Chart 3978 [ previous update 3007/18 ] WGS84 DATUM


Insert
16#,Wk 8° 47´·4S., 35° 03´·6W.

6278 ARGENTINA - Light.


Source: Argentine Notice 11/123/19

Chart 3324 [ previous update 371/19 ] WGS84 DATUM


Amend light to, Mo(K)9s16m10M 37° 55´·6S., 57° 31´·5W.

Chart 3329 [ previous update 3435/19 ] WGS84 DATUM


Amend light to, Mo(K)9s16m10M 37° 55´·6S., 57° 31´·5W.

2.42
Wk49/19
II

6206* WEST INDIES - Turks and Caicos Islands - Depths.


Source: British Government Survey

Chart 468 (Panel, Grand Turk Terminal 1) [ previous update 2633/19 ] WGS84 DATUM
Insert depth, 14, and extend 2m approximate contour W to enclose 21° 26´·290N., 71° 09´·105W.
depth, 3 21° 26´·083N., 71° 09´·006W.

Chart 3001 [ previous update 3583/19 ] WGS84 DATUM


Replace depth, 17, with depth, 115 21° 20´·7N., 70° 57´·5W.
depth, 22, with depth, 168, and extend 20m contour E to
enclose 21° 10´·0N., 71° 10´·9W.

Chart 3907 (INT 4160) [ previous update 2773/19 ] WGS84 DATUM


Insert depth, 67, enclosed by 10m contour 21° 15´·3N., 71° 14´·6W.
depth, 98, enclosed by 10m contour 21° 09´·5N., 71° 17´·3W.
depth, 97, and extend 10m contour NE to enclose 21° 07´·8N., 71° 18´·2W.
depth, 118 (a) 21° 05´·3N., 71° 19´·0W.
Delete depth, 133, close N of: (a) above
Insert depth, 197, and extend 20m contour N to enclose 21° 03´·2N., 71° 19´·7W.
Replace depth, 198, with depth, 83, enclosed by 10m contour 21° 16´·2N., 71° 14´·3W.

6221* WEST INDIES - Turks and Caicos Islands - NM Block.


Source: British Government Survey

Chart 3908 (INT 4162) [ previous update 3583/19 ] WGS84 DATUM


Insert the accompanying block, centred on: 21° 12´·8N., 71° 08´·3W.

6234 UNITED STATES OF AMERICA - Gulf of Mexico - Buoy.


Source: US Coast Guard District 8 LNM 43/411/19

Chart 4012 (INT 12) [ previous update 4430/19 ] WGS84 DATUM


Move
PfFl(4)Y.20s ODAS 42002, from: 26° 04´·5N., 93° 46´·0W.
to: 26° 03´·3N., 93° 38´·8W.

Chart 4400 (INT 400) [ previous update 4430/19 ] WGS84 DATUM


Move
PfFl(4)Y.20s ODAS 42002, from: 26° 04´·5N., 93° 46´·1W.
to: 26° 03´·3N., 93° 38´·8W.

Chart 4401 (INT 401) [ previous update 5704/19 ] WGS84 DATUM


Move
PfFl(4)Y.20s ODAS 42002, from: 26° 05´·1N., 93° 46´·9W.
to: 26° 03´·3N., 93° 38´·8W.

2.43
Wk49/19
II

6267 WEST INDIES - Leeward Islands - Legend.


Source: St Christopher Air and Sea Ports Authority

Chart 487 (Panel D, Basseterre Bay) [ previous update 4635/19 ] WGS84 DATUM
Insert legend, Works in progress (2019), centred on: 17° 17´·35N., 62° 43´·49W.

6168 UNITED STATES OF AMERICA - East Coast - Obstruction.


Source: US Coast Guard District 5 LNM 44/12311/19

Chart 2603 (Panel 1) [ previous update 5885/19 ] NAD83 DATUM


Insert
45,Obstn 39° 31´·76N., 75° 33´·02W.

2.44
Wk49/19
II

6175(P)/19 ENGLAND - East Coast - Works. Wind farm. Buoyage. Restricted area.
Source: Partrac
1. Work is about to commence on the construction of the Triton Knoll Offshore Wind Farm. The site boundary will be marked
by light-buoys as follows:

Buoy Type Designation Characteristic Position


South Cardinal TK01 Q(6)+LFl.15s 53° 24´·05N., 0° 57´·93E.
Special Mark TK02 Fl.Y.5s 53° 24´·57N., 0° 54´·43E.
Special Mark TK03 Fl.Y.5s 53° 26´·13N., 0° 50´·01E.
Special Mark TK04 Fl.Y.5s 53° 27´·46N., 0° 45´·93E.
South Cardinal TK05 VQ(6)+LFl.10s 53° 28´·86N., 0° 41´·18E.
Special Mark TK06 Fl.Y.5s 53° 30´·81N., 0° 41´·83E.
North Cardinal TK07 Q 53° 32´·20N., 0° 44´·25E.
Special Mark TK08 Fl.Y.5s 53° 32´·44N., 0° 47´·68E.
North Cardinal TK09 VQ 53° 32´·43N., 0° 52´·04E.
Special Mark TK10 Fl.Y.5s 53° 29´·60N., 0° 55´·31E.
Special Mark TK11 Fl.Y.5s 53° 26´·98N., 0° 57´·97E.
East Cardinal TK12 Q(3)10s 53° 24´·37N., 1° 00´·23E.
2. Metocean buoys will be deployed in the following positions:

53° 26´·00N., 0° 55´·09E.


53° 30´·58N., 0° 47´·94E.
3. A safety zone of 500 metres becomes operational around the turbines under construction.
4. All vessels should navigate with caution in the area.
5. These changes will be included in the next New Editions of Charts 107, 1190 and 1503.
(ETRS89 DATUM)

Charts affected - 107 - 1190 (INT 1508) - 1503 (INT 1509)

6186(T)/19 SCOTLAND - East Coast - Buoy.


Source: Wick Harbour Authority
1. The port-hand lateral light-buoy, Fl(2)R.6s, in position 58° 26´·238N., 3° 04´·100W. is unlit.
(ETRS89 DATUM)

Chart affected - 1462

6271(P)/19 ENGLAND - South Coast - Maintained channels. Dredged areas. Depths. Works. Jetty.
Source: Queen’s Harbour Master, Portsmouth
1. There have been several changes to maintained depth areas within Portsmouth Harbour.
2. The maintained depth area in the Bedenham Approach Channel, centred on position 50° 48´·813N., 1° 07´·601W. , has
decreased from 8·5m to 7·5m and the limits of the maintained depth area have decreased in extent. The new maintained
depth area limit is bounded by the following positions:

50° 48´·935N., 1° 07´·823W.


50° 48´·967N., 1° 07´·777W.
50° 48´·880N., 1° 07´·618W.
50° 48´·638N., 1° 07´·270W.
50° 48´·619N., 1° 07´·319W.
50° 48´·610N., 1° 07´·370W.

2.45
Wk49/19
II
6271(P)/19 ENGLAND - South Coast - Maintained channels. Dredged areas. Depths. Works. Jetty. (continued)
3. The limits of the maintained depth area at Royal Clarence Yard on the North side of the Oil Fuel Jetty, centred on position
50° 48´·039N., 1° 07´·091W. , have decreased in extent and are now bounded by the following positions:

50° 48´·061N., 1° 07´·205W.


50° 48´·062N., 1° 07´·000W.
50° 48´·011N., 1° 06´·976W.
50° 48´·004N., 1° 07´·029W.
50° 48´·010N., 1° 07´·095W.
50° 48´·028N., 1° 07´·209W.
4. The following maintained depth areas in Bedenham Approach Channel, Royal Clarence Yard and Haslar Lake are no longer
maintained and depths in these areas may be significantly less than charted:

Maintained depth area Centred on position Former Maintained depth


Turning Circle 50° 48´·731N., 1° 07´·327W. 7·5m
East Jetty 50° 48´·052N., 1° 07´·276W. 4·0m
No 1 Jetty Boat Pool 50° 47´·430N., 1° 06´·866W. 1·5m
Petrol Pier Outer 50° 47´·322N., 1° 06´·987W. 3·0m
Petrol Pier South Side 50° 47´·301N., 1° 07´·043W. 4·5m
5. The following maintained depth areas within Haslar Lake have been amended as follows:

Maintained depth area Centred on position Former Maintained New Maintained


depth depth
No 1 Jetty 50° 47´·435N., 1° 06´·935W. 6·0m 4·0m
Petrol Pier North Side 50° 47´·331N., 1° 07´·047W. 5·0m 4·0m
Approaches to Hornet SC 50° 47´·367N., 1° 07´·182W. 3·0m 2·5m
6. Bridge and dolphin construction works are taking place in the entrance to North Camber, centred on position
50° 48´·045N., 1° 06´·697W.
7. *Works to extend berth No 2 are currently underway within the following area

50° 48´·658N., 1° 05´·675W.


50° 48´·631N., 1° 05´·796W.
50° 48´·640N., 1° 05´·799W.
50° 48´·654N., 1° 05´·727W.
8. Jetty construction works are taking place along South Camber, centred on position 50° 47´·934N., 1° 06´·601W.
9. Mariners are advised to navigate with caution in the area and to contact the local Port Authority for the latest information.
10. Charts will be updated when full details are available.
11. Former Notice 3148(P)/19 is cancelled.
*Indicates new or revised information.
(ETRS89 DATUM)

Charts affected - 2625 - 2628 - 2629 - 2631 (INT 1732)

6220(P)/19 FØROYAR - Depths. Restricted area. Works. Light.


Source: Danish Chart Correction 43/534/19
1. Significant changes to charted detail have taken place at Torshavn (Thorshavn).
2. Depths of 6·5m to 9·4m exist along Eystari Moli, between positions 62° 00´·18N., 6° 46´·07W. and
62° 00´·38N., 6° 45´·86W. Fenders are available to hold vessels 3·5m away from the quay, where there are depths of 7·0m
to 9·7m.

2.46
Wk49/19
II
6220(P)/19 FØROYAR - Depths. Restricted area. Works. Light. (continued)
3. *The charted maritime limit joining the following positions has been replaced by a restricted area limit:

Position Remarks
62° 00’ .44N. , 6° 45’ .72W.
62° 00’ .33N. , 6° 45’ .27W.
62° 00’ .11N. , 6° 45’ .41W.
* 61° 59’ .91N. , 6° 45’ .74W. lateral light-buoy Fl.G.3s
62° 00’ .18N. , 6° 46’ .07W.
4. Extensive land reclamation has taken place within the area above. Reclamation works remain ongoing.
5. Light, F.G (15.7.-1.6.), in position 62° 00´·17N., 6° 45´·98W. has been moved to position 62° 00´·18N., 6° 46´·05W.
6. Mariners are advised to consult the local port authority for the latest information.
7. These changes will be included in the next New Edition of Chart 3569.
8. Former Notice 3503(P)/19 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)

Chart affected - 3569

6210(T)/19 NETHERLANDS - Traffic separation scheme.


Source: Netherlands Notice 45/394(T)/19
1. Vessels with a length greater than 300m and a beam greater than 40m navigating within TSS Terschelling-German Bight
(53° 40´·81N., 5° 47´·87E.) during heavy weather conditions and seas with a wave height above 5m are at risk of
grounding.
2. Mariners are recommended to navigate an alternative route via TSS East Friesland (54° 04´·93N., 5° 21´·06E.)
(WGS84 DATUM)

Charts affected - 1631 (INT 1418) - 1632 (INT 1420) - 1633 (INT 1417) - 2182A (INT 1043) - 2182B (INT 1042) -
DE 50 (INT 1045) - DE 87 (INT 1413)

2.47
Wk49/19
II

6214(T)/19 NETHERLANDS - Fairways. Restricted areas. Precautionary area. Submarine cable.


Source: Netherlands Notice 45/391(T)/19
1. Fishing is prohibited within the Westerschelde fairways and the Rede Van Vlissingen precautionary area West of longitude
3° 42´·87E. and East of longitude 3° 31´·28E. with the exception of fairways Vaarwater langs Hoofdplaat and Vaarwater
langs de Paulinapolder.
2. Fishing and anchoring are prohibited within an area 500m either side of the charted cable joined by the following positions:

51° 25´·58N., 3° 43´·18E.


51° 25´·22N., 3° 43´·01E.
51° 24´·95N., 3° 42´·11E.
51° 25´·17N., 3° 41´·40E.
51° 25´·15N., 3° 40´·35E.
51° 25´·35N., 3° 39´·27E.
51° 25´·47N., 3° 37´·25E.
51° 25´·40N., 3° 35´·95E.
51° 25´·59N., 3° 35´·22E.
51° 25´·48N., 3° 32´·65E.
51° 28´·25N., 3° 29´·18E.
51° 31´·92N., 3° 21´·77E.
51° 32´·96N., 3° 20´·42E.
51° 34´·71N., 3° 16´·83E.
51° 35´·90N., 3° 12´·74E.
51° 37´·37N., 3° 11´·62E.
51° 40´·49N., 3° 07´·88E.
51° 41´·75N., 3° 04´·30E.
51° 42´·15N., 3° 03´·63E.
3. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
(WGS84 DATUM)

Charts affected - 110 (INT 1473) - 116 (INT 1477) - 120 (INT 1479) - 1872 - 1874 (INT 1474) - 8011 - 8012

6156(P)/19 FRANCE - West Coast - Submarine cable.


Source: French Notice 44/50/19
1. A submarine cable exists joining the following positions:

48° 21´·952N., 4° 31´·458W.


48° 21´·887N., 4° 31´·448W.
48° 21´·782N., 4° 31´·296W.
48° 21´·706N., 4° 31´·245W.
48° 21´·022N., 4° 31´·012W.
48° 20´·912N., 4° 31´·082W.
48° 20´·861N., 4° 31´·171W.
2. This change will be included in a New Edition of Chart 3428 to be published late 2019.
(WGS84 DATUM)

Chart affected - 3428 (INT 1833)

2.48
Wk49/19
II

6213(P)/19 TURKEY - South Coast - Anchorage areas.


Source: Turkish Notice 43/205/19
1. The limits of No 1 and No 2 Anchorages in Mersin Körfezi have been amended as follows.

No 1
36° 40´·00N., 34° 35´·00E.
36° 41´·00N., 34° 35´·00E.
36° 46´·00N., 34° 38´·00E.
36° 46´·00N., 34° 39´·33E.
36° 40´·00N., 34° 39´·33E.
No 2
36° 44´·00N., 34° 42´·67E.
36° 44´·00N., 34° 46´·67E.
36° 40´·00N., 34° 46´·67E.
36° 40´·00N., 34° 42´·67E.
2. Mariners are advised to contact the local port authority for further information.

Chart affected - 8119

2.49
Wk49/19
II

6263(P)/19 SPAIN - Islas Baleares - Anchorage areas. Restricted area. Anchor berth.
Port development.
Source: Spanish Notice 44/347/19
1. New anchorage areas have been established in the approaches to Palma, Mallorca, bounded by the following positions:

Non-Dangerous Cargoes
39° 33´·02N., 2° 38´·93E.
39° 33´·02N., 2° 40´·17E.
39° 32´·72N., 2° 40´·83E.
39° 32´·33N., 2° 40´·83E.
39° 32´·33N., 2° 40´·55E.
39° 32´·39N., 2° 40´·58E.
39° 32´·47N., 2° 40´·28E.
39° 32´·33N., 2° 40´·02E.
39° 32´·33N., 2° 38´·93E.
Dangerous Cargoes
39° 32´·33N., 2° 38´·93E.
39° 32´·33N., 2° 40´·02E.
39° 32´·21N., 2° 39´·80E.
39° 31´·98N., 2° 40´·08E.
39° 31´·95N., 2° 40´·41E.
39° 32´·33N., 2° 40´·55E.
39° 32´·33N., 2° 40´·83E.
39° 31´·96N., 2° 40´·83E.
39° 31´·66N., 2° 40´·28E.
39° 31´·66N., 2° 38´·93E.
Small Craft
39° 33´·02N., 2° 39´·10E.
39° 33´·82N., 2° 39´·10E.
39° 33´·08N., 2° 41´·10E.
39° 32´·72N., 2° 40´·83E.
39° 33´·02N., 2° 40´·17E.
2. A restricted area, anchoring prohibited, has been established within the above anchorage areas bounded by the following
positions:

39° 32´·21N., 2° 39´·80E.


39° 32´·47N., 2° 40´·28E.
39° 32´·39N., 2° 40´·58E.
39° 31´·95N., 2° 40´·41E.
39° 31´·98N., 2° 40´·08E.
3. The former anchorage area, Dangerous Cargoes, centred on position 39° 32´·40N., 2° 39´·54E. has been discontinued.
4. Anchor berth A, for nuclear vessels, has been moved from position 39° 31´·97N., 2° 39´·93E. to position
39° 31´·93N., 2° 39´·93E.
5. A new port limit has been established joining the following positions:

39° 31´·66N., 2° 35´·22E.


39° 31´·66N., 2° 40´·28E.
39° 31´·96N., 2° 40´·83E.
39° 32´·72N., 2° 40´·83E.
39° 33´·19N., 2° 41´·17E.
6. Anchoring is only permitted within designated anchorage areas.
7. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
8. These changes will be included in New Editions of Charts 3034 and 3035 to be published early 2020. Chart 2832 will
be updated by Notice to Mariners.
(WGS84 DATUM)

Charts affected - 3034 - 3035

2.50
Wk49/19
II

6179(P)/19 MAURITANIA - Works. Spoil grounds.


Source: French Notice 47/5(P)/19
1. Dredging works are taking place in the approach channel to Port Mineralier de Cansado, along a line joining the following
positions:

20° 49´·37N., 17° 01´·74W.


20° 45´·70N., 17° 02´·44W.
20° 43´·27N., 17° 01´·57W.
20° 39´·62N., 17° 04´·29W.
20° 38´·65N., 17° 07´·52W.
2. Two spoil grounds have been established for the associated dredging works within areas bounded by the following
positions:

20° 42´·87N., 16° 59´·33W.


20° 42´·89N., 16° 57´·60W.
20° 41´·54N., 16° 57´·58W.
20° 41´·52N., 16° 59´·31W.
and

20° 38´·53N., 17° 03´·83W.


20° 38´·54N., 17° 02´·39W.
20° 37´·17N., 17° 02´·39W.
20° 37´·17N., 17° 03´·81W.
3. Mariners are advised to navigate with caution in the area.
4. Charts will be updated when full details are available.
(WGS84 DATUM)

Charts affected - 1661 (INT 1951) - 1690 - 1699

6161(P)/19 TANZANIA - Buoyage. Light-beacons. Works.


Source: Tanzania Ports Authority
1. The following light-buoys have been established or amended in the approaches to Tanga:

Designation Position Comments


No 1 5° 03´·75S., 39° 13´·30E. New position
No 2 5° 03´·94S., 39° 12´·40E. New position
No 3 5° 02´·27S., 39° 12´·60E. New buoy
No 4 5° 03´·54S., 39° 11´·99E. Replaces Niule light-beacon
No 5 5° 02´·443S., 39° 09´·879E. Replaces Ulenge Reef light-beacon
No 6 5° 03´·481S., 39° 09´·458E. Replaces Dixon Bank buoy
No 7 5° 02´·27S., 39° 08´·86E. New buoy
No 8 5° 02´·874S., 39° 08´·696E. Replaces No 2 buoy
No 9 5° 02´·482S., 39° 07´·817E. Replaces Kwawa light-beacon
No 10 5° 03´·019S., 39° 07´·139E. Replaces Raskazone North red buoy
No 11 5° 03´·221S., 39° 06´·857E. Replaces Tanga East buoy
2. Dredging works are taking place within Tanga port, within an area bounded by the following positions:

5° 03´·585S., 39° 05´·936E.


5° 03´·504S., 39° 06´·221E.
5° 03´·521S., 39° 06´·490E.
5° 03´·221S., 39° 06´·857E.
5° 02´·899S., 39° 07´·010E.
5° 03´·011S., 39° 07´·256E.
5° 03´·581S., 39° 06´·930E.
5° 03´·917S., 39° 06´·153E.

2.51
Wk49/19
II
6161(P)/19 TANZANIA - Buoyage. Light-beacons. Works. (continued)
3. Mariners are advised to navigate with caution in the area.
4. Chart 663 will be updated when full details are available.
(WGS84 DATUM)

Chart affected - 663 (INT 7698)

6162(T)/19 QATAR - Buoy.


Source: MENAS Notice 324/19
1. A waverider buoy has been deployed in position 26° 35´·91N., 51° 58´·21E.
2. Mariners are advised to navigate with caution in the area.
3. Former Notice 5224(T)/19 is cancelled.
(WGS84 DATUM)

Chart affected - 2523 (INT 7250)

6182(P)/19 UNITED ARAB EMIRATES - Restricted area.


Source: Dubai Maritime City Authority

Update Feature Position


Delete circular limit of restricted area, entry 25° 07´·87N., 55° 06´·98E.
prohibited, pecked line, radius 2·5M,
centred on:

Chart affected - 8054

2.52
Wk49/19
II

6149(P)/19 CHINA - Yellow Sea Coast - Anchorage areas. Buoyage.


Source: Chinese Notices 42/1348-1351/19
1. The limits and designations of anchorage areas No 1 – No 5 have been amended as follows:

No 1
35° 23´·15N., 119° 39´·45E.
35° 21´·20N., 119° 44´·16E.
35° 17´·92N., 119° 42´·14E.
35° 19´·87N., 119° 37´·43E.
No 2
35° 19´·05N., 119° 49´·33E.
35° 17´·71N., 119° 52´·57E.
35° 14´·43N., 119° 50´·54E.
35° 15´·77N., 119° 47´·31E.
No 3 Quarantine
35° 17´·15N., 119° 37´·73E.
35° 15´·19N., 119° 42´·44E.
35° 13´·26N., 119° 41´·25E.
35° 15´·21N., 119° 36´·54E.
No 4 Fumigating and Tank Cleaning
35° 15´·19N., 119° 42´·44E.
35° 14´·71N., 119° 43´·61E.
35° 12´·78N., 119° 42´·42E.
35° 13´·26N., 119° 41´·25E.
No 5
35° 14´·71N., 119° 43´·61E.
35° 13´·12N., 119° 47´·44E.
35° 11´·19N., 119° 46´·24E.
35° 12´·78N., 119° 42´·42E.
2. Special mark light-buoys, Mo(Q)Y.12s, have been moved to the following positions:

Designation Former Position New Position


M1 35° 16´·73N., 119° 50´·90E. 35° 17´·72N., 119° 52´·62E.
M2 35° 19´·86N., 119° 43´·37E. 35° 21´·21N., 119° 44´·21E.
M3 35° 21´·81N., 119° 38´·66E. 35° 23´·16N., 119° 39´·50E.
M4 35° 12´·30N., 119° 43´·64E. 35° 11´·20N., 119° 46´·29E.
3. These changes will be included in New Editions of Charts 806, 1501, 1201 to be published early 2020.
(CGCS 2000 DATUM)

Charts affected - 806 - 1201 - 1501 - 8167 - 8168

6157(T)/19 CHINA - Yellow Sea Coast - Buoyage. Virtual aid to navigation.


Source: Chinese HO, mv Umm Qarn and Chinese Notice 42/1382(T)/19
1. It has been reported that the port-hand lateral light-buoys marking Huangdao Qianwan (36° 00´·768N., 120° 13´·301E. )
have been temporarily removed.
2. The north cardinal light-buoy, Q AN, in position 36° 01´·705N., 120° 15´·273E. is reported as temporarily moved to
position 36° 01´·690N., 120° 15´·430E.
3. * A virtual aid to navigation (V-AIS), starboard lateral topmark, has been established in position
36° 01´·495N., 120° 14´·135E.
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
5. Former Notice 2341(T)/18 is cancelled.
* Indicates new or revised entry.
(CGCS 2000 DATUM)

Charts affected - 1505 - 1506 - 8152

2.53
Wk49/19
II

6180(P)/19 CHINA - South Coast - Buoyage.


Source: Chinese Notice 42/1354/19
1.

Update Feature Position


Insert green red gren pillar light-buoy, with topmark, 21° 52´·39N., 113° 12´·50E.
cone point up, Y1
Delete former green red green pillar light-buoy, with 21° 53´·12N., 113° 11´·99E.
topmark, cone point up, Y1

Chart affected - 8114

6208(P)/19 CHINA - South Coast - Port developments. Reclamation area.


Source: Chinese Chart 16561
1. Extensive port developments have taken place within Shentou Gangqu, including changes to coastline, new piers and land
reclamation in an area approximately bounded by the following positions:

19° 49´·32N., 109° 10´·86E.


19° 50´·07N., 109° 09´·56E.
19° 47´·75N., 109° 08´·10E.
19° 45´·19N., 109° 09´·32E.
19° 45´·47N., 109° 09´·98E.
2. Extensive land reclamation has taken place between Zhaiji and Paipu, within an area approximately bounded by the
following positions:

19° 41´·30N., 109° 12´·65E.


19° 41´·79N., 109° 11´·28E.
19° 39´·77N., 109° 08´·54E.
19° 38´·57N., 109° 08´·90E.
3. There have been changes to the positions of pilot boarding places throughout the approaches to Yangpu.
4. Mariners are advised to navigate with caution in the area and to contact the local port authority for the latest information.
5. These changes will be included in a New Edition of Chart 54 to be published early 2020.
(CGCS 2000 DATUM)

Chart affected - 54

2.54
Wk49/19
II

6215(P)/19 CHINA - East Coast - Note.


Source: Chinese Chart 13179
1. Updated Section: ANCHORAGES Text Box, River Anchorages
Replace:
• Nangang Shuidao

Anchorage Position Remarks


No 5 31° 22´·90N., 121° 37´·60E. 7 to 13m
No 6 31° 23´·30N., 121° 36´·70E. 6 to 14m
No 7 31° 23´·70N., 121° 35´·80E. 4 to 16m
No 8 31° 24´·00N., 121° 34´·90E. 2 to 16m. Only anchorages available for
ships in international trade. Maximum
stay 72 hours.
No 9 31° 24´·35N., 121° 34´·00E. 2 to 15m. Only anchorages available for
ships in international trade. Maximum
stay 72 hours. Obstruction, position
approximate, in NE part of anchorage.
An isolated 1·7m depth lies in the NW
part of the anchorage.
No 10 31° 24´·75N., 121° 32´·95E. 1 to 15m
No 11 31° 25´·30N., 121° 31´·70E. 1 to 11m
With:
• Nangang Shuidao

Anchorage Position Remarks


No 5 31° 22´·90N., 121° 37´·60E. 7 to 13 m
No 6 31° 23´·30N., 121° 36´·70E. 5 to 16 m
No 7 31° 23´·70N., 121° 35´·80E. 2 to 16 m. A shoal extends into the N
part of the anchorage.
No 8 31° 24´·00N., 121° 34´·90E. 1 to 16 m. Only anchorages available for
ships in international trade. Maximum
stay 72 hours.
No 9 31° 24´·35N., 121° 34´·00E. 1 to 15 m. Only anchorages available for
ships in international trade. Maximum
stay 72 hours. Obstructions lie in the E
and W of the area.
No 10 31° 24´·75N., 121° 32´·95E. 2 to 15 m
No 11 31° 25´·30N., 121° 31´·70E. 1 to 11 m

Chart affected - 8124

6223(T)/19 VIETNAM - Buoy.


Source: VMS-North Notice 251(T)/19
1. The Isolated danger light-buoy, Fl(2)5s, in position 17° 50´·8N., 106° 36´·0E. is out of service.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Chart affected - 3989

2.55
Wk49/19
II

6233(P)/19 CHINA - East Coast - Depths. Works.


Source: Chinese Chart 14181
1. Numerous depths less than charted exist within Quanzhou Gang. The most significant are as follows:

Depth Position
4·9m 24° 48´·11N., 118° 46´·67E.
4·4m 24° 48´·69N., 118° 45´·23E.
3·4m 24° 50´·27N., 118° 42´·10E.
2·3m 24° 52´·99N., 118° 41´·24E.
2·3m 24° 53´·23N., 118° 41´·07E.
2·9m 24° 53´·32N., 118° 40´·98E.
1·8m 24° 53´·37N., 118° 40´·92E.
2. Works have been completed in the vicinity of the following positions:

24° 51´·35N., 118° 45´·64E.


24° 50´·90N., 118° 45´·59E.
3. These changes will be included in a New Edition of Chart 1737 to be published early 2020.
(CGCS 2000 DATUM)

Chart affected - 1737

6237(P)/19 TAIWAN - Depths. Restricted areas. Anchorage area. Wrecks. Virtual aids to navigation. Buoyage.
Breakwater.
Source: UKHO
1. There are significant changes to depths and alongside depths within the Port of Kao-Hsiung. The most significant are as
follows:

Depth Position
11.8m 22° 33´·43N., 120° 19´·59E.
13.7m 22° 32´·97N., 120° 19´·39E.
13.9m 22° 32´·74N., 120° 19´·59E.
12.8m 22° 32´·55N., 120° 19´·75E.
6.9m 22° 32´·70N., 120° 20´·72E.
4.4m 22° 36´·99N., 120° 17´·46E.
2. Turning areas have been established in the following positions:

Radius Position
200m 22° 36´·79N., 120° 16´·67E.
450m 22° 32´·68N., 120° 20´·04E.
3. The limits of anchorage, No 4, has been amended to the following positions:

22° 31´·57N., 120° 14´·32E.


22° 30´·50N., 120° 14´·98E.
22° 31´·56N., 120° 17´·98E.
22° 32´·63N., 120° 17´·17E.
22° 32´·10N., 120° 15´·82E.
4. A restricted area, entry prohibited, has been established joining the coastline and the following position:

22° 32´·86N., 120° 17´·91E.


22° 32´·67N., 120° 17´·30E.
22° 32´·14N., 120° 17´·73E.

2.56
Wk49/19
II
6237(P)/19 TAIWAN - Depths. Restricted areas. Anchorage area. Wrecks. Virtual aids to navigation. Buoyage.
Breakwater. (continued)
5. Wrecks have been identified in the following positions:

Known depth Position


1.2m 22° 35´·54N., 120° 16´·57E.
24m 22° 31´·47N., 120° 16´·37E.
6. Virtual Aids to Navigation, with X-shape topmarks, V-AIS, exist in the following positions

22° 37´·63N., 120° 13´·37E.


22° 37´·86N., 120° 12´·31E.
22° 32´·63N., 120° 15´·86E.
22° 32´·31N., 120° 14´·19E.
7. Light-buoys have been withdrawn from following positions:

22° 37´·61N., 120° 13´·37E.


22° 37´·85N., 120° 12´·33E.
22° 32´·58N., 120° 15´·62E.
22° 32´·30N., 120° 13´·18E.
8. A breakwater has been constructed joining the following positions:

22° 33´·26N., 120° 16´·44E.


22° 33´·01N., 120° 16´·38E.
9. These changes will be included in the New Editions of Chart 2376, Chart 3230 published early 2020.
10. Charts 2409, 3232 and 4410 will be updated by Notice to Mariners.
11. Former Notices 3942(T)/16 and 4307(T)/16 are cancelled.
(WGS84 DATUM)

Charts affected - 2376 - 3230 - 8053

2.57
Wk49/19
II

6240(P)/19 CHINA - East Coast - Note.


Source: Chinese Chart 13179
1. Updated Section: ANCHORAGES Text Box, Nangang Shuidao
Replace:

Nangang Shuidao
Anchorage Position Remarks
No 5 31° 22´·90N., 121° 37´·60E. 7 to 13m
No 6 31° 23´·30N., 121° 37´·60E. 6 to 14m
No 7 31° 23´·70N., 121° 35´·80E. 4 to 16m
No 8 31° 24´·00N., 121° 34´·90E. 2 to 16m. Only anchorages available for ships
in international trade. Maximum stay 72
hours. A dangerous wreck, position
approximate, is reported to exist in the SW
part of the anchorage.
No 9 31° 24´·35N., 121° 34´·00E. 2 to 15m. Only anchorages available for ships
in international trade. Maximum stay 72
hours. Obstruction, position approximate, in
NE part of anchorage. An isolated 1·7m depth
lies in the NW part of the anchorage.
No 10 31° 24´·75N., 121° 32´·95E. 1 to 15m
No 11 31° 25´·30N., 121° 31´·70E. 1 to 11m

With:

Nangang Shuidao
Anchorage Position Remarks
No 5 31° 22´·90N., 121° 37´·60E. 7 to 13m
*No 6 31° 23´·30N., 121° 36´·70E. 5 to 16m
*No 7 31° 23´·70N., 121° 35´·80E. 2 to 16m. A shoal extends into the N part of
the anchorage.
*No 8 31° 24´·00N., 121° 34´·90E. 1 to 16m. Only anchorages available for
ships in international trade. Maximum stay
72 hours.
*No 9 31° 24´·35N., 121° 34´·00E. 1 to 15m. Only anchorages available for
ships in international trade. Maximum stay
72 hours. Obstructions lie in the E and W of
the area.
*No 10 31° 24´·75N., 121° 32´·95E. 2 to 15m
No 11 31° 25´·30N., 121° 31´·70E. 1 to 11m
*indicates new or revised entry

Chart affected - 8125

2.58
Wk49/19
II

6252(P)/19 CHINA - East Coast - Note.


Source: Chinese Chart 13179
1. Updated Section: ANCHORAGES Text Box, Nangang Shuidao
Replace:

• Nangang
Shuidao
Anchorage Position Remarks
No 1 31°21´·21N 121°41´·00E 3 to 11m. Attention should be paid to shallow points 5·9, 2·6 and
4·0m in the central and NE parts of anchorage.
No 2 31°21´·60N 121°40´·20E 8 to 11m.
No 3 31°22´·00N 121°39´·40E 8 to 12m.
No 4 31°22´·40N 121°38´·50E 7 to 12m. An obstruction (9·2m) lies in the SW corner.
No 5 31°22´·90N 121°37´·60E 7 to 13m.
No 6 31°23´·30N 121°36´·70E 6 to 14m.
No 7 31°23´·70N 121°35´·80E 4 to 16m.
No 8 31°24´·00N 121°34´·90E 2 to 16m. Only anchorages available for ships in international
trade. Maximum stay 72 hours.
No 9 31°24´·35N 121°34´·00E 2 to 15m. Only anchorages available for ships in international
trade. Maximum stay 72 hours. Obstruction, position
approximate, in NE part of anchorage. An isolated 1·7m depth
lies in the NW part of the anchorage.
No 10 31°24´·75N 121°32´·95E 1 to 15m.
No 11 31°25´·30N 121°31´·70E 1 to 11m.
With:

• Nangang
Shuidao
Anchorage Position Remarks
*No 1 31° 21´·21N., 121° 41´·00E. 4 to 10 m. A shoal depth of 4.4 m lies in the NE part of anchorage.
An obstruction lies in the centre of the anchorage.
*No 2 31° 21´·60N., 121° 40´·20E. 8 to 11 m. A dangerous wreck (31° 21´·68N., 121° 40´·57E.),
position approximate, reported (2018), lies within the anchorage.
No 3 31° 22´·00N., 121° 39´·40E. 8 to 12 m
*No 4 31° 22´·40N., 121° 38´·50E. 8 to 13 m
No 5 31° 22´·90N., 121° 37´·60E. 7 to 13 m
*No 6 31° 23´·30N., 121° 36´·70E. 5 to 16 m
*No 7 31° 23´·70N., 121° 35´·80E. 2 to 16 m. A shoal extends into the N part of the anchorage.
*No 8 31° 24´·00N., 121° 34´·90E. 1 to 16 m. Only anchorages available for ships in international
trade. Maximum stay 72 hours.
*No 9 31° 24´·35N., 121° 34´·00E. 1 to 15 m. Only anchorages available for ships in international
trade. Maximum stay 72 hours. Obstructions lie in the E and W of
the area.
*No 10 31° 24´·75N., 121° 32´·95E. 2 to 15 m
No 11 31° 25´·30N., 121° 31´·70E. 1 to 11 m
(* indicates new or revised entry)

Chart affected - 8126

2.59
Wk49/19
II

6257(T)/19 CHINA - East Coast - Works. Restricted area.


Source: Chinese Notice 43/1414(T)/19
1. Reef removal operations are taking place within an area bounded by the following positions:

30° 30´·93N., 122° 18´·96E.


30° 30´·34N., 122° 20´·78E.
30° 29´·58N., 122° 19´·85E.
30° 30´·27N., 122° 18´·08E.
2. Explosives will be used to clear the reefs.
3. Vessels should monitor VHF Channel 16.
4. Navigation and anchoring is prohibited within this area and passing vessels should keep 500m clear of the operation areas.
5. Diving operations are prohibited within 1500m of the area.
(CGCS 2000 DATUM)

Chart affected - 1306

6269(P)/19 CHINA - South Coast - Buoy.


Source: Hong Kong Notice 22/49/19
1. The green conical buoy, Fl(3)G.10s No 3, in position 22° 26´·632N., 113° 53´·452E. has moved to position
22° 26´·605N., 113° 53´·540E.
2. These changes will be included in the next New Edition of Chart 4124.
(CGCS 2000 DATUM)

Chart affected - 4124

6136(T)/19 JAPAN - Hokkaidō - Depths.


Source: Japanese Notice 44/5495(T)/19
1. Depths of 0·5m to 1·5m less than charted exist on and in the vicinity of a line joining the following positions:

42° 59´ 13·9"N., 144° 21´ 37·2"E.


42° 59´ 19·3"N., 144° 21´ 39·0"E.
2. Depths of 0·5m to 1m less than charted exist within an area bounded by the following positions:

42° 59´ 25·8"N., 144° 21´ 39·8"E.


42° 59´ 25·3"N., 144° 21´ 38·7"E.
42° 59´ 21·9"N., 144° 21´ 40·9"E.
42° 59´ 23·3"N., 144° 21´ 42·5"E.
(WGS84 DATUM)

Chart affected - JP 31

2.60
Wk49/19
II

6137(T)/19 JAPAN - Honshū - Restricted area.


Source: Japanese Notice 44/5498(T)/19
1. A restricted area, entry prohibited, marking a wreck with a depth of 13m, has been established, bounded by the following
positions:

35° 28´ 54"N., 139° 47´ 43"E.


35° 28´ 59"N., 139° 47´ 51"E.
35° 28´ 52"N., 139° 47´ 57"E.
35° 28´ 47"N., 139° 47´ 49"E.
(WGS84 DATUM)

Charts affected - JP 67 - JP 1061 - JP 1062

6138(T)/19 JAPAN - Honshū - Works.


Source: Japanese Notice 44/5499(T)/19
1. Groyne construction works are taking place, until 31 December 2019, within an area bounded by the following positions:

35° 29´ 22·3"N., 139° 45´ 22·5"E.


35° 29´ 15·0"N., 139° 45´ 27·2"E.
35° 29´ 26·2"N., 139° 45´ 53·1"E.
35° 29´ 33·9"N., 139° 45´ 48·3"E.
(WGS84 DATUM)

Chart affected - JP 67

6139(P)/19 JAPAN - Honshū - Restricted area.


Source: Japanese Notice 44/5500(P)/19
1. The restricted area, Area Prohibited from lying at Anchor, has been amended as follows:

35° 26´ 34·0"N., 139° 42´ 07·7"E.


35° 26´ 19·4"N., 139° 41´ 49·9"E.
35° 25´ 23·1"N., 139° 43´ 22·6"E.
35° 25´ 39·1"N., 139° 43´ 38·5"E.
2. These changes will be included in a New Edition of Charts JP66 and JP1085 to be published 28 November 2019.
3. Charts JP1061, JP1062 and JP5510 will be updated by Notice to Mariners.
(WGS84 DATUM)

Charts affected - JP 66 - JP 1061 - JP 1062 - JP 1085 - JP 5510

2.61
Wk49/19
II

6140(P)/19 JAPAN - Honshū - Restricted area. Works.


Source: Japanese Notice 44/5501(P)/19
1. A restricted area, entry prohibited, has been established, bounded by the following positions:

35° 25´ 52·8"N., 139° 41´ 14·9"E.


35° 25´ 51·0"N., 139° 41´ 19·1"E.
35° 26´ 06·4"N., 139° 41´ 49·6"E.
35° 26´ 12·8"N., 139° 41´ 55·7"E.
35° 26´ 30·7"N., 139° 41´ 27·5"E.
35° 26´ 24·2"N., 139° 41´ 21·3"E.
2. Wharf construction works are taking place within the area above.
3. This change will be included in a New Edition of Chart JP66, to be published 28 November 2019.
4. Charts JP1061, JP1062 and JP90 will be updated by Notice to Mariners.
(WGS84 DATUM)

Charts affected - JP 66 - JP 90 - JP 1061 - JP 1062

6141(T)/19 JAPAN - Honshū - Depths.


Source: Japanese Notice 44/5505(T)/19
1. Depths less than charted exist in the following positions:

Depth Position
9·8m 34° 54´ 49·5"N., 136° 58´ 12·3"E.
9·7m 34° 54´ 42·2"N., 136° 58´ 23·9"E.
(WGS84 DATUM)

Chart affected - JP 1056

6142(T)/19 JAPAN - Seto Naikai - Works.


Source: Japanese Notice 44/5506(T)/19
1. Dredging works are taking place, until 31 January 2020, within an area bounded by the following positions:

33° 51´ 49·3"N., 135° 09´ 11·2"E.


33° 51´ 54·4"N., 135° 09´ 08·8"E.
33° 51´ 55·9"N., 135° 09´ 13·1"E.
33° 51´ 59·2"N., 135° 09´ 11·5"E.
33° 51´ 55·2"N., 135° 08´ 59·6"E.
33° 51´ 46·7"N., 135° 09´ 03·7"E.
(WGS84 DATUM)

Chart affected - JP 77

2.62
Wk49/19
II

6143(T)/19 JAPAN - Seto Naikai - Works.


Source: Japanese Notice 44/5507(T)/19
1. Magnetic survey and dredging works are taking place, until 31 January 2020, within an area bounded by the following
positions:

33° 57´ 09·0"N., 130° 57´ 17·1"E.


33° 57´ 19·9"N., 130° 57´ 26·9"E.
33° 57´ 21·9"N., 130° 57´ 23·8"E.
33° 57´ 21·8"N., 130° 57´ 22·7"E.
33° 57´ 16·8"N., 130° 57´ 16·4"E.
33° 57´ 13·9"N., 130° 57´ 13·8"E.
33° 57´ 11·4"N., 130° 57´ 12·8"E.
(WGS84 DATUM)

Charts affected - JP 135 - JP 1262 - JP 1263

6200(P)/19 RUSSIA - Pacific Ocean Coast - Coastline. Legend.


Source: Russian Notice 45/5239/19

Update Feature Position


Insert coastline, single firm line, joining: 42° 44´·99N., 133° 04´·33E.
42° 44´·70N., 133° 04´·41E.
42° 44´·61N., 133° 04´·67E.
42° 44´·74N., 133° 04´·75E.
42° 44´·75N., 133° 04´·79E.
Delete legend, Being reclaimed (2016), 42° 44´·71N., 133° 04´·58E.
centred on:

Chart affected - 8063

6232(P)/19 KOREA - East Coast - Pier. Alongside depths. Pontoons.


Source: Korean Notice 44/1026/19
1. Changes to charted detail have taken place within Mukho and Pohang. The most significant of these are listed below.
2. A pier has been established between 37° 33´·02N., 129° 06´·78E. and 37° 33´·01N., 129° 06´·83E. .
3. Alongside depths within Mukho have changed. The most significant are as follows:

Depth Position
6m 37° 33´·01N., 129° 06´·77E.
4·5m 37° 33´·04N., 129° 06´·80E.
4. The pontoons within Pohang, have been removed in the following positions:

36° 00´·90N., 129° 24´·03E.


36° 00´·90N., 129° 24´·00E.
and
36° 00´·88N., 129° 24´·10E.
36° 00´·89N., 129° 24´·07E.

2.63
Wk49/19
II
6232(P)/19 KOREA - East Coast - Pier. Alongside depths. Pontoons. (continued)
5. Alongside depths within Pohang have changed. The most significant are as follows:

Depth Position
6·8m 36° 00´·78N., 129° 24´·38E.
9·7m 36° 00´·65N., 129° 24´·54E.
4·4m 36° 00´·65N., 129° 24´·28E.
4·5m 36° 00´·75N., 129° 24´·17E.
9·7m 36° 00´·82N., 129° 24´·24E.
6. These changes will be included in a New Edition of Chart 898 to be published Early 2020.
(WGS84 DATUM)

Chart affected - 898

6235(P)/19 KOREA - West Coast - Depths. Light.


Source: Korean Chart 3489
1. Depths less than charted exist within the approaches to Mokpo. The most significant are as follows:

Depth Position
11·9m 35° 07´·97N., 125° 59´·49E.
14·0m 35° 07´·98N., 126° 01´·39E.
8·2m 35° 07´·81N., 126° 03´·60E.
23·0m 35° 06´·26N., 126° 00´·23E.
1·4m 34° 34´·80N., 125° 53´·77E.
13·9m 34° 36´·19N., 125° 51´·88E.
9·3m 34° 35´·09N., 125° 52´·29E.
16·6m 34° 34´·97N., 125° 48´·83E.
15·8m 34° 55´·07N., 125° 59´·53E.
11·0m 34° 50´·83N., 125° 58´·03E.
2. The light in position 34° 34´·01N., 125° 54´·89E. has been moved to position 34° 34´·05N., 125° 54´·74E.
3. These and other changes will be included in the next New Edition of Chart 3928, to be published early 2020.
4. Chart 913 and 3365 will be updated by Notice to Mariners.
(WGS84 DATUM)

Chart affected - 3928

6244(P)/19 KOREA - West Coast - Depths.


Source: Korean Notice 44/1026/19
1. Depths less than charted exist within the Outer Port of Gunsan Hang. The most significant are as follows:

Depth Position
6m 35° 58´·639N., 126° 37´·153E.
2·3m 35° 58´·623N., 126° 37´·417E.
4·8m 35° 58´·576N., 126° 37´·262E.
6·8m 35° 58´·571N., 126° 37´·102E.
3.3m 35° 58´·618N., 126° 37´·334E.
2. Mariners are advised to navigate with caution in the area.
3. These changes will be included in a New Edition of Chart 1008 to be published Early 2020.
(WGS84 DATUM)

Chart affected - 1008

2.64
Wk49/19
II

6249(P)/19 KOREA - West Coast - Depths. Fish havens. Tidal streams.


Source: ENC KR4F2K30
1. Depths less than charted exist in the approaches to Incheon. The most significant are as follows:

Depth Position
3·1m 37° 11´·36N., 126° 10´·47E.
4·5m 37° 10´·81N., 126° 09´·87E.
2·9m 37° 07´·03N., 126° 04´·56E.
12·4m 37° 06´·49N., 126° 11´·73E.
2. Fish havens have been established centred on the following positions:

37° 12´·45N., 126° 13´·85E.


37° 11´·58N., 126° 13´·88E.
37° 10´·84N., 126° 12´·74E.
37° 09´·06N., 126° 11´·81E.
3. There have been numerous changes to tidal streams in the approaches to Incheon.
4. Mariners are advised to navigate with caution in the area.
5. These changes will be included in a New Edition of Chart 1270 to be published early 2020.
6. Chart 1258 will be updated by Notice to Mariners.
(WGS84 Datum)

Chart affected - 1270 (INT 5363)

6173(T)/19 BRUNEI - Buoy. Light-beacons.


Source: Brunei Notice 6(T)/18
1. The east cardinal light-buoy, VQ(3)5s, in position 5° 03´·36N., 115° 11´·48E. is reported missing.
2. The following aids to navigation are reported out of commission:

Feature Characteristic Designation Position


Light-beacon Fl(2)R.15s9m3M No 16 5° 00´·30N., 115° 04´·80E.
Light-beacon Fl(2)R.10s7m4M No 64 4° 55´·92N., 115° 06´·41E.
Light-beacon Fl.R.3s7m4M No 66 4° 54´·11N., 115° 05´·79E.
3. Former Notice 2959(T)/18 is cancelled.
(WGS84 DATUM)

Charts affected - 1844 - 2134

6188(T)/19 INDONESIA - Kalimantan - Wreck.


Source: mv SC Sonoma
1. A dangerous wreck, bow visible, has been reported in position 2° 28´·04S., 109° 26´·00E.
2. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - 1066 - 1312 - 2470 - 2872 - 3757 - 3758

2.65
Wk49/19
II

6126(P)/19 AUSTRALIA - South Australia - Works. Channel. Virtual aids to navigation. Buoyage.
Source: Australian Notice 22/1168(P)/19
1. There have been changes in the appoaches and entrance channel to Port Adelaide, the most significant are detailed below.
2. The entrance channel (34° 47´·19S., 138° 24´·51E.) has been widened to 170m and the swinging basin
(34° 46´·02S., 138° 29´·19E.) has been expanded to a diameter of 550m.
3. Navaids marking the southern edge of the entrance channel, including leading light beacons in positions
34° 46´·71S., 138° 21´·59E. and 34° 46´·74S., 138° 21´·81E. , and north of the eastern Outer Harbour swinging basin
dredged limit, have been removed.
4. Navaids that have been removed may be replaced with Virtual aids to navigation (V-AIS) or temporary buoys.
5. Mariners are advised to navigate with caution in the area.
(WGS84 DATUM)

Charts affected - Aus 130 - Aus 137 - Aus 138 - Aus 781

6152(P)/19 AUSTRALIA - Queensland - Works.


Source: Australian Notice 22/1156(P)/19
1. The entrance channel and Trinity Inlet have been widened and dredged to a depth of 9·0m.
2. The eastern portion of the swing basin in position 16° 55´·54S., 145° 46´·94E. has been dredged to 8·5m.
3. The Trinity Inlet channel has been dredged southwards with a depth of 9·0m to a new swing basin in position
16° 56´·45S., 145° 46´·91E. with a depth of 8·3m.
4. Berths 1 to 6 (16° 55´·65S., 145° 46´·82E. ) have been dredged to a depth of 9·3m.
5. These changes will be included in the next New Editions of charts Aus262 and Aus263.
(WGS84 DATUM)

Charts affected - Aus 262 - Aus 263

6185(P)/19 PANAMA - Caribbean Sea Coast - Pier. Buoyage. Dolphin.


Source: Panama Maritime Authority and UKHO
1. A new pier has been established, joining the following positions:

9° 23´·786N., 79° 49´·162W.


9° 23´·828N., 79° 49´·123W.
9° 23´·716N., 79° 49´·056W.
2. Changes to buoyage have taken place in the approaches to the new pier.
3. The dolphin in position 9° 23´·814N., 79° 49´·090W. is reported to have been removed.
4. Mariners are advised to navigate with caution in the area and to contact the local Port Authority for the latest information.
5. Chart 1400 will be updated when full details become available.
(WGS84 DATUM)

Chart affected - 1400

2.66
Wk49/19
II

6209(P)/19 UNITED STATES OF AMERICA - Gulf of Mexico - Depth information. Legends. Dredged depths.
Depths. Pier. Channel limits.
Source: US Chart 11347
1. There have been significant changes to channel names and channel limits, project depths legends, dredged depths, depths
and a pier between the approaches to Calcasieu Pass (29° 28´·70N., 93° 13´·44W.) and Lake Charles
(30° 13´·98N., 93° 14´·75W.).
2. Mariners are advised to navigate with caution in the area.
3. For detailed channel information and minimum depths as reported by USACE, use NOAA Electronic Navigational Charts.
4. USACE surveys and channel condition reports are available at http://navigation.usace.army.mil/Survey/Hydro
5. These changes will be included in the New Edition of Chart 3190 to be published in early 2020.
6. These changes will be included in the next New Edition of Chart 8236.
(NAD83 DATUM)

Charts affected - 3190 - 8236

2.67
Wk49/19
II

6231(P)/19 WEST INDIES - Turks and Caicos Islands - Depths. Drying heights. Coral.
Source: British Government Survey
1. Lidar surveys show that numerous depths less than charted exist at Cockburn Harbour in South Caicos and surrounding the
area of the Turks Islands. The most significant are as follows:

Depth Position
1·5m 21° 29´·523N., 71° 32´·197W.
2·1m 21° 29´·428N., 71° 32´·311W.
2·8m 21° 29´·384N., 71° 32´·176W.
0·6m 21° 29´·344N., 71° 31´·874W.
1·3m 21° 29´·169N., 71° 31´·805W.
1·4m 21° 29´·155N., 71° 31´·623W.
Drying height 0·7m 21° 29´·795N., 71° 32´·294W.
Drying height 0·5m 21° 29´·380N., 71° 31´·047W.
Drying height 0·4m 21° 29´·458N., 71° 31´·097W.
Drying height 0·5m 21° 30´·35N., 71° 08´·28W.
Drying height 0·3m 21° 30´·13N., 71° 09´·25W.
9·3m 21° 29´·93N., 71° 09´·51W.
7·8m 21° 30´·56N., 71° 09´·23W.
0·9m 21° 31´·86N., 71° 06´·77W.
14·5m 21° 33´·30N., 71° 04´·93W.
4·7m 21° 31´·11N., 71° 05´·91W.
9·6m 21° 30´·43N., 71° 05´·76W.
0·5m 21° 28´·26N., 71° 06´·33W.
4·6m 21° 26´·90N., 71° 05´·84W.
2m 21° 25´·92N., 71° 05´·66W.
0·5m 21° 25´·43N., 71° 05´·05W.
6·2m 21° 25´·18N., 71° 04´·15W.
7·9m 21° 24´·06N., 71° 02´·48W.

2. 7·7m 21° 11´·36N., 71° 16´·56W.


8·3m 21° 23´·02N., 71° 03´·67W.
7·2m 21° 22´·56N., 71° 00´·27W.
6·6m 21° 19´·31N., 71° 04´·88W.
6·1m 21° 18´·46N., 71° 04´·69W.
3·5m 21° 20´·60N., 71° 04´·62W.
2·5m 21° 18´·57N., 71° 10´·83W.
6·4m 21° 22´·10N., 71° 04´·18W.
7·4m 21° 16´·97N., 71° 10´·13W.
5·1m 21° 17´·46N., 71° 07´·86W.
3·5m 21° 23´·68N., 71° 04´·95W.

3. 4·4m 21° 19´·59N., 71° 06´·21W.


4·9m 21° 18´·29N., 71° 08´·50W.
4·3m 21° 18´·89N., 71° 08´·06W.
3·9m 21° 17´·61N., 71° 11´·19W.
2·7m 21° 19´·57N., 71° 09´·28W.
2·3m 21° 19´·36N., 71° 10´·98W.
3·5m 21° 19´·15N., 71° 11´·50W.
2·2m 21° 19´·95N., 71° 08´·47W.
5·8m 21° 17´·32N., 71° 13´·43W.
8·5m 21° 16´·44N., 71° 13´·18W.
8·3m 21° 16´·22N., 71° 14´·14W.
6·7m 21° 15´·33N., 71° 14´·64W.

2.68
Wk49/19
II
6231(P)/19 WEST INDIES - Turks and Caicos Islands - Depths. Drying heights. Coral. (continued)

4. 2·2m 21° 14´·68N., 71° 14´·83W.


7·8m 21° 13´·42N., 71° 14´·20W.
2·6m 21° 20´·32N., 71° 07´·70W.
2m 21° 21´·32N., 71° 09´·69W.
2·4m 21° 20´·77N., 71° 06´·82W.
1·9m 21° 21´·01N., 71° 05´·92W.
1·5m 21° 21´·05N., 71° 05´·53W.
1·7m 21° 21´·25N., 71° 07´·49W.
8·6m 21° 10´·06N., 71° 16´·14W.
3·5m 21° 22´·48N., 71° 11´·90W.
21·5m 21° 33´·92N., 71° 04´·06W.
12·8m 21° 12´·93N., 71° 11´·91W.
9·8m 21° 09´·42N., 71° 17´·34W.
11·8m 21° 05´·33N., 71° 18´·98W.
9·7m 21° 07´·82N., 71° 18´·17W.
9m 21° 22´·43N., 70° 59´·36W.
18·2m 21° 07´·34N., 71° 17´·01W.
11·5m 21° 20´·70N., 70° 57´·46W.

5. Due to numerous uncharted coral heads it is strongly advised that mariners without local knowledge should avoid navigating
in the following area:

21° 25´·36N., 71° 08´·58W.


21° 25´·32N., 71° 06´·46W.
21° 24´·60N., 71° 05´·54W.
21° 21´·63N., 71° 05´·13W.
21° 20´·60N., 71° 10´·83W.
21° 20´·47N., 71° 12´·68W.
21° 22´·89N., 71° 11´·43W.
6. Mariners are advised to navigate with caution in the area.
7. These changes will be included in the next New Editions of Charts 1441 and 1450.
8. Charts 468, 3001, 3907 and 3908 will be updated by Notice to Mariners.
(WGS84 DATUM)

Charts affected - 1441 - 1450

6177(P)/19 UNITED STATES OF AMERICA - East Coast - Depth. Buoy.


Source: ENC US5ME10M
1. A depth of 6·1fm exists in Portland Harbor Anchorage B, in position 43° 39´·38N., 70° 12´·72W.
2. The Portland Harbor CG mooring buoy has been relocated from position 43° 39´·19N., 70° 12´·30W. to position
43° 39´·18N., 70° 12´·90W.
3. Mariners are advised to navigate with caution in the area.
4. These changes will be included in a New Edition of Chart 2488 to be published late 2019.
(NAD83 DATUM)

Chart affected - 2488

2.69
Wk49/19
To accompany Notice to Mariners 6216/19

On Chart 2011

DREDGED DEPTHS
The depths shown for the dredged channels
are generally maintained, but silting is liable to
occur. For the latest information, consult Port
Control.

Wk49/19
To accompany Notice to Mariners 6272/19

On Chart 1425

GAS TERMINAL
Vessels must keep at least 500m from the gas
terminal when a tanker is berthed inside.
Swimming and diving are prohibited at least
200m from mooring buoys.

Wk49/19
To accompany Notice to Mariners 6144/19. Image Size (mm) 115.8 by 115.8

Wk49/19
To accompany Notice to Mariners 6144/19. Image Size (mm) 50 by 74.9

Wk49/19
To accompany Notice to Mariners 6146/19. Image Size (mm) 167 by 105.3

Wk49/19
To accompany Notice to Mariners 6148/19. Image Size (mm) 92.1 by 134.5

Wk49/19
To accompany Notice to Mariners 6159/19. Image Size (mm) 95.1 by 112.3

Wk49/19
To accompany Notice to Mariners 6159/19. Image Size (mm) 90.3 by 106.7

Wk49/19
To accompany Notice to Mariners 6166/19. Image Size (mm) 58.6 by 81.9

Wk49/19
To accompany Notice to Mariners 6196/19. Image Size (mm) 71.9 by 72.3

Wk49/19
To accompany Notice to Mariners 6196/19. Image Size (mm) 40.3 by 61.1

Wk49/19
To accompany Notice to Mariners 6216/19. Image Size (mm) 59.6 by 93.7

Wk49/19
To accompany Notice to Mariners 6216/19. Image Size (mm) 92.6 by 173.7

Wk49/19
To accompany Notice to Mariners 6221/19. Image Size (mm) 172.6 by 153.5

Wk49/19
To accompany Notice to Mariners 6259/19. Image Size (mm) 186 by 98.1

Wk49/19
To accompany Notice to Mariners 6262/19. Image Size (mm) 59.5 by 97

Wk49/19
To accompany Notice to Mariners 6264/19. Image Size (mm) 118.5 by 125.7

Wk49/19
III

NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2016 Edition). It is recommended that the warnings reprinted below should be kept in a file or
book, followed by subsequent weekly reprints. Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via SafetyNET and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from www.admiralty.co.uk/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@ukho.gov.uk
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA
Co-ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 49, published on the UKHO website 25 November 19.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 49
The following NAVAREA I warnings were in force at 250500 UTC Nov 19.

2019 series: 127 165 175 182 183 184.

182 SOUTHWESTERN APPROACHES TO THE BRITISH ISLES. Chart GB 2 (INT 160).


1. ODAS light-buoy K1 reported adrift in vicinity of 48-48.6N 012-01.2W at 210700 UTC Nov 19.
2. Cancel 180/19.

183 1. Navarea I warnings in force at 221000 UTC Nov 19. 2. Cancel 179/19.

184 1. RIGLIST. Correct at 250500 UTC Nov 19.

Southern North Sea: 51N to 55N


52-13.3N 003-44.3E Maersk Resolute ACP P15-G
52-37.1N 002-47.0E Ensco 101
53-05.5N 002-07.8E Seafox 4 ACP Leman Gas Field
53-14.0N 003-14.5E 590021
53-28.4N 004-29.5E Ensco 121 ACP L11-B-PA
53-33.0N 001-04.6E Energy Endeavour ACP Pickerill A
NEW Rotterdam Seafox 1
53-45.0N 003-18.7E Prospector 1 ACP K4-A
53-49.0N 004-30.8E Prospector 5 ACP L5A-D
NEW Amsterdam Seajacks Hydra
NEW 53-51.7N 001-13.3E Ensco 123
53-56.4N 002-44.8E Noble Hans Deul ACP Chiswick
54-03.0N 002-29.5E Ensco 100 ACP Ketch Gas Field
54-20.7N 002-21.4E Ensco 92
54-24.4N 002-48.9E Maersk Resolve ACP D12-B

North Sea: 55N to 60N, East of 5W


55-29.0N 005-06.7E Noble Sam Turner ACP Dan Oil Field
55-43.4N 004-48.0E Maersk Guardian ACP Tyra Gas Field
NEW Invergordon Maersk Resilient
56-15.0N 003-20.9E Maersk Invincible ACP Valhall Oil Field
56-16.8N 003-24.0E Maersk Reacher ACP Valhall Oil Field
56-21.8N 004-08.7E Rowan Viking
56-38.9N 002-13.3E Noble Sam Hartley
56-43.5N 002-12.5E Ensco 120 ACP Jasmine Gas Field
NEW 56-43.5N 001-15.8E Wilphoenix
56-49.1N 003-08.1E Maersk Interceptor
56-50.9N 001-35.7E Ocean Endeavor
56-52.1N 002-04.3E Paul B Loyd Jr.
56-58.0N 001-52.2E Rowan Gorilla 5 ACP Franklin Gas Field
57-06.6N 002-50.8E Maersk Integrator ACP Ula Oil Field
57-11.7N 001-54.8E Maersk Highlander ACP u/c Pierce Oil Field Westward
57-48.6N 000-58.3W Maersk Innovator ACP Buzzard Oil and Gas Field
57-50.7N 000-54.7W COSL Pioneer
57-57.4N 001-50.7E Rowan Gorilla 7 ACP Armada Gas Field
58-11.6N 001-26.0W Borgland Dolphin
58-19.5N 000-41.9E Transocean 712
58-45.8N 001-12.6E Noble Houston Colbert
58-50.7N 001-44.6E Rowan Stavanger ACP Gudrun Oil and Gas Field

Wk49/19 3.1
III
59-02.2N 002-13.5E Maersk Intrepid
59-16.1N 002-17.0E Leiv Eiriksson
59-20.2N 002-21.8E Deepsea Bergen
59-29.5N 001-33.4E Ocean Patriot
59-35.4N 001-03.4E Noble Lloyd Noble ACP u/c Mariner Oil Field
59-47.6N 002-10.9E Deepsea Nordkapp
59-52.0N 002-02.6E West Phoenix

Norwegian Sea: 60N to 65N, East of 5W


60-07.4N 004-09.3W Transocean Leader
60-24.7N 004-03.3W Deepsea Aberdeen
60-44.4N 003-34.8E Songa Equinox
NEW Agotnes Transocean Endurance
60-50.3N 003-30.9E COSL Promoter
NEW Invergordon Ocean Valiant
NEW Skipavika Deepsea Atlantic
61-09.7N 001-06.7E Paragon MSS1
NEW Floro Transocean Norge
61-28.6N 002-12.2E Transocean Spitsbergen
64-50.2N 006-47.2E Transocean Enabler

South and West Coasts of the British Isles.


NEW 53-34.0N 003-27.3W Irish Sea Pioneer ACP Hamilton 110/13
53-52.6N 003-33.6W Borr Ran ACP South Morecambe Gas Field.

NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform; u/c - under construction
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit www.navarea-xix.no

2. Cancel 181/19.

3.2 Wk49/19
IV

[49/19]
UPDATES TO ADMIRALTY SAILING DIRECTIONS

NP3 Africa Pilot Volume 3 (2019 Edition) From the vicinity of the inner pilot boarding position
(9.21), the track leads W, passing:
Tanzania -- Pangani Bay to Tanga — Light 2 S of Ulenge Reefs (50225S 390980E),
detached and which barely dry; the SE edge
239 is marked by a light buoy. Shoal areas extend
up to 2 cables S of the reefs. Thence:
Paragraph 9.6 1 line(s) 4 Replace by: Clear of an isolated depth, reported, of 111 m
...position SE of Niule (9.10) at the entrance... (50287S 390972E); a second isolated depth,
reported, of 65 m lies about 3¼ cables farther S.
Tanzania Ports Authority [NP3--No 10--Wk 49/19] Thence:
3 N of Dixon Bank (50354S 390949E), a small
Tanzania -- Pangani Bay to Tanga — Directions coral patch marked by a light buoy, thence:
N of shoal depths (50340S 390880E), where the
240 depths are reported (1979) to be unreliable. The
shoals are marked on the N side by No 8 Light
Paragraph 9.10 6 line(s) 2--6 Replace by: Buoy. Thence:
...drying coral reef marked on its NE and E sides by light 4 S of Kwawa Reef (50238S 390779E), part of
buoys, and by No 3 Beacon (white, tripod base) (50403S which dries and which extends 8 cables S
391106E) standing near the NW edge. from Ras Chongoleani (50167S 390764E),
a mangrove covered point; the S extremity of
Tanzania Ports Authority [NP3--No 11--Wk 49/19] the reef is marked by a light buoy. Thence:
5 N of Ras Kazone (50326S 390728E), cliff
Tanzania -- Tanga — Pilotage like, covered with vegetation and fronted by a
drying reef.
241 Thence as required for anchorage in Tanga Bay.

Paragraph 9.21 1 line(s) 4 Replace by: Tanzania Ports Authority [NP3--No 14--Wk 49/19]
...Ulenge Reefs (9.30). Deep draught vessels...
Tanzania -- Tanga --
Tanzania Ports Authority [NP3--No 12--Wk 49/19] Tanga Bay — Directions; leading lights

Tanzania -- Tanga — Directions; leading lights 242--243


Paragraph 9.31 1--5 Replace by:
242
1 Caution. The leading lights exhibited from the E
Paragraph 9.29 3--5 Replace by: extremity of Toten Island (9.14) and throughout the
3 SW of an obstruction (50341S 391322E), inner harbour are close together and also serve as
formed by the remains of a former light anchorage leads.
beacon, at the SW end of a patch of foul Toten Island Leading Lights:
ground and marked on its S side by No 1 Front light (white concrete tower) (50327S
Light Buoy (starboard hand), thence: 390663E).
NE of Niule (50440S 391125E) (9.10), marked at Rear light (similar structure) (75 m from front light).
its E and NE extremities by light buoys, thence: 2 From a position in Tanga Bay about 3½ cables SW
4 To a position SW of Fungu Nyama (50136S of Kwawa Reef (9.30), the alignment (235) of these
391344E), an extensive drying coral reef. The track lights leads SW to a position NNW of Ras Kazone
then leads W, passing: (9.30). A shoal area and drying reef extend NNW of
N of Niule (9.10), thence: Raz Kazone, marked by a light buoy.
Clear of an isolated depth of 122 m (50270S Tanga Inner Harbour Leading Lights:
391130E), reported (1957). Front light (white concrete pillar, 8 m in height)
Thence to the inner pilot boarding position (9.21). (50373S 390679E).
Rear light (similar structure, 6 m in height) (67 m
Tanzania Ports Authority [NP3--No 13--Wk 49/19] from front light).
3 The alignment (204) of these lights leads SSW,
Tanzania -- Tanga -- Tanga Bay — Directions passing:
WNW of Ras Kazone, thence:
242 ESE of a drying reef extending E of the E extremity of
Paragraph 9.30 1--4 Replace by: Toten Island, marked by a light buoy, thence:
Kissosora Leading Lights:
1 For entry to Tanga Bay it is recommended to Front light (white concrete tower, 6 m in height)
remain on the N side of the Ras Kazone leading line (50387S 390599E).
(9.31a) in order to avoid the shallow depths, which 4 Rear light (similar structure) (2½ cables from
may be less than charted, at its inner end. front light).

Wk49/19 4.1
IV

The alignment (247) of these lights leads into the Tanzania -- Tanga to Moa Bay — Directions; light
inner harbour, passing:
NNW of Hospital Spit Light (white concrete tower) 243
(50365S 390672E), thence:
SSE of Toten Island South Light (white tower) Paragraph 9.38 1 line(s) 1--2 Replace by:
(50351S 390649E). 1 From a position SE of Niule (50440S 391125E)
5 Useful marks: (9.10) at the entrance to the port of...
Tower (50373S 390728E).
Post Office tower (50419S 390630E). Paragraph 9.43 1 line(s) 1--2 Replace by:

Tanzania Ports Authority [NP3--No 15--Wk 49/19] 1 From a position SE of Niule (50440S 391125E)
(9.10), the track leads NNE, passing:
Tanzania -- Tanga --
Tanga Bay — Directions; leading lights Tanzania Ports Authority [NP3--No 18--Wk 49/19]

243
After Paragraph 9.31 5 line 8 Insert: NP5 South America Pilot Volume 1
(2017 Edition)
Direct route to moorings east of Ras Kazone
9.31a
1 Caution. It is reported (1979) that depths W of Brazil -- East coast -- Porto de Recife to
Dixon Bank are unreliable; depths less than charted Porto de Pedras — Directions; wrecks
may exist.
From a position S of the inner pilot boarding 162
position (9.21), shallow draught vessels may proceed
Paragraph 5.102 4 line 1 Replace by:
to the moorings as follows:
Ras Kazone Leading Lights: 4 The track then continues SSW, passing:
Front light (white concrete tower, 11 m in height) Clear of a dangerous wreck (83849S 350081W),
(50324S 390758E). thence:
2 Rear light (mast and yard on white concrete ESE of Ponta Tamandaré (84540S...
tower and gallery, black stripe, 22 m in height)
(3 cables from front light), exhibited from the Paragraph 5.103 1 line 1 Replace by:
signal station (9.25). 1 ESE of a dangerous wreck (84740S
The alignment (266) of these lights leads towards 350360W), thence:
moorings, passing: ESE of the reefs off Ponta das Ilhetas (84736S...
S of Ulenge Reefs (9.30), thence:
Clear of an isolated depth of 65 m (50320S Brazilian Notice 20/E213/19; ENC BR322200 (3.006)
390966E), reported, thence: [NP5--No 99--Wk 49/19]
3 N of Dixon Bank (50354S 390949E), a small
coral patch marked by a light buoy on its N
side.
The track then leads through an area of shoal
NP18 Baltic Pilot Volume 1 (2018 Edition)
patches, marked on the N side by a light buoy, to the
moorings.
Germany -- Baltic Sea --
Tanzania Ports Authority [NP3--No 16--Wk 49/19] Warnemünde approaches — Prohibited area

Tanzania -- Tanga -- Tanga Bay — Anchorages 403

243 Paragraph 3.118 1 line(s) 1--10 including existing Section


IV Notice Week 32/19 Replace by:
Paragraph 9.32 1 lines 1--8 including heading Replace by:
1 A restricted area (5410·70N 1156·80E), where
Anchorages and moorings fishing and anchoring are prohibited, lies near the
9.32 coast W of Warnemünde, off Nienhagen (13.116). The
1 CBM (oil), 5 cables E of Ras Kazone (9.30). area is marked at each corner by buoys (special),
CBM (LPG), close E of Toten Island South Light deployed annually from the 1st May to the 30th
(9.31). November. A light buoy (special) is moored in the SW
Anchorage in Tanga Bay, entered between Ras part of the area.
Kazone and Kwawa Reef, 9 cables NNE, in depths 2 A second restricted area (541387N 120069E),
from 11 to 18 m. Maximum draught 167 m. where fishing and anchoring are prohibited lies within
Tanga inner harbour provides sheltered anchorage anchorage area No 1 (13.123).
in depths from 6 to 11 m for vessels up to 183 m in A cable area with a radius of 2½ cables, within
length. Maximum draught 94 m. which anchoring is prohibited, lies in position
541685N 120858E.
GB Chart 663; Indian Chart 2693; ENC GB50663A
[NP3--No 17--Wk 49/19] German Notice 45/36/19 [NP18--No 49--Wk 49/19]

4.2 Wk49/19
IV

NP19 Baltic Pilot Volume 2 (2018 Edition) Paragraph 2.60 1 lines 4--6 Replace by:
...Kao--hsiung Kang First (North) Entrance TSS (2.52).
Sweden -- Södertälje Kanal — Traffic regulations
UKHO [NP32A--No 74--Wk 49/19]
234
Taiwan -- South--west--coast --
After Paragraph 6.57 3 line 2 Insert: Kao--hsiung — Directions
Overtaking. Vessels over 4 m in width may not
66
meet or overtake other vessels in Linasundet (6.42)
between latitudes 591275N and 591340N. Paragraph 2.61 1 lines 1--8 Replace by:

Swedish Notice 780/14383/19 [NP19--No 87--Wk 49/19] 1 From a position W of Kao--hsiung Kang Second
(South) Entrance TSS, the track leads 6 miles NNE,
through the NNE bound lane which forms part of the
NP28 Dover Strait Pilot (2017 Edition) Kao--Hsuing Kang TSS, to a position W of Kao--hsiung
Kang First (North) Entrance TSS, passing to seaward
of Nos 2, 3 and Dangerous Cargo Anchorages (2.50).
Netherlands -- North Sea -- North Hinder Junction
— Anchorage; wreck; foul ground UKHO [NP32A--No 75--Wk 49/19]
224
Taiwan -- North coast --
Paragraph 9.28 1 line 5 Replace by: Chi--lung Kang — Pilotage

...of North Hinder Junction Precautionary Area. A wreck 87


and numerous foul patches exist within the anchorage.
Paragraph 2.219 1 lines 3--7 Replace by:
Netherlands Notice 45/392/19 [NP28--No 42--Wk 49/19] ...24 hours. The pilot boarding position is 251089N
1214447E. For details see ADMIRALTY List of Radio
Signals Volume 6(6).
NP30 China Sea Pilot Volume 1 (2018 Edition)
UKHO [NP32A--No 76--Wk 49/19]
China -- South coast -- Yangpu — Pilotage
Taiwan -- North coast --
244 Chi--lung Kang — Pilotage

Paragraph 7.167 1--2 Replace by: 89

1 Pilotage is compulsory, pilots are provided from Paragraph 2.227 2 lines 5--7 Delete
Haikou. The pilot boarding places are:
Within Anchorages Nos 1, 2 and 3 (7.166). UKHO [NP32A--No 77--Wk 49/19]
No 1 (194880N 1090420E).
No 3 (194500N 1090730E); within Anchorage
China -- Taiwan Strait -- Meizhou Wan --
No 8. Putou Channel — Controlling depths
No 4 (194320N 1090550E).
No 5 (194440N 1090260E); close S of 154
Anchorage No 7.
2 No 6 (194080N 1090880E); within Anchorage Paragraph 4.201 2 line(s) 3--4 Replace by:
No 13. ...depth of 21 to 23 m over a width of 500 m.
No 7 (195050N 1090800E). Putou Channel (251238N 1185915E) for
No 8 (194680N 1090200E); within Anchorage 70 000 tonnes vessels has a designed depth of 11 m
No 5. over a width of 200 m.
No 9 (194360N 1090820E); within Anchorage
No 10. Chinese Notice 42/Putian MSA/19
For details see ADMIRALTY List of Radio Signals [NP32A--No 70--Wk 49/19]
Volume 6(6).
China -- Taiwan Strait -- Meizhou Wan --
Chinese Chart 16561/19 [NP30--No 103--Wk 49/19] Putou Channel — Traffic regulations

154
NP32A China Sea Pilot Volume 3 (2019 Edition)
After Paragraph 4.206 2 line 4 Insert:

Taiwan -- South--west coast -- Putou Channel is for one way traffic only for bulk
Kao--hsiung — Directions vessels up to 70 000 tonnes proceeding with the tide
to Berth No 4 in the Putou Operating Area.
65
Chinese Notice 42/Putian Channel/19
Paragraph 2.59 1 lines 6--8 Delete [NP32A--No 71--Wk 49/19]

Wk49/19 4.3
IV

China -- Taiwan Strait -- Meizhou Wan -- NP32B China Sea Pilot Volume 4 (2019 Edition)
Putou Channel — Berth
China -- Yellow Sea -- Lianyungang — Pilotage
155
55
Paragraph 4.207 4 line(s) 1--4 Replace by: Paragraph 2.33 1 line(s) 3--8 Replace by:
4 Berth No 4 (251425N 1185825E), in the Putou No 1 (344646N 1193390E).
Operation Area, can accommodate 70 000 tonnes bulk No 2 (344773N 1193733E).
carriers. No 3 (344958N 1194171E).
One main navigation channel enters the bay with No 4 (345176N 1194694E).
the berths and terminals approached directly, or via No 6 (344493N 1193410E).
branch channels. There is a lightering anchorage in No 7 (344839N 1194209E).
the bay. No 8 (345124N 1194976E).

Chinese Chart 12581/19 [NP32B--No 79--Wk 49/19]


Chinese Notice 42/Putian MSA/19
[NP32A--No 72--Wk 49/19]
China -- Yellow Sea -- Lianyungang — Berth
55
China -- Taiwan Strait -- Meizhou Wan --
Putou Channel — Directions Paragraph 2.35 3 line(s) 1--8 Delete

156 UKHO [NP32B--No 80--Wk 49/19]

After Paragraph 4.216 4 line 6 Insert: China -- Yellow Sea -- Rizhao — Anchorages
62
Putou Channel Paragraph 2.92 1--4 Replace by:
4.216a
1 From a position about 7½ cables E of Longhu Yu 1 Anchorage may be obtained in the following areas.
Light (red concrete cone, 5 m in height) (251245N Name Position Remarks
1185997E), the recommended track leads generally
No 1 352060N Depths from 18 to 23 m,
NNW for about 2½ miles through Putou Channel, Anchorage -- 1194080E good holding ground.
marked by light buoys (lateral), to the vicinity of Putou vessels
Operating Area Berth No 4 (4.207). awaiting
orders
Chinese Notice 42/Putian MSA/19 No 2 351675N Vessels of
[NP32A--No 73--Wk 49/19] Anchorage -- 1194993E 100 000 tonnes and over
vessels and draught of 175 m
awaiting tide and over. Depths from 21
China -- Approaches to Wenzhou Wan -- and orders to 32 m
East of Hutou Yu — Directions; wreck 2 No 3 351521N Depths from 17 to 22 m.
Anchorage -- 1193948E
186 vessels
awaiting
After Paragraph 5.67 7 line 3 Insert: orders and
quarantine
ESE of a dangerous wreck (275018N No 4 351398N Depths from 19 to 24 m.
1211700E), reported (2018). Anchorage -- 1194244E
Fumigation,
Chinese Notice 43/1390/19 [NP32A--No 78--Wk 49/19] tank
cleaning and
quarantine
China -- Approaches to Wenzhou Wan -- 3 No 5 351296N Vessels of
East of Hutou Yu — Directions; wreck Anchorage -- 1194492E 100 000 tonnes
vessels and over,
awaiting tide Depths from 20 to 30 m.
188 and orders.
4 Tanker 350870N Depths from 21 to 24 m
After Paragraph 5.76 1 line 8 Insert:
1194956E
NE of a dangerous wreck (275018N 1211700E), Temporary 352800N NE of port, least depth
reported (2018), thence: Anchorage 1195300E 196 m

Chinese Notice 43/1390/19 [NP32A--No 79--Wk 49/19] Chinese Notice 42/1348/19 [NP32B--No 77--Wk 49/19]

4.4 Wk49/19
IV

China -- Yellow Sea -- India -- West coast -- New Mangalore — Wreck


Rizhao — Traffic regulations
184
63
Paragraph 6.38 1 lines 3--5 Replace by:
Paragraph 2.94 1 line(s) 1--3 Replace by: ...between 16 and 18 m. A dangerous wreck (125635N
1 Without the consent of Rizhao VTS, vessels 744620E), position approximate, lies E of the anchorage
planning to berth at Shijiu Gangqu S operating area area.
are prohibited from anchoring at No 1 Anchorage. Indian Notice 19/221/19 [NP38--No 6--Wk 49/19]
Vessels arriving, departing and navigating without
anchoring are prohibited from crossing the anchorage
areas. India -- West coast -- Approaches to Gulf of
Khambhºt -- Southerland Channel — Light
Chinese Notice 42/1348/19 [NP32B--No 78--Wk 49/19] 234
After Paragraph 8.38 3 line 4 Insert:
South Korea -- West coast --
Pyeongtaek Hang — Pilotage Valsºd Khadi Light (white tower, red bands, 48 m in
height) (203779N 812822E)
205
Indian Notice 15/184/19 [NP38--No 3--Wk 49/19]
Paragraph 6.91 2 line(s) 1--4 Replace by:
2 Pungdo (bad weather) (370780N 1262401E); India -- West coast -- Approaches to Gulf of
Pungdo (370824N 1262276E); Khambhºt -- Southerland Channel — Light
Ippado (370817N 1262988E); 236
Dorido (bad weather) (370620N 1263600E).
Paragraph 8.42 3 line(s) 3--5 Delete
ENC KR4F2K30 [NP32B--No 81--Wk 49/19]
Indian Notice 15/184/19 [NP38--No 4--Wk 49/19]
South Korea -- West coast --
Pyeongtaek Hang — Anchorage; obstructions India -- West coast -- Approaches to Gulf of
Khambhºt -- Valsºd Bay — Light
207
239
Paragraph 6.109 2 line(s) 4--5 Replace by:
Paragraph 8.62 2 line(s) 2--3 Replace by:
Dorido Waiting Anchorage (370504N
1263852E), depths from 13 to 20 m. Several ...patches lie 4½ miles SW and 3½ miles W Valsºd Khadi
obstructions lie within the anchorage area. Light (8.38)

Indian Notice 15/184/19 [NP38--No 5--Wk 49/19]


South Korean Chart 3415/19
[NP32B--No 76--Wk 49/19]
NP39 South Indian Ocean Pilot (2017 Edition)

NP38 West Coast of India Pilot (2019 Edition)


Republic of Mauritius -- Rodriguez Island --
Port Mathurin — Directions
India -- West coast -- Badagara — Wrecks 281
176 Paragraph 11.217 1--2 including existing Section IV Notice
Week 50/17 Replace by:
Paragraph 5.134 6 line(s) 1--3 Delete
1 The track leads through the channel, marked by
light beacons (lateral), to a position within the white
Indian Notice 15/185/19 [NP38--No 1--Wk 49/19] sector (163--167) of Port Mathurin Sector Light
(11.216). Thence the bearing 200 of the power
India -- West coast -- Badagara — Anchorage station chimney (11.214) leads for about 2 cables
through the S part of the channel into the turning
177 basin, 260 m in diameter, marked on the N, E and W
sides by light beacons.
Paragraph 5.138 3 lines 1--5 Replace by: 2 Cautions:
In the turning basin, a strong current builds up during
3 Anchorage may be obtained abreast the town a falling tide;
about 2¼ miles WSW of the above flagstaff in a depth Navigation at night in the channel is not
of about 9 m, mud. recommended.

Indian Notice 15/185/19 [NP38--No 2--Wk 49/19] Indian Notice 21/235/19 [NP39--No 23--Wk 49/19]

Wk49/19 4.5
IV

NP42B Japan Pilot Volume 3 (2019 Edition) 2 Non dangerous cargo anchorage, centred on
393267N 23989E, with depths of 12 to 24 m,
sand, shells and stone.
Seto Naikai -- Harima Nada -- West side -- Okado Caution. Advice from the local authority and certain
Hana to Inge Shima — Directions; obstruction
precautions must be taken to avoid damaging the sea
grass ecosystem throughout Bahía de Palma.
294
3 Prohibited anchorage areas lie close W and E of
Paragraph 11.28 2 line 27 Replace by: the anchorage area. A prohibited anchorage area
centred on 393220N 24021E lies within the
...1342199E). An obstruction (343910N anchorage areas.
1342200E), position approximate, lies Anchoring and trawling are prohibited in an area on
2¾ cables N of the wreck. the W side of the approaches to the port. Anchoring
is also prohibited within the harbour.
Japanese Notice 43/871/19 [NP42B--No 1--Wk 49/19]
Spanish Notice 44/347/19 [NP45--No 67--Wk 49/19]
Seto Naikai -- Harima Nada -- North side -- Ishima
Suido to Himeji Ko — Directions; obstruction
NP46 Mediterranean Pilot Volume 2
298 (2018 Edition)
Paragraph 11.58 4 line 2 Replace by:
France -- Corse -- East coast --
...1342199E), lying close to track. An Bastia — Prohibited area
obstruction (343910N 1342200E), position
215
approximate, lies 2¾ cables N of the wreck.
Thence: After Paragraph 7.25 1 line 2 Insert:

Japanese Notice 43/871/19 [NP42B--No 2--Wk 49/19] Prohibited area. When a tanker is moored at the
buoys, vessels must keep at least 500 m away from
the terminal.
NP43 South and East Coasts of Korea, East French Notice 45/93(F707)/19 [NP46--No 75--Wk 49/19]
Coast of Siberia and Sea of Okhotsk Pilot
(2018 Edition) France -- Corse -- East coast --
Lucciana Oil Terminal — Prohibited area
South Korea -- Jejudo -- South coast -- 217
Gaeminpogot to Marado — Directions; wrecks
After Paragraph 7.41 1 line 8 Insert:
94
Prohibited area. When a tanker is moored at the
After Paragraph 2.73 2 line 10 Insert: buoys, vessels must keep at least 500 m away from
the terminal.
SSE of a dangerous wreck (331248N
1263501E), position approximate, thence: French Notice 45/93(F707)/19 [NP46--No 76--Wk 49/19]
After Paragraph 2.73 4 line 6 Insert:
Clear of a dangerous wreck (330790N NP58A Norway Pilot Volume 3A (2015 Edition)
1262603E), position approximate.
Lofoten south--east side --
South Korean Chart 2714 [NP43--No 90--Wk 49/19] Moskenes — Light sector

368
NP45 Mediterranean Pilot Volume 1 Paragraph 11.22 1 line 4 For (314--3257) Read
(2018 Edition) (3177--3270)

Spain -- Mallorca -- Palma — Outer anchorages Norwegian Notice 20/60749/19


[NP58A--No 83--Wk 49/19]
205
Lofoten west side -- Torvøya --
Paragraph 4.136 1--2 Replace by: Ramberg — Light sector
1 Dangerous cargo anchorage. A designated 434
dangerous cargo anchorage is centred on 393197N
23987E, with depths from 17 to 30 m, sand and Paragraph 13.28 2 line 3 For (280--325) Read
shells. (2768--3252)
Nuclear vessels. Anchorage A (393193N
23993E), lying near the centre of the dangerous Norwegian Notice 20/60792/19
cargo anchorage is reserved for nuclear vessels. [NP58A--No 84--Wk 49/19]

4.6 Wk49/19
IV

Lofoten west side -- Selfjorden -- Paragraph 9.237 1--2 including heading Replace by:
Krystadpynten — Light sector
Spare
435 9.237

Paragraph 13.30 1--4 Replace by: Norwegian Notice 20/60758/19


[NP58B--No 25--Wk 49/19]
1 From a position SW of Kubbholmen (680476N
131144E) the track leads initially SSW, and at night
within the white sector (1856--1977) of Krystad
Light (680355N 131013E), passing: NP59 Nova Scotia and Bay of Fundy Pilot
WNW of Lyngøya (680452N 131136E), thence: (2013 Edition)
2 WNW of Flatholmen (680412N 131088E),
thence:
WNW of a patch (680400N 131049E) with a United States of America -- Maine -- Jonesport --
depth of 58 m; this danger lies on the E limit of the Moosabec Reach -- Eastern part — Bridge
white sector (1856--1977) of Krystad Light.
3 Thence the track leads S, passing: 195
E of a patch (680381N 131006E), with a depth of
40 m, thence: Paragraph 8.149 3 line(s) 5--7 Replace by:
W of a marine farm (680364N 131098E) moored A bridge (443146N 673688W) which spans
off the S side of Revsholmen, thence: Moosabec Reach is under construction (2019); vertical
4 E of Krystadpynten from which Krystad Light and horizontal clearances unknown. Contact local
(pile, 3 m in height) (680355N 131013E) is authorities for the latest information.
exhibited, thence:
E of two rocks (680340N 130991E) awash, both US Notice 44/13326/19 [NP59--No 13--Wk 49/19]
marked by iron perches.
The track then leads SSW, and at night within the
white sector (0029--0173), astern, of Krystad Light,
passing (with positions relative to Krystad Light): NP63 Persian Gulf Pilot (2018 Edition)

Norwegian Notice 20/60790/19


Gulf of Oman -- Oman -- As Suwayq -- Said Bin
[NP58A--No 85--Wk 49/19] Sultan Naval Base — Anchorages

86
NP58B Norway Pilot Volume 3B (2018 Edition) Paragraph 3.131 1 lines 4--8 Replace by:
Outer anchorages. Three anchorage areas lie
Vargsund -- Korsfjorden -- Vannes to NNW of As Suwayq (235076N 572652E):
Korsfjordbotnen — Directions Anchorage A (235269N 572552E) for small
craft;
300 Anchorage B (235408N 572515E) for medium
size vessels;
Paragraph 9.235 2 line(s) 8--9 Delete Anchorage C (235716N 572462E) for
deep--draught vessels.

Paragraph 9.236 1--2 Replace by: Omani Notice 10/41/19 [NP63--No 84--Wk 49/19]

1 Vannes to Korsfjorden Havn and


Korsfjordbotnen. From a position N of Vannes the
track leads ENE, and at night in the white sector NP69 East Coast of the United States Pilot
(0545--0645) of Goppi Light (white lantern, 3 m in Volume 2 (2017 Edition)
height) (701482N 232532E), passing:
SSE of dangerous rock (701461N 232406E),
thence: Delaware -- Chesapeake and Delaware Canal --
Delaware River — Anchorage
SSE of Eidsnesøyra (701466N 232402E), from
where a light (port hand) is exhibited, thence:
73
NNW of an iron perch marking the N side of
Flatskjæret (701448N 232473E), a drying flat Paragraph 3.107 3 lines 1--3 Replace by:
on which stands a beacon (black tower).
2 The track then leads E to a position about 1 cable 3 Anchorage No 3 (393240N 753290W), a
NW of Indrerevet (701453N 232665E), marked by general anchorage, lies on the W side of the main
an iron perch. Thence the track leads ESE, and at channel NNE of Reedy Island (3.99). Obstructions lie
night in the white sector (2945--299), astern, of within the anchorage.
Goppi Light, passing:
NNE of Indrerevet, and: US Notice 44/12311/19 [NP69--No 32--Wk 49/19]

Wk49/19 4.7
V

UPDATES TO ADMIRALTY LIST OF LIGHTS AND FOG SIGNALS

NP74, Vol A Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

A1794 - Locquémeau. Dir Lt 121° 48 43·28 N Dir Q WRG 39 W12 White gabled Q G115·5°-120·5°(5°).
FR, LA, 39500 3 34·11 W R 8 building Q W120·5°-121·5°(1°).
G 8 6 Q R121·5°-127°(5·5°)
* * * * * * *

NORTH COAST. BAIE DE LANNION


A1794·1 Remove from list; deleted

A3372 - Cullen Harbour. Outer 57 41·62 N Fl G 2s 6 2 Metal post G114°-119°(5°)


Basin 2 49·33 W
* * *

NORTH MINCH. ISLE OF LEWIS. STORNOWAY HARBOUR


A3982·6 Remove from list; deleted

A3998 - Vallaquie Island. Dir Lt 57 35·50 N Dir Fl(3)WRG 11 W 5 Metal post (fl 0·4, ec 1·2) x 2, fl 0·4, ec 4·4.
207·5° 7 09·40 W 8s R 5 Fl(3)G 195°-205°(10°).
G 5 Fl(3)W 205°-210°(5°).
Fl(3)R 210°-220°(10°).
Bearing 207·5° is approximate based
on sector information. Reported out
of position (T) 2019
- - Dir Lt 255·5° .. Dir Fl(3)WRG 11 W 8 Metal post (fl 0·4, ec 1·2) x 2, fl 0·4, ec 4·4.
8s R 8 Fl(3)G 249°-254°(5°).
G 8 Fl(3)W 254°-257°(3°).
Fl(3)R 257°-262°(5°).
Bearing 255·5° is approximate based
on sector information
*

WEST COAST. MORECAMBE BAY. BARROW-IN-FURNESS


A4820 - Isle of Walney 54 02·92 N Fl W 15s 21 20 White stone tower Obscured 122°-127°(5°) when within
(GB:ABP) 3 10·63 W 24 3M of the shore
* *

A6413 - Dingle Harbour. Ldg Lts 52 07·41 N Oc W 3s 10 3 Post


182°. Front 10 16·58 W
* *

A6413·1 - Dingle Harbour. Ldg Lts 52 07·38 N Oc W 3s 14 3 Post


182°. Rear. 100m from front 10 16·59 W
* *

A6413·3 - Dingle Harbour. Dir Lt 52 08·34 N Dir Oc WRG 14 3 Mast Oc G354°-001°(7°).


002° 10 16·52 W 5s Oc W001°-003°(2°).
Oc R003°-009°(6°)
* * *

KRAKA OILFIELD
A7780·9 - Dogger Tail End. Eastward. 55 24·13 N Mo(U)W 15s 27 10 Platform Additional lit platforms close by. TE
DK, , 114A DUC-KR-A 5 04·70 E 2019
(DK)
---- .. Mo(U)R 15s 19 2 .. TE 2019
---- .. Horn Mo(U)
30s
---- .. Racon .. .. .. ALRS Vol 2 Station 55660
*

5.1 Wk49/19
V

NP74, Vol A Edition 2019/20 continued.

A7865 - Devil's Hole. Eastward. 56 57·56 N Mo(U)W 15s .. 15 Platform


22/30C. West Franklin 1 48·34 E
(GB)
- - - - - Reserve light .. Mo(U)W 15s .. 10
- - - - - Subsidiary light .. Mo(U)R 15s .. 3
----- .. Horn Mo(U) .. 2 .. (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
- - - - - Reserve fog signal .. Horn Mo(U) .. 0·5 . . (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
* * * * * * * *

A7880 - Great Fisher Bank. 56 10·71 N Mo(U)W 15s .. 15 Platform TE 2019


DK, , 142A Southward. DUC-SV-A 4 10·77 E
(DK)
- - - - Reserve light .. Mo(U)W 15s .. 10 . . TE 2019
- - - - Subsidiary light .. Mo(U)R 15s .. 2 .. 1 on each corner of platform if not
marked by a W light, the subsidiary
lights are synchronized. TE 2019
---- .. Horn Mo(U) .. .. .. (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
---- .. Racon .. .. .. ALRS Vol 2 Station 55760
*

ELGIN GASFIELD
A7968·5 - Halibut Bank. 57 00·70 N Mo(U)W 15s .. 15 Platform 3 platforms with connecting bridges
South-eastward. 1 50·31 E
22/30C-WHP A,WHP B,
PUQ
(GB)
- - - - Reserve light .. Mo(U)W 15s .. 10
- - - - Subsidiary light .. Mo(U)R 15s .. 3 .. 1 on each corner of platform if not
marked by a W light, the subsidiary
lights are synchronized
---- .. Horn Mo(U) .. 2 .. (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
- - - - Reserve fog signal .. Horn Mo(U) .. 0·5 . . (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
* * * *

NP76, Vol C Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

SUNDSVALLS BUKTEN. ALNÖSUNDET


C6038·3 Remove from list; deleted

SUNDSVALLS BUKTEN. ALNÖSUNDET


C6038·301 Remove from list; deleted

SUNDSVALLS BUKTEN. ALNÖSUNDET


C6038·31 Remove from list; deleted

SUNDSVALLS BUKTEN. ALNÖSUNDET


C6038·311 Remove from list; deleted

5.2 Wk49/19
V

NP77, Vol D Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

D1086·5 - Banc De Guerande. 47 14·10 N Fl(5)Y 20s .. 3 × on platform


FR, LA, 50450 SEM-REV IHES 2 46·80 W
--- .. AIS .. .. .. MMSI No 992271054
* * * * * * * *

D1087 - Banc De Guerande 47 14·41 N Mo(U)Y 15s 14 5 Wind turbine R Lt


2 46·52 W
-- .. AIS .. .. .. MMSI No 992271051
* * * * * * * *

D1286·4 - Port de La Cotinière. 45 54·63 N Fl R 4s 10 6 White tower, red top fl 1.


FR, LA, 57680 Grande Jetée. Head 1 19·70 W 10 TE 2019
*

D1685·12 - Puerto de Vicedo. S 43 44·30 N Fl(4)G 11s 9 3 Green column on (fl 0·5, ec 1·5) x 3, fl 0·5, ec 4·5.
ES, I, 03087 Breakwater. Head 7 40·63 W white hut TE 2019
6
*

NORTH-WEST COAST
D1740 - Cabo Toriñana 43 03·20 N Fl(2+1)W 15s 63 24 White round tower fl 0·2, ec 2·2, (fl 0·2, ec 6·1) x 2
ES, I, 03880 9 17·89 W 14
-- .. AIS .. .. .. MMSI No 992242141
-- .. Racon .. .. .. ALRS Vol 2 Station 67780
* * * * * * * *

D2349·261 - Muelle de la Plancha. Jetty. 36 50·10 N Fl Y 5s .. 1 Yellow post fl 0·5


ES, I, 09438 S Head 6 21·49 W
* * * * * * * *

D2349·271 - Muelle de la Plancha. Jetty. 36 50·11 N Fl Y 5s .. 1 Yellow post fl 0·5


ES, I, 09438·1 N Head 6 21·49 W
* * * * * * * *

D2628·5 Cabo Bojador. Harbour. 26 06·80 N Fl R 5s .. 6


FR, LC, 21100 Main Breakwater. Head 14 29·80 W
ES, I, 13885 ---- .. Horn 20s
*

D2777·2 - Puerto de Naos. Duque de 28 58·04 N Fl(2)R 7s 5 3 Red mast fl 0·5, ec 1, fl 0·5, ec 5
ES, I, 12036 alba. NE Head 13 31·95 W 4
* * *

TANGA
D6756 Remove from list; deleted

TANGA
D6758 Remove from list; deleted

TANGA
D6759 Remove from list; deleted

D6765 - Toten Island. S Beacon 5 03·51 S Fl(2+1)W 6s .. 6 White tower fl 0·3


39 06·49 E
* *

DUBAI HARBOUR
D7357·9 - Entrance Dir Lt 184° 25 06·12 N Dir WRG 12 13 Post Iso G 4s 182°-183°(1°).
55 06·21 E 12 F W183°-185°(2°).
Iso R 4s 185°-186°(1°)
- .. By day .. 6
- .. AIS .. .. .. MMSI No 994701119
* *

5.3 Wk49/19
V

NP78, Vol E Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

E0333·7 - Puerto de Santa Ponsa. 39 30·99 N VQ(3)W 5s 3 1 * on black post,


ES, II, 35145·10 Bajo de Las Secas 2 28·51 E yellow band
3
*

E0473·5 Remove from list; renumbered to E0473.51

E0473·5 Puerto Deportivo de 42 03·05 N VQ(3)W 5s 9 3 * on black post,


ES, II, 31340 L'Estartit. E Breakwater. 3 12·40 E yellow band
Elbow 4
* * * * * * * *

E0473·51 Renumbered; was previously E0473.5


ES, II, 31335
Puerto Deportivo de 42 03·04 N Fl G 5s .. 3 Green post, white fl 0·5
L'Estartit. E Breakwater. 3 12·34 E base
Head 3
* * * * *

E0474·3 Puerto Deportivo de 42 03·09 N Fl(2)R 13s .. 3 Red post fl 0·5, ec 3, fl 0·5, ec 9.
ES, II, 31360·1 L'Estartit. Inner Breakwater. 3 12·33 E 3 Sync with E0474·4
Head
* * * * * * * *

E6534 L'Île Srigina (Îlot de 36 56·27 N Fl R 5s 54 19 White square tower fl 0·6.


DZ, , 3800 Serigina) 6 53·17 E 12 Obscured by Pointe Esrah when
bearing less than 122°
*

E6636 Port Cherchell. Forte 36 36·69 N Fl(2+1)W 15s 37 25 Grey truncated fl 0·1, ec 2·4, (fl 0·1, ec 6·15) x 2.
DZ, , 2200 Joinville 2 11·34 E conical tower W(Unintens)326°-037·5°(71·5°),
26 W037·5°-326°(288·5°)
*

E6650 Port de Ténès. Jetée NW. 36 31·59 N Oc(2)G 6s 10 7 White round tower ec 1, lt 1, ec 1, lt 3.
DZ, , 2102 Head 1 18·98 E 7 G226°-116°(250°).
TE 2019
*

E6654 Sidi Abderrahmane. Pier 36 29·68 N Fl(2)R 5s 8 6 .. fl 0·5, ec 1, fl 0·5, ec 3.


1 05·81 E TE 2019
*

E6656 Nadji 36 26·57 N Fl(3)W 15s 60 24 Yellow square tower (fl 0·2, ec 2·8) x 2, fl 0·2, ec 8·8
DZ, , 1900 0 56·35 E on red building
29
- .. Reserve light
*

E6726 Port de Ghazaouet. Môle E 35 06·22 N FG 8 5 Black round metal


DZ, , 1102 1 51·97 W column
6
*

5.4 Wk49/19
V

NP79, Vol F Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

F1685·78 - Banyan 1 13·35 N Fl(2)W 10s 11 5 Black # on black TE; replaced by isolated danger
103 41·58 E beacon, red band buoy Fl(2)10s close SW (T) 2019
*

F1693·2 - Pulau Satumu. Semaphore 1 09·65 N Iso W 10s 41 6 Metal framework Traffic Signals. Shown where VLCC
tower 103 44·47 E tower crosses Main Strait. Black > by day, ×
by night. TE 2019
*

F1695 - Sebarok 1 11·87 N Fl R 5s 8 5 Red beacon See F1694·9. TE; replaced by port
103 48·43 E lateral buoy Fl R 5s close SE (T)
2019
-- .. AIS .. .. .. MMSI No 995630022
*

F1926·1 Kuala Suai. Ldg Lts. Rear. 3 47·66 N Fl W 6s 9 8 White +


MY, , 2002·2 30m from front 113 29·89 E
* *

F3152 Van Fong Bay. Hon Do 12 28·88 N Fl(2)W 10s 81 12 Grey round concrete fl 0·5, ec 1·5, fl 0·5, ec 7·5.
109 21·58 E tower W122°-092°(330°)
11
*

F3200·5 - Van Ca. Headland. T 15 24·12 N Fl(3+1)Y 12s .. . . × on yellow beacon


108 47·42 E
* * * * * * * *

NP80, Vol G Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 47, dated 21 November 2019.

G0914 - Ldg Lts 293°. Rear 37 55·56 S Mo(K) W 9s 16 10 Red U, white stripe fl 1·5, ec 0·5, fl 0·5, ec 0·5, fl 1·5, ec
AR, H212, 1006 57 31·57 W on Red Lattice 4·5.
Framework W190°-015°(185°).
12 Marks submarine outfall
* * * * * * *

G0914·1 - Ldg Lts 293°. Front 37 55·64 S Iso R 3s .. 4 .. R268°-318°(50°).


AR, H212, 1006·1 57 31·35 W Temporary position (P) 2019
* * * * * * * *

5.5 Wk49/19
V

NP81, Vol H Edition 2019/20. NEW EDITION Weekly Edition No. 49, Dated 05 December 2019.
NOTE: These are the first updates issued for the New Edition.

Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP81, Vol H Edition 2019/20 New Edition.

TUKTOYAKTUK HARBOUR
H0012·1 - Tuktoyaktuk Island 69 27·35 N FW 22 17 red U, white band, on Seasonal
CA, IW, 2508 132 59·98 W tripod framework
tower
12
-- .. Racon .. .. .. ALRS Vol 2 Station 99077
* *

H0116 - Forteau Harbour. Wharf 51 28·17 N Fl Y 4s 5 . . Mast Seasonal


CA, N, 228 56 57·20 W 3
* * * * *

H0348 W of Burin Peninsula. 46 52·78 N Iso W 10s 45 15 Red and white U, on Shown 24 hours
CA, N, 100 Green Island 56 05·14 W square framework
tower
7
-- .. Horn 60s .. .. .. bl 4.
Horn points 089°
* *

BURIN PENINSULA. LAMALINE HARBOUR


H0350 - Allan's Island 46 50·80 N Fl W 4s 19 16 White tower, red top fl 1
CA, N, 76 55 47·86 W 11
-- .. Horn 30s .. .. .. bl 3.
Horn points S
* * *

H0540·68 - Summerville Wharf 48 27·23 N Fl Y 4s .. 2 Round mast Seasonal


CA, N, 442·519 53 33·29 W
* * *

H0664·5 - Point of Bay. Wharf 49 15·63 N Fl R 4s .. 2 Mast Seasonal


CA, N, 350·1 55 14·61 W 3
*

H0665·5 - Phillips Head. Wharf 49 13·50 N Fl R 4s .. 4 Mast Seasonal


CA, N, 350·6 55 18·36 W 2
* *

H0666 - Lower Sandy Point 49 12·63 N Fl G 6s 5 . . Green and white fl 0·5


CA, N, 351 55 17·82 W daymark on square
framework tower
5
* * *

H0768 - Crawleys Creek. Ldg Lts 46 09·01 N Iso G 4s 4 3 White (, black Shown 24 hours
CA, A, 785·84 235°21′. Front 60 13·35 W stripe, on pyramid
tower
* * *

H0768·1 - Crawleys Creek. Ldg Lts 46 08·96 N Iso G 4s 9 3 White D, black Shown 24 hours
CA, A, 785·85 235°21′. Rear. 174·5m from 60 13·46 W stripe, on pyramid
front tower
* * *

H3621·6 - CFB Halifax 44 39·71 N FR .. .. .. Private


63 35·23 W
* * * * * * * *

H3621·7 - CFB Halifax 44 39·80 N FR .. .. .. Private


63 35·37 W
* * * * * * * *

5.6 Wk49/19
V

NP81, Vol H Edition 2019/20 continued.

MACHIAS SEAL ISLAND


H4189 - North Rock 44 32·26 N Fl R 6s 14 . . White cylinder tower, fl 1
CA, A, 5·8 67 05·23 W red bands
-- .. AIS .. .. .. MMSI No 993676005
* * * * * * * *

GRAND BANKS OF NEWFOUNDLAND. TERRA NOVA FIELD


H4425 Remove from list; deleted

NP82, Vol J Edition 2018/19. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

J0242·2 - Sprague Fuel Terminal. 43 06·99 N FG 3 . . Dolphin Private


US, I, 8525 Center 70 48·63 W
* *

J0574 - Mount Hope Bay. Brayton 41 42·72 N FR 4 .. .. Private


US, I, 18915 Point Channel. Ldg Lts 71 11·41 W
324·6°. Front
* * * * * * * *

J0574·1 - Mount Hope Bay. Brayton 41 42·77 N QR 5 .. .. Private


US, I, 18917 Point Channel. Ldg Lts 71 11·46 W
324·6°. Rear. 120m from
front
* * * * * * * *

J2853·31 - D Ldg Lts 350·5°. Rear. 1M 30 47·74 N Iso R 6s 15 . . Red U, white stripe,
US, III, 6910 from front 81 29·47 W yellow band, on
US, III, 37745 framework tower on
US, III, 6911 piles
US, III, 37746 - - - - Passing light .. 2QW 3 5 .. Synchronized. Located on NE and SE
corners of platform
* * * * * * * *

RIVIÈRE DE CAYENNE. APPROACHES. L'ENFANT PERDU


J6901 - Enfant Perdu 5 02·53 N Fl W 4s 17 11 White truncated fl 1.
FR, LD, 18700 (FR) 52 21·26 W conical tower, red top TE 2019
15
- - Emergency light .. FW 17 7
*

NP83, Vol K Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 47, dated 21 November 2019.

K2592·6 - Currumbene Creek. Ldg Lts 35 02·28 S F Bu .. . . Red %


244°. Front 150 40·24 E
---- .. By day .. .. .. Shown in poor visibility
*

K2592·61 - Currumbene Creek. Ldg Lts 35 02·29 S F Bu .. . . Red +


244°. Rear. 64m from front 150 40·23 E
----- .. By day .. .. .. Shown in poor visibility
*

5.7 Wk49/19
V

NP83, Vol K Edition 2019/20 continued.

K2592·626 - Currambene Creek. No 28 35 01·56 S Fl R 3s .. . . Red beacon


150 40·11 E
* * * * * * * *

K2592·627 - Currambene Creek. No 29 35 01·44 S Fl G 3s .. . . Green beacon


150 39·90 E
* * * * * * * *

K2593·1 - No 4. Huskisson Reef 35 02·09 S Fl R 3s .. . . Red beacon


150 40·72 E
* * * * * * * *

ÎLE DE LIFOU
K4834 - Cap des Pins 21 03·55 S Fl(2+1)W 15s 90 15 White pylon, black fl 0·1, ec 2·5, (fl 0·1, ec 6·1) x 2.
FR, LC, 51820 (FR) 167 27·40 E top TE; replaced by light Fl(3)15s 12m
30 4M, close E (T) 2019
*

NP84, Vol L Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

NORDMØREFJORDENE
L1048 - Omsundet. Omsbrørnes. 63 06·42 N Oc WRG 6s 2 W2·6 Column G241·5°-253·6°(12·1°),
NO, , 381000 SW Side 7 50·92 E R1·9 5 W253·6°-265·6°(12°),
G1·9 R265·6°-084·3°(178·7°),
G084·3°-094·9°(10·6°)
* *

L1068 - Sunndalsfjorden. Flåøy 62 44·90 N Oc(3)WRG 10s 5 W5·8 Framework tower G283°-288·5°(5·5°),
NO, , 383600 8 26·73 E R4·6 6 W288·5°-316·9°(28·4°),
G4·6 R316·9°-019·4°(62·5°),
G019·4°-121·3°(101·9°),
W121·3°-128·2°(6·9°),
R128·2°-135·6°(7·4°)
* *

L1088 - Todalsfjorden 62 50·21 N Iso WRG 6s 4 W3·4 Pile G146·4°-159·5°(13·1°),


NO, , 386600 8 37·45 E R2·5 3 W159·5°-173·6°(14·1°),
G2·5 R173·6°-196·6°(23°),
G196·6°-278°(81·4°),
W278°-287·1°(9·1°),
R287·1°-294·4°(7·3°)
* *

L1107 - Gjerdesvika. Stenholmen 63 17·04 N Iso WRG 6s 9 W5·8 Post G061·4°-079°(17·6°),


NO, , 388700 8 19·65 E R4·5 3 W079°-110·4°(31·4°),
G4·5 R110·4°-204·6°(94·2°),
G204·6°-254·2°(49·6°),
W254·2°-267·4°(13·2°),
R267·4°-276·6°(9·2°)
* *

L5942 Jakobshavn (Ilulissat). Inner 69 13·14 N Iso G 2s 39 4·5 Orange % on


DK, , 7748B Harbour. Ldg Lts 142·9°. 51 05·21 W framework mast
Front
* * * * *

L5942·1 Jakobshavn (Ilulissat). Inner 69 13·12 N Iso G 4s 41 4·5 Orange + on


DK, , 7748A Harbour. Ldg Lts 142·9°. 51 05·16 W framework mast
Rear. 54m from front
* * * * * *

5.8 Wk49/19
V

NP85, Vol M Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

M4154·22 - Gauido 36 41·01 N QW 12 8 ) on yellow round


KR, 410, 3290·8 126 04·51 E tower, black top
21
* *

M4164·201 - Yeonheungdo. Pylons. B 37 14·65 N Fl(4)Y 8s .. 6 Pylon


KR, 410, 3503·2 126 30·01 E
---- .. Horn 50s .. .. .. bl 5.
TD 2019
*

M4164·213 - Yeonheungdo. Pylons. P 37 14·41 N Fl Y 4s .. 6 Pylon


KR, 410, 3503·14 126 29·27 E
---- .. Horn 50s .. .. .. bl 5.
TD 2019
*

M4222·2 - Daeheuksando. Juk Hang 34 40·84 N Fl(2)W 6s 29 8 White round concrete W220°-040°(180°)
KR, 410, 3035 125 12·14 E tower
8
--- .. Racon .. .. .. ALRS Vol 2 Station 82520
*

M4305·3601 Dunbyeong. Bridge. P2 34 37·18 N FY 15 8 Bridge pier


KR, 410, 2537·33 127 32·69 E
* * * * * * * *

M4305·3602 Dunbyeong. Bridge. P1 34 37·18 N FY 15 8 Bridge pier


KR, 410, 2537·33 127 32·70 E
* * * * * * * *

M4305·3603 Dunbyeong. Bridge. S2 34 37·22 N FY 16 8 Bridge pier


KR, 410, 2537·33 127 32·68 E
* * * * * * * *

M4305·3604 Dunbyeong. Bridge. S1 34 37·22 N FY 16 8 Bridge pier


KR, 410, 2537·33 127 32·69 E
* * * * * * * *

M4305·3605 Dunbyeong. Bridge. P3 34 37·26 N FY 17 8 Bridge piers


KR, 410, 2537·33 127 32·68 E
- - P4 .. FY 17 8
* * * * * * * *

M4305·3606 Dunbyeong. Bridge. L2 34 37·28 N FG 20 7 Bridge pier


KR, 410, 2537·33 127 32·67 E
* * * * * * * *

M4305·3607 Dunbyeong. Bridge. L1 34 37·28 N FG 20 7 Bridge pier


KR, 410, 2537·33 127 32·68 E
* * * * * * * *

M4305·3608 Renumbered; was previously M4305.37


KR, 410, 2537·33
Dunbyeong. Bridge. C1 34 37·30 N FW 20 7 Bridge centre
127 32·67 E
- - C2 .. FW 20 7
* * * * * * * *

M4305·3609 Dunbyeong. Bridge. R2 34 37·32 N FR 21 8 Bridge pier


KR, 410, 2537·33 127 32·66 E
* * * * * * * *

5.9 Wk49/19
V

NP85, Vol M Edition 2019/20 continued.

M4305·361 Dunbyeong. Bridge. R1 34 37·33 N FR 21 8 Bridge pier


KR, 410, 2537·33 127 32·67 E
* * * * * * * *

M4305·3611 Dunbyeong. Bridge. P6 34 37·35 N FY 17 8 Bridge pier


KR, 410, 2537·33 127 32·66 E
* * * * * * * *

M4305·3612 Dunbyeong. Bridge. P5 34 37·35 N FY 17 8 Bridge pier


KR, 410, 2537·33 127 32·67 E
* * * * * * * *

M4305·3613 Dunbyeong. Bridge. S4 34 37·39 N FY 18 8 Bridge pier


KR, 410, 2537·33 127 32·66 E
* * * * * * * *

M4305·3614 Dunbyeong. Bridge. S3 34 37·39 N FY 18 8 Bridge pier


KR, 410, 2537·33 127 32·67 E
* * * * * * * *

M4305·3615 Dunbyeong. Bridge. P8 34 37·43 N FY 18 8 Bridge pier


KR, 410, 2537·33 127 32·67 E
* * * * * * * *

M4305·3616 Dunbyeong. Bridge. P7 34 37·43 N FY 18 8 Bridge pier


KR, 410, 2537·33 127 32·68 E
* * * * * * * *

M4305·37 Remove from list; renumbered to M4305.3608

M4369·001 - South Harbour Bridge. PR2 35 04·71 N Fl Y 4s 3 7


KR, 410, 2027·2 129 01·57 E
* * * * * * * *

M4369·002 - South Harbour Bridge. PR3 35 04·72 N Fl Y 4s 3 7


KR, 410, 2027·3 129 01·61 E
* * * * * * * *

M4369·003 - South Harbour Bridge. PR4 35 04·73 N Fl Y 4s 3 7


KR, 410, 2027·4 129 01·65 E
* * * * * * * *

M4369·004 - South Harbour Bridge. PR5 35 04·74 N Fl Y 4s 3 7


KR, 410, 2027·5 129 01·71 E
* * * * * * * *

M4369·005 - South Harbour Bridge. PR6 35 04·75 N Fl Y 4s 3 7


KR, 410, 2027·6 129 01·77 E
* * * * * * * *

M4369·006 - South Harbour Bridge. PR7 35 04·77 N Fl Y 4s 3 7


KR, 410, 2027·7 129 01·81 E
* * * * * * * *

M4369·007 - South Harbour Bridge. 35 04·82 N Fl Y 4s 3 7


KR, 410, 2027·8 PR8-IN 129 01·87 E
* * * * * * * *

M4369·008 - South Harbour Bridge. 35 04·78 N Fl Y 4s 3 7


KR, 410, 2027·9 PR8-OUT 129 01·89 E
* * * * * * * *

5.10 Wk49/19
V

NP85, Vol M Edition 2019/20 continued.

M4369·009 - South Harbour Bridge. 35 04·84 N Fl Y 4s 3 7


KR, 410, 2027·10 PR9-IN 129 01·98 E
* * * * * * * *

M4369·01 - South Harbour Bridge. 35 04·80 N Fl Y 4s 3 7


KR, 410, 2027·11 PR9-OUT 129 01·99 E
* * * * * * * *

M4369·011 - South Harbour Bridge. 35 04·82 N Fl Y 4s 3 7


KR, 410, 2027·12 PR10 129 02·05 E
* * * * * * * *

M4369·012 - South Harbour Bridge. 35 04·83 N Fl Y 4s 3 7


KR, 410, 2027·13 PR11 129 02·11 E
* * * * * * * *

M4369·013 - South Harbour Bridge. 35 04·84 N Fl Y 4s 3 7


KR, 410, 2027·14 PR12 129 02·17 E
* * * * * * * *

M4369·014 - South Harbour Bridge. 35 04·86 N Fl Y 4s 3 7


KR, 410, 2027·15 PR13 129 02·24 E
* * * * * * * *

M4369·015 - South Harbour Bridge. 35 04·88 N Fl Y 4s 3 7


KR, 410, 2027·16 PR14 129 02·29 E
* * * * * * * *

M4413·2 - Pohang. Guhang. E 36 02·76 N Fl R 5s 15 15 Red round concrete


KR, 410, 1316 Breakwater. Head 129 23·09 E tower
11
*

M4456 Gisamundan 38 01·32 N Fl W 6s 32 12 White round concrete


KR, 410, 1223 128 44·14 E tower
10
*

M8085 - Nachal'nyy 53 14·72 N Fl R 6s 94 5 White U, red stripe, fl 0·5.


RU, 2401, 3385 159 55·60 E on 4-sided metal Shown 15/6 to 30/11
framework tower
6
*

NP87, Vol P Edition 2019/20. Weekly Edition No. 49, Dated 05 December 2019.
Last Updates: Weekly Edition No. 48, dated 28 November 2019.

P4623·62 - Zhongzhou Fishing 22 34·57 N FG 4 8·5 Round column


TW, 5, 31630 Harbour. Inner Breakwater 120 17·93 E 4
* * * * * * * *

P4623·65 - Zhongzhou Fishing 22 34·58 N FR 4 8·5 Round column


TW, 5, 31620 Harbour. Outer Breakwater 120 17·97 E 4
* * * * * * * *

P4672·05 Yeh-liu Pan-tao. Jetty. Head 25 12·58 N Fl R 4s .. 9·5 Red beacon


TW, , 10481 121 41·25 E 8
* * * *

5.11 Wk49/19
V

NP87, Vol P Edition 2019/20 continued.

P4672·1 Yeh-liu Pan-tao. Jetty. Head 25 12·46 N Fl R 4s .. 9·5 Red beacon


TW, , 10480 121 41·22 E 4
* * *

P4672·12 Yeh-liu Pan-tao. Jetty. Head 25 12·50 N Fl G 8s .. 9·5 Green beacon


TW, , 10470 121 41·32 E 8
* * *

P4672·14 Yeh-liu Pan-tao. Jetty. Head 25 12·26 N Fl G 5s .. 9·5 Green beacon


TW, , 10440 121 41·64 E 8
* * *

P4672·145 Yeh-liu Pan-tao. Jetty. Head 25 12·26 N Fl R 4s .. 9·5 Red beacon


TW, , 10450 121 41·59 E 6
* * * * * * * *

P4672·15 Yeh-liu Pan-tao. Jetty. Head 25 11·68 N Fl R 4s .. 9·5 Red beacon


TW, , 10430 121 41·37 E 8
* * *

P4672·23 Ta-wu-lun-ao. Jetty. Head 25 10·96 N Fl G 4s .. 9·5 Green beacon fl 1


TW, , 10410 121 41·79 E 8
* * *

P4672·24 Ta-wu-lun-ao. Jetty. Head 25 10·89 N Fl R 4s .. 9·5 Red beacon fl 1


TW, , 10420 121 41·78 E 8
* * *

NP88, Vol Q Edition 2020/21. NEW EDITION Weekly Edition No. 49, Dated 05 December 2019.
NOTE: These are the first updates issued for the New Edition.

Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP88, Vol Q Edition 2020/21 New Edition.

Q0998·5 - Tg Kelian. Haji Reef 2 05·79 S Fl W 5s 10 12 White beacon fl 0·5


(ID) 105 06·62 E
* * * * * * * *

Q1054·905 Teluk Banten 5 58·68 S Fl Y 4s 17 6 Yellow × on yellow fl 1


ID, , 2318·18 (ID) 106 07·44 E post on dolphin
7
* * * * * * * *

Q1070·1 - Sunda Kelapa. Muara 6 06·40 S Fl G 5s 10 8 Green % on green fl 0·5


ID, , 1761·2 Karang 106 47·18 E beacon
(ID)
*

Q1070·2 - Sunda Kelapa. Muara 6 06·40 S Fl R 5s 10 8 Red & on red beacon fl 0·5
ID, , 1761·3 Karang 106 47·22 E
(ID)
* *

Q1070·4 - Sunda Kelapa. Muara 6 06·07 S Fl R 3s 12 10 Red & on red beacon fl 0·5
ID, , 1761·5 Karang 106 47·29 E
(ID)
* *

5.12 Wk49/19
V

NP88, Vol Q Edition 2020/21 continued.

Q1086·64 - OMA 6 18·50 S QW .. 10 Platform


(ID) 108 32·15 E
*

Q1086·642 - OMA 6 20·22 S Q W 1s .. 9·8 Platform


(ID) 108 34·09 E
* * * * * * * *

Q1086·651 - XA-FTA 6 18·14 S Fl(4)W 15s 36 12 Platform


(ID) 108 37·92 E
-- .. Racon .. .. .. ALRS Vol 2 Station 86473
* * *

Q1087·4 Pelabuhan Balongan. N 6 21·51 S Fl G 2s .. . . Green % on green


Breakwater. Head 108 23·54 E beacon
(ID)
* * *

Q1087·5 Pelabuhan Balongan. S 6 21·56 S Fl(2)R 6s .. . . Red & on red beacon


Breakwater. Head 108 23·57 E
(ID)
* * *

Q1088 Pelabuhan Balongan. Jetty. 6 22·92 S Fl W .. . . White beacon


Head 108 24·49 E
(ID)
* * * * * * * *

Q1290 - Tg Serangan 8 43·11 S Fl W 5s 12 12 White metal fl 0·5


ID, , 4169 (ID) 115 15·41 E framework structure
10
*

Q1294·86 - Teluk Kombal. Pamenang 8 23·63 S Fl W 3s 20 18 White beacon


Port 116 05·96 E
(ID)
* * *

Q1295·55 - Santigi Bay 8 30·02 S Fl W 3s 13 12 White beacon


(ID) 116 02·55 E
* * *

Q1429·98 Tg Kandangaur. Tanah 3 44·97 S LFl W 6s 19 12 White pile beacon fl 2


ID, , 4348·6 Bambu 115 38·38 E 14
* * * * * * * *

Q1558·85 T. Wowobatu 4 03·52 S Fl W 10s 14 9 White pipe beacon fl 1


ID, , 5579·22 (ID) 122 39·59 E 7
* * * * * * * *

Q1558·88 T. Wowobatu. No 1 4 03·65 S Fl G 3s 10 6 Green % on green fl 1


ID, , 5579·20 (ID) 122 40·26 E pipe beacon
7
* * * * * * * *

JOSEPH BONAPARTE GULF. CAMBRIDGE GULF. WEST ARM


Q1636·7 Remove from list; deleted

BARROW ISLAND
Q1692·59 Remove from list; deleted

BARROW ISLAND
Q1692·592 Remove from list; deleted

5.13 Wk49/19
V

NP88, Vol Q Edition 2020/21 continued.

Q1697·8 Remove from list; deleted

ASHBURTON
Q1702·711 - Ashburton Road. G01 21 31·42 S VQ G 8 3·5 Green % on green
115 02·80 E beacon
* * * * * * * *

Q1702·712 - Ashburton Road. R01 21 31·45 S VQ R 15 3·5 Red & on red beacon
115 02·94 E
--- .. Racon .. .. .. ALRS Vol 2 Station 87440
* * * * * * * *

Q1702·713 - Ashburton Road. G02 21 32·19 S Fl G 4s 8 3·5 Green % on green


115 02·60 E beacon
* * * * * * * *

Q1702·714 - Ashburton Road. R02 21 32·23 S Fl R 4s 8 3·5 Red & on red beacon
115 02·74 E
* * * * * * * *

Q1702·715 - Ashburton Road. G03 21 33·17 S Fl G 4s 8 3·5 Green % on green


115 02·34 E beacon
* * * * * * * *

Q1702·716 - Ashburton Road. R03 21 33·20 S Fl R 4s 8 3·5 Red & on red beacon
115 02·48 E
* * * * * * * *

Q1702·717 - Ashburton Road. G04 21 34·14 S Fl G 4s 8 3·5 Green % on green


115 02·09 E beacon
* * * * * * * *

Q1702·718 - Ashburton Road. R04 21 34·17 S Fl R 4s 8 3·5 Red & on red beacon
115 02·23 E
* * * * * * * *

Q1702·719 - Ashburton Road. G05 21 35·11 S Fl G 4s 8 3·5 Green % on green


115 01·83 E beacon
* * * * * * * *

Q1702·72 - Ashburton Road. R05 21 35·15 S Fl R 4s 15 3·5 Red & on grey


115 01·98 E beacon
* * * * * * * *

Q1702·721 - Ashburton Road. G06 21 36·09 S Fl G 4s 8 3·5 Green % on green


115 01·58 E beacon
* * * * * * * *

Q1702·722 - Ashburton Road. R06 21 36·12 S Fl R 4s 8 3·5 Red & on red beacon
115 01·72 E
* * * * * * * *

Q1702·723 - Ashburton Road. G07 21 37·06 S Fl G 4s 8 3·5 Green % on green


115 01·32 E beacon
* * * * * * * *

Q1702·724 - Ashburton Road. R07 21 37·10 S Fl R 4s 8 3·5 Red & on red beacon
115 01·47 E
* * * * * * * *

Q1702·725 - Ashburton Road. G08 21 38·04 S Fl G 4s 8 3·5 Green % on green


115 01·07 E beacon
* * * * * * * *

5.14 Wk49/19
V

NP88, Vol Q Edition 2020/21 continued.

Q1702·726 - Ashburton Road. R08 21 38·07 S Fl R 4s 8 3·5 Red & on red beacon
115 01·21 E
* * * * * * * *

Q1756·5 - S Breakwater 30 17·32 S Fl G 3s 7 3 .. fl 0·3


115 02·37 E
* * * *

Q1756·52 - N Breakwater 30 17·29 S Fl R 3s 7 3 .. fl 0·3


115 02·45 E
* * * *

Q1801·09 - 35 00·03 S Fl R 3s .. 2 Red & on white fl 0·3


117 56·83 E beacon
* * *

Q1801·1 - 34 59·90 S Fl(2)R 5s .. 2 Red & on white fl 0·5, ec 1, fl 0·5, ec 3


117 56·93 E beacon
* * *

KING GEORGE SOUND. OYSTER HARBOUR


Q1801·16 - 34 59·70 S Fl G 3s .. 2 Green % on green fl 0·7
117 57·12 E beacon
* *

Q1801·19 - No 1 34 59·62 S Fl G 3s .. 2 Green % on green fl 0·3


117 57·13 E beacon
* * *

Q1801·2 - No 2 34 59·60 S Fl R 3s .. 3 Red & on red beacon fl 0·3


117 57·10 E
* * * *

Q1801·24 - No 3 34 59·51 S Fl G 3s .. 2 Green % on green fl 0·3


117 57·11 E beacon
* * *

Q1801·25 - No 4 34 59·48 S Fl R 3s .. 3 Red & on red beacon fl 0·3


117 57·06 E
* * * *

Q1801·26 - No 3A 34 59·44 S Fl G 3s .. 3 Green % on green


117 57·06 E beacon
* * * * * * * *

Q1801·3 - No 6 34 59·48 S Fl R 3s .. 3 Red & on red beacon fl 0·3


117 56·82 E
* * * *

Q1801·35 - No 5 34 59·48 S Fl G 3s .. 3 Green % on white fl 0·3


117 56·80 E beacon
* * * *

KING GEORGE SOUND. OYSTER HARBOUR


Q1801·39 - 34 59·59 S Fl G 3s .. 3 Green % on white
117 56·73 E beacon
* * * * * * * *

Q1801·4 - No 8 34 59·63 S Fl R 3s .. 3 Red & on red beacon fl 0·3


117 56·72 E
* * * *

5.15 Wk49/19
V

NP88, Vol Q Edition 2020/21 continued.

Q1801·65 - Green Island. W 34 59·16 S Fl G 3s .. 2 Green % on green fl 0·7


117 57·02 E beacon
* *

Q1801·66 - 34 59·31 S QW .. 2 ) on yellow beacon,


117 57·92 E black top
*

Q1801·72 - 34 58·84 S Fl G 3s .. 2 Green % on green fl 0·7


117 56·98 E beacon
* *

Q1801·73 - Bayonet Head. E 34 58·84 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 56·89 E
* *

Q1801·77 - 34 58·08 S Fl G 3s .. 2 Green % on green fl 0·7


117 57·02 E beacon
* *

Q1801·78 - 34 58·08 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 56·90 E
* *

Q1801·8 - 34 57·76 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 57·00 E
* *

Q1801·82 - 34 57·66 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 57·00 E
* *

Q1801·83 - 34 57·58 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 56·96 E
* *

Q1801·84 - 34 57·54 S Fl R 4s .. 2 Red & on red beacon fl 0·8


117 56·91 E
* *

Q1801·85 - 34 57·52 S Fl G 4s .. 2 Green % on green fl 0·8


117 56·89 E beacon
* *

Q1801·86 - 34 57·48 S Fl G 3s .. 2 Green % on green fl 0·7


117 57·13 E beacon
* *

Q1801·89 - 34 57·16 S Fl R 3s .. 2 Red & on red beacon fl 0·7


117 57·22 E
* *

Q2061·4 - No 22 34 45·77 S Fl R 2s .. . . Red & on beacon Destroyed; special buoy in situ (T)
138 29·62 E 2019
*

Q3354·4 - Tanah Merah. N 2 23·82 S Fl G 5 5 Green % on green


ID, , 6091·9 (ID) 133 06·98 E buoyant beacon
*

5.16 Wk49/19
VI

UPDATES TO ADMIRALTY LIST OF RADIO SIGNALS


Weekly Edition No. 49 dated 05 December 2019

The ADMIRALTY List of Radio Signals diagrams included in the paper version of the weekly Notice to Mariners (Section
VI) are printed in black and white. If required, a colour version of these diagrams can be downloaded from
www.admiralty.co.uk/maritime-safety-information. To obtain the colour versions select View and download NMs – select
Weekly – select Year – select Week – go to Selected Week Content – select File (for example:
NP286(3)–WK01–14–PAGE149_Week01_2019.pdf)

VOLUME 2, NP282(1), 2019/20


Published Wk 13/19
(Last Updates: Weekly Edition No. 48 dated 28 November 2019)

RADAR BEACONS

PAGE 14, NETHERLANDS.


54870 L16-Logger Platform.
Delete entry

Netherlands Notice 46/402/19 (RSDRA2019000275565) 49/19

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 162, UNITED KINGDOM.


Beatrice Windfarm East Lt Buoy.
Delete entry

Northern Lighthouse Board correspondence (RSDRA2019000256266) 49/19

PAGE 162, UNITED KINGDOM.


Beatrice Windfarm North Lt Buoy.
Delete entry

Northern Lighthouse Board correspondence (RSDRA2019000256266) 49/19

PAGE 162, UNITED KINGDOM.


Beatrice Windfarm South Lt Buoy.
Delete entry

Northern Lighthouse Board correspondence (RSDRA2019000256266) 49/19

PAGE 162, UNITED KINGDOM.


Beatrice Windfarm West Lt Buoy.
Delete entry

Northern Lighthouse Board correspondence (RSDRA2019000256266) 49/19

VOLUME 2, NP282(2), 2019/20


Published Wk 13/19
(Last Updates: Weekly Edition No. 48 dated 28 November 2019)

RADAR BEACONS

PAGE 66, CHILE.


92000 Banco Belen Lt.
Delete entry and replace by:

Banco Belén Lt Bn 36°41′·81S 73°05′·00W 3 & 10 360° 4 B 92000

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

Wk49/19
6.1
6.1
VI
VI

AUTOMATIC IDENTIFICATION SYSTEM (AIS)

PAGE 92, ARGENTINA, below Buenos Aires Access Channel Black Yellow Black Lt Buoy Km 7.3.
Insert:

Buenos Aires Access Channel Port


34°35′·72S 58°21′·85W 997011030 Virtual
Lt Bn Km 0

Argentine Bulletin 11/19 (RSDRA2019000268476) 49/19

PAGE 94, ARGENTINA, below Buenos Aires Access Channel Port Lt Buoy No Km 9.
Insert:

Buenos Aires Access Channel


34°35′·67S 58°21′·87W 997011029 Virtual
Starboard Lt Bn Km 0

Argentine Bulletin 11/19 (RSDRA2019000268476) 49/19

PAGE 102, AUSTRALIA.


Portsea Surf Beach Lt Buoy.
Delete entry

(former update 39/19)


Australian Notice 23/1211/19 (RSDRA2019000275831) 49/19

PAGE 104, CHILE, above Aguada Posterior Bn.


Insert:

Aguada Anterior Bn 52°03′·50S 73°02′·10W 997251114 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Bajo Caution Norte Lt Buoy.


Insert:

Bajo Colo Colo Lt Bn 41°45′·21S 73°43′·42W 997251044 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Bajo Satélite Lt.


Insert:

Bajo Young Shoal 41°46′·05S 73°43′·33W 997256031 Broadcasts every 3 minutes Virtual

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Bajo Zealous Buoy.


Insert:

Banco Belén Lt Bn 36°41′·81S 73°05′·00W 997251026 Broadcasts every 3 minutes Real

Banco Belén Weste Lt Buoy 36°41′·75S 73°05′·23W 997256028 Broadcasts every 3 minutes Virtual

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Cerro Dirección Lt.


Insert:

Chinquihue Port Lt Bn 41°29′·95S 72°59′·17W 997251041 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

Wk49/19 6.2
6.2
VI
VI

PAGE 104, CHILE.


Costanera Este Lt Bn.
Delete entry and replace by:

Costanera Este Lt Bn 41°28′·80S 72°56′·97W 997251058 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE.


Costanera Weste Lt Bn.
Delete entry and replace by:

Costanera Weste Lt Bn 41°28′·87S 72°57′·12W 997251056 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Crawford Lt.


Insert:

Doña Sebastiana Este Lt Bn 41°44′·71S 73°48′·28W 997251042 Broadcasts every 3 minutes Real

Doña Sebastiana Weste Lt Bn 41°44′·55S 73°49′·04W 997251043 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 104, CHILE, below Enfilación Isla Tenglo Posterior Lt.


Insert:

Ex Vapor Huasco Lt Buoy 36°42′·62S 73°06′·00W 997251049 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Isla Crossover Lt.


Insert:

Isla Diego Portales Posterior Bn 52°03′·32S 73°00′·23W 997251111 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Isla Medio Canal South Bn.


Insert:

Isla Merino Anterior Bn 52°03′·47S 73°00′·67W 997251110 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Malecón de Atraque Lt.


Insert:

Molo 331 Lt Bn 36°41′·84S 73°06′·12W 997251048 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Muelle Policarpo Toro Lt Bn.


Insert:

Pam Haugaut Lt Bn 36°42′·00S 73°05′·04W 997251047 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Puerto Progreso Lt Bn.


Insert:

Punta Anselmo Port Lt Bn 41°30′·79S 72°59′·82W 997251046 Broadcasts every 3 minutes Real

6.3 Wk49/19
Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19 6.3
Insert:

Pam Haugaut Lt Bn 36°42′·00S 73°05′·04W 997251047 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19 VI

PAGE 106, CHILE, below Puerto Progreso Lt Bn.


Insert:

Punta Anselmo Port Lt Bn 41°30′·79S 72°59′·82W 997251046 Broadcasts every 3 minutes Real
VI
6.3
Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Punta Boca Bn.


Insert:

Punta Codina Stbd Lt Bn 41°30′·93S 72°59′·71W 997251045 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Punta Duprat, Molo de Abrigo Lt.


Insert:

Punta Escobén Anterior Bn 52°03′·37S 73°01′·17W 997251112 Broadcasts every 3 minutes Real

Punta Escobén Posterior Bn 52°03′·37S 73°01′·15W 997251113 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Punta Kirke Sur Lt.


Insert:

Punta Lenqui Lt Bn 41°45′·33S 73°39′·84W 997251040 Broadcasts every 3 minutes Real

Punta Lutrín Lt Bn 37°05′·65S 73°10′·29W 997251027 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Punta Panul Lt.


Insert:

Punta Puchoco Lt Bn 37°01′·72S 73°10′·63W 997251050 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE.


Punta Restinga Bn.
Delete entry and replace by:

Punta Restinga Bn 53°03′·53S 73°00′·65W 997251011 Broadcasts every 3 minutes Virtual

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE, below Punta Restinga Bn.


Insert:

Roca Boca Maule 37°01′·08S 73°11′·51W 997256029 Broadcasts every 3 minutes Virtual

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

PAGE 106, CHILE.


Tenglo Oeste Lt Bn.
Delete entry and replace by:

Tenglo Weste Lt Bn 41°28′·92S 72°57′·07W 997251057 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19

LEGAL TIME

PAGE 248, Fiji.


DeleteWk49/19
entry and replace by: 6.4
Fiji -12 -13 10 Nov 2019 0200h 12 Jan 2020 0300h
Delete entry and replace by:

Tenglo Weste Lt Bn 41°28′·92S 72°57′·07W 997251057 Broadcasts every 3 minutes Real

Chilean Bulletin 11/19 (RSDRA2019000268978) 49/19 VI

LEGAL TIME

PAGE 248, Fiji.


Delete entry and replace by:

Fiji -12 -13 10 Nov 2019 0200h 12 Jan 2020 0300h


1 Nov 2020 17 Jan 2021
7 Nov 2021 16 Jan 2022
6 Nov 2022 15 Jan 2023
5 Nov 2023 14 Jan 2024
6.4
Fiji Coastal Navigational Warning 45/19 (RSDRA2019000268544) 49/19

Wk49/19
6.5
VI
VI

VOLUME 3, NP283(1), 2018/19


Published Wk 49/18
(Last Updates: Weekly Edition No. 48 dated 28 November 2019)

RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS


RADIO WEATHER SERVICES AND NAVIGATIONAL WARNINGS
PAGE 67, BAHRAIN, below NAVTEX.
Insert: BAHRAIN
MARITIME SAFETY INFORMATION (MSI) ON THE INTERNET
The internet is not part of the Maritime Safety Information system and should never be relied upon as the only means to obtain the latest forecast and
warning information. Access to the service may be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
INMARSAT SafetyNET or international NAVTEX for the latest information. However, the following website(s) may prove useful to the mariner:
Bahrain Ministry of
Navigation Warnings, Notices to Mariners and other
https://www.mtt.gov.bh/directorates/ports-and-maritime Transportation and
related information in English and Arabic.
Telecommunications
VI
MENAS Navigational Warning 344/19 (RSDRA2019000268465) 49/19 VI
BANGLADESH
PAGE 193,WEATHER
INTERNET SPAIN.
SPAIN (Mediterranean
SERVICES Coast).
MARITIME
ALGECIRAS SAFETY
MRSC. INFORMATION (MSI) ON THE INTERNET.
VOLUME 3, NP283(1), 2018/19
Delete entry and replace by: Select the 'Forecast' menu and then 'Marine Forecast', to access bulletins for
Bangladesh Meteorological Department Published Wk 49/18
www.bmd.gov.bd coastal
(Last Updates: Weekly Edition No. waters and
48 dated 28 high seas. The2019)
November site also provides synoptic weather charts,
ALGECIRAS MRSC INFORMATION (MSI) ON THE INTERNET
MARITIME SAFETY Marine Warnings and Special Weather Bulletins, in English.
The internet
Control RADIO
Centre:is36°07′·39N
not part of 5°26′·55WWEATHER
the Maritime SERVICES
Safety Information system and should AND
never be NAVIGATIONAL
relied upon as the only means WARNINGS
to obtain the latest forecast and
MARITIME SAFETY INFORMATION
warning information. (MSI)may
Access to the service ONbeTHE INTERNET
interrupted or delayed from timeNAVIGATIONAL
to time, updates may also be delayed. Please refer to GMDSS services,
RADIO
Ch 74 WEATHER SERVICES AND
VHF WARNINGS
INMARSAT SafetyNET or international NAVTEX for the latest information. However, the following website(s) may prove useful to the mariner:
The internet
PAGE is not part of the
67, BAHRAIN, Maritime
below Safety Information system and should never be relied upon as the only means to obtain the latest forecast and
NAVTEX. Diagrams pages 194, 195, 196 and 197
warning information. Access
http://www.armada.mde
Insert: to the service may be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
es/ArmadaPortal/page/Portal/ArmadaEspannola/
INMARSAT SafetyNET or international NAVTEX for the latest information. However, Notices to Mariners, in SpanishBAHRAINonly.
Bay,the followingand
website(s)
English.may prove useful to the mariner:
Weather
cienciaihm1/prefLang-en/02ProductosServicios--01avisos
0515 1515 2315 Weather bulletins for Algeciras in Spanish
Bulletins
MARITIME SAFETY INFORMATION (MSI) ON Bangladesh Navy Hydrographic andSpanish Hydrographic
THE INTERNET Notices to Mariners,
NAVAREAWeather Bulletins in
III Warnings and tidal and
English
http://bnhoc.navy.mil.bd/ Institute
Oceanographic Centre
http://www.armada.mde es/ArmadaPortal/page/Portal/ArmadaEspannola/ information, in Spanish,
English. together with links to Spanish and
Spanish Coastguard correspondence (RSDRA2019000275560) 49/19
The internet is not part of the Maritime Safety Information system and should never be relied upon as the only means
cienciaihm1/prefLang-en/02ProductosServicios--02NAVAREAS to obtain
Portuguese the latest
coastal and forecast
NAVAREA andII
warning information. Access to the service may be interrupted or delayed from time to time, updates may also bewarnings. delayed. Please refer to GMDSS services,
FIRING
INMARSAT PRACTICE AREAS
PAGE 193, SafetyNET or international NAVTEX
SPAIN (Mediterranean for the latest information. However, the following website(s) may prove useful to the mariner:
Coast). Spanish coastal Navigational Warnings
The Bangladesh
ALMERÍA Navy carries out firing practice and exercises in a number of areas off the coast. The dates and times
MRCC. of any exercise are promulgated by Notice
Bahrain Ministry of (including Islas Canarias), available as Internet'
to http://radioavisos.salvamentomaritimo.es/
Mariners,
Delete published
entry and by the
replace Bangladesh
by: Navy Hydrographic and Oceanographic Centre
Spanish (BNHOC)Navigation
Coastguard – see Warnings,
'Maritime Notices
Safety to Mariners
Information andon
(MSI) other
the
https://www.mtt.gov.bh/directorates/ports-and-maritime Transportation and downloadable PDF files, in English and
entry. Further information may be obtained by contacting the Bangladeshi Navy on: related information in English and Arabic.
Telecommunications Spanish.
ALMERÍA MRCC
Tel: +880 31 740391–9 ext 4170
MENAS
Spanish Navigational Warning 344/19 and
Coastguard correspondence (RSDRA2019000268465) 49/19
IHM website (RSDRA2019000275560 & RSDRA2019000275726) 49/19
Mobile:
Control +880 1769
Centre: 724170 2°28′·01W
36°49′·84N BANGLADESH
Fax: +880 31 741162 Almería 36°49′·84N 2°28′·01W
PAGE
E-mail:
INTERNET 193, SPAIN (Mediterranean
bnhoc@navy.mil.bd
198,WEATHER SERVICES Coast).
Ch 11 VHF
ALGECIRAS
CARTAGENA MRSC.
MRSC.
Website: www.navy.mil.bd Cabo Gata 36°43′·30N 2°11′·57W
Delete entry and replace by: Diagrams pages 194,Select the 'Forecast'
195, 196 and 197 menu and then 'Marine Forecast', to access bulletins for
Bangladesh Meteorological Department
www.bmd.gov.bd coastal waters and high seas. The site also provides synoptic weather charts,
Weather
ALGECIRAS
0315 0715 1115 1515 1915
Weather bulletins for coastal waters, together with
Marine Warnings andSea Areas
Special AlboránBulletins,
Weather and Palos, BELGIUM
in Spanish and
in English. English.
Bulletins MRSC
CARTAGENA MRSC
2315
Control
INTERNETCentre: 36°07′·39N 5°26′·55W
37°34′·89NSERVICES
WEATHER 0°57′·97W
MARITIME
Spanish SAFETY
Coastguard INFORMATION
correspondence (MSI) ON THE INTERNET
(RSDRA2019000275560) 49/19
Oceanographic Meteorological Station 74
Ch 06 VHF
www.kustweerbericht.be/nl/professionele.gebruikers.algemeen.asp
The internet is not part of the Maritime Safety Information system and should never Marine
be weather synopsis
relied upon as theand
onlyforecasts
means toforobtain
up to five
the days
latestinforecast
advance, in Dutch.
and
Diagrams pages 194, 195, 196 and 197
warning
PAGE information.
193, SPAINAccess to the service may
(Mediterranean be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
Coast).
INMARSAT 0115 0515
Weather SafetyNET 0915 1315NAVTEX
or international 1715 forWeather
the latest information. However,
BARCELONA
NAVTEX
MRCC.
– OOSTENDE0515 1515 2315 bulletins for Algeciras
coastal Bay,the
waters, following
intogether
Spanish website(s)
and
with Areasmay
English.
Sea prove
Palos anduseful to the
Cabrera, mariner:and English.
in Spanish
51°04′·44N 3°20′·08E
Delete entry
Bulletins and2115
replace by:
Bangladesh Navy Hydrographic and Notices to Mariners, Weather Bulletins and tidal
http://bnhoc.navy.mil.bd/
518 kHz: T, V 490 kHz: B Centre Diagrams inpages 39, 220, 221 and 312
Oceanographic information, English.
Spanish Coastguard correspondence (RSDRA2019000275560) 49/19
BARCELONA
Weather
MRCC
T: 0710 1910 Weather forecast for Sea Areas Dover and Thames in English.
Bulletins
Control
FIRING Centre: 41°20′·09N
PRACTICE B:AREAS2°08′·54E
0810 1210 1610 2010 Weather bulletins for coastal areas and River Scheldt in Dutch and occasionally in English.
PAGE 193,
198, SPAIN (Mediterranean Coast).
The Bangladesh
ALMERÍA
CASTELLÓN Navy
MRCC. T:carries
MRSC. 0310out firing
0710 practice
1110 Chand
1510 10 exercises
1910 in a numberWarnings
2310 Navigational of areas off the
VHF and galecoast. The for
warnings dates
Seaand times
Areas of any
Dover andexercise
Thames are promulgated by Notice
in English.
to Mariners,
Delete published
entry
Navigational by the Bangladesh
and replace by: Navy Hydrographic and Oceanographic Centre (BNHOC) – see 'Maritime Safety Information (MSI) on the Internet'
V: 0330 0730 1130 1530 1930 2330 UK Diagrams
Coastalpages
(WZ) 194, 195, 196Warnings
Navigational and 197 in English.
entry. Warnings
Further information may be obtained by contacting the Bangladeshi Navy on:
Weather B: 1600
0700 0010 2300 0810 1210 1610Weather
0410 LT bulletins
2010 Local for GironaWarnings
Navigational and Barcelona coastal
and gale waters,
warnings together
in Dutch, with Sea in
sometimes Areas León, Menorca and
English.
ALMERÍA
CASTELLÓN MRCC
Bulletins MRSC Baleares, in Spanish and English.
Tel: +880 31 740391–9 ext 4170
Ice Warnings
Mobile:
Control +880 1769
Centre: T: 0310
724170
36°49′·84N 0710 1110 1510 1910 2310 Baltic Ice Code for Netherlands Area Group GG in English.
2°28′·01W
and Reports 39°58′·19N 0°01′·26E
Fax: +880
Spanish 31 741162correspondence (RSDRA2019000275560)
Coastguard
Ch 72
49/19
VHF Almería 36°49′·84N 2°28′·01W
E-mail: bnhoc@navy.mil.bd Ch 11 VHF
MARITIME SAFETY
Website: www.navy.mil.bd INFORMATION (MSI) ON THE INTERNET
Diagrams pages 194, 195, 196 and 197 Cabo Gata 36°43′·30N 2°11′·57W
TheWeather
internet is not 0933
part of the LT
Maritime Safety Information Diagrams pages 194, 195,be196 andupon
197 as the only means to obtain the latest forecast and
2233 Weathersystem andfor
bulletins should
coastalnever relied
waters, in Spanish and English.
Bulletins
warning information. Access
0715 to the 1515
service may be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
Weather
INMARSAT
0315 1115 1915
Weather bulletins for coastal waters, together with BELGIUM
Sea Areas Alborán and Palos, in Spanish and English.
Bulletins SafetyNET
2315 or international NAVTEX for the latest information. However, the following website(s) may prove useful to the mariner:
Spanish Coastguard correspondence (RSDRA2019000275560) 49/19
INTERNET WEATHER SERVICES Links to Notices to Mariners, marine and coastal weather
SpanishWk49/19
https://www.afdelingkust.be/en/flemish-hydrography 6.5
6.6
Flemish Hydrographic
Coastguard correspondence (RSDRA2019000275560) 49/19 Office forecasts, tidal data and other related information, in
Oceanographic Meteorological Station English,
PAGE 198, SPAIN (Mediterranean Coast).
www.kustweerbericht.be/nl/professionele.gebruikers.algemeen.asp Marine weather synopsis andDutch, French
forecasts andtoGerman.
for up five days in advance, in Dutch.
PALMA
PAGE MRCC.
Delete 193,
entrySPAIN (Mediterranean
and replace by: Coast).
The internet is not part of the Maritime Safety Information system and should never be relied upon as the only means to obtain the latest forecast and
Diagrams pages 194, 195, 196 and 197
warning information. Access to the service may be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
INMARSAT
Weather SafetyNET or international NAVTEX for the latest information. However, the following website(s) may prove useful to the mariner:
0515 1515 2315 Weather bulletins for Algeciras Bay, in Spanish and English.
Bulletins
Bangladesh Navy Hydrographic and Notices to Mariners, Weather Bulletins and tidal
http://bnhoc.navy.mil.bd/
Oceanographic Centre information, in English.
Spanish Coastguard correspondence (RSDRA2019000275560) 49/19 VI
FIRING PRACTICE AREAS
PAGE 193, SPAIN (Mediterranean Coast).
The Bangladesh
ALMERÍA Navy carries out firing practice and exercises in a number of areas off the coast. The dates and times of any exercise are promulgated by Notice
MRCC.
to Mariners,
Delete published
entry by the Bangladesh
and replace by: Navy Hydrographic and Oceanographic Centre (BNHOC) – see 'Maritime Safety Information (MSI) on the Internet'
entry. Further information may be obtained by contacting the Bangladeshi Navy on:
ALMERÍA MRCC
Tel: +880 31 740391–9 ext 4170
Mobile:
Control +880 1769
Centre: 724170 2°28′·01W
36°49′·84N
VI
Fax: +880 31 741162 Almería 36°49′·84N 2°28′·01W
E-mail: bnhoc@navy.mil.bd Ch 11 VHF
Website: 193,
www.navy.mil.bd Cabo Gata 36°43′·30N 2°11′·57W
PAGE SPAIN.
MARITIME SAFETY INFORMATION (MSI) ON Diagrams
THE INTERNET.
pages 194, 195, 196 and 197
Delete entry and0315
replace by: 1515 1915
Weather 0715 1115 BELGIUM
Weather bulletins for coastal waters, together with Sea Areas Alborán and Palos, in Spanish and English.
Bulletins 2315
MARITIME SAFETY INFORMATION (MSI) ON THE INTERNET
INTERNET WEATHER SERVICES
Spanish Coastguard
The internet is not correspondence (RSDRA2019000275560)
part of the Maritime 49/19
Safety Information system and should never be relied upon as the only means to obtain the latest forecast and
Oceanographic Meteorological Station
Marine
warning information. Access to the service may be interrupted or delayed from time
www.kustweerbericht.be/nl/professionele.gebruikers.algemeen.asp weather
to time, synopsis
updates mayand
alsoforecasts for upPlease
be delayed. to fiverefer
days to
in GMDSS
advance,services,
in Dutch.
INMARSAT
PAGE 193, SafetyNET or international NAVTEX
SPAIN (Mediterranean for the latest information. However, the following website(s) may prove useful to the mariner:
Coast).
BARCELONA MRCC.
http://www.armada.mde es/ArmadaPortal/page/Portal/ArmadaEspannola/
NAVTEX
Delete – OOSTENDE
entry and replace by: Notices to Mariners, in51°04′·44N 3°20′·08E
Spanish only.
cienciaihm1/prefLang-en/02ProductosServicios--01avisos
518 kHz: T, V 490 kHz: B Diagrams pages 39, 220, 221 and 312
Spanish Hydrographic NAVAREA III Warnings in English and
BARCELONA MRCCT: 0710
http://www.armada.mde
Weather 1910 Institute
Weather forecast for Sea
es/ArmadaPortal/page/Portal/ArmadaEspannola/ Areas Dover and Thames in English.
Spanish, together with links to Spanish and
cienciaihm1/prefLang-en/02ProductosServicios--02NAVAREAS
Bulletins
Control Centre: 41°20′·09N 2°08′·54E
B: 0810 1210 1610 2010 Weather bulletins for coastal areas and River Scheldt inPortuguese coastal and in
Dutch and occasionally NAVAREA
English. II
warnings.
Ch 10 VHF
T: 0310 0710 1110 1510 1910 2310 Navigational Warnings and gale warnings for Sea Areas Dover and Thames in English.
Navigational Spanish coastal Navigational Warnings
V: 0330 0730 1130 1530 1930 2330 UK Diagrams
Coastalpages
(WZ) 194, 195, 196Warnings
Navigational and 197 in English. (including Islas Canarias), available as
Warnings
http://radioavisos.salvamentomaritimo.es/ Spanish Coastguard
Weather B: 1600
0010 2300 0810 1210 1610Weather
0410 LT bulletins
2010 Local for GironaWarnings
Navigational and Barcelona coastal
and gale waters,
warnings downloadable
together
in Dutch, PDF
with Sea in
sometimes Areas files,
León,inMenorca
English. English and
0700 Spanish.
Bulletins Baleares, in Spanish and English.
Ice Warnings
T: 0310 0710 1110 1510 1910 2310 Baltic Ice Code for Netherlands Area Group GG in English.
and Reports
Spanish Coastguard correspondence and IHM website (RSDRA2019000275560
(RSDRA2019000275560) 49/19 & RSDRA2019000275726) 49/19

MARITIME SAFETY INFORMATION (MSI) ON THE INTERNET


PAGE 198, SPAIN (Mediterranean Coast).
CARTAGENA MRSC.
The internet is not part of the Maritime Safety Information system and should never be relied upon as the only means to obtain the latest forecast and
Delete entry
warning and replace
information. Access toby:
the service may be interrupted or delayed from time to time, updates may also be delayed. Please refer to GMDSS services,
INMARSAT SafetyNET or international NAVTEX for the latest information. However, the following website(s) may prove useful to the mariner:
CARTAGENA MRSC Links to Notices to Mariners, marine and coastal weather
https://www.afdelingkust.be/en/flemish-hydrography 6.5
Flemish Hydrographic Office forecasts, tidal data and other related information, in
Control Centre: 37°34′·89N 0°57′·97W
English, Dutch, French and German.
Ch 06 VHF
Diagrams pages 194, 195, 196 and 197
Weather 0115 0515 0915 1315 1715
Weather bulletins for coastal waters, together with Sea Areas Palos and Cabrera, in Spanish and English.
Bulletins 2115

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19


73
PAGE 198, SPAIN (Mediterranean Coast).
CASTELLÓN MRSC.
Delete entry and replace by:

CASTELLÓN MRSC
Control Centre: 39°58′·19N 0°01′·26E
Ch 72 VHF
Diagrams pages 194, 195, 196 and 197
Weather
0933 2233 LT Weather bulletins for coastal waters, in Spanish and English.
Bulletins

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19

PAGE 198, SPAIN (Mediterranean Coast).


PALMA MRCC.
Delete entry and replace by:

PALMA MRCC
Control Centre: 39°34′·02N 2°38′·72E
Mallorca and Menorca
Cala Figuera 39°27′·46N 2°31′·34E
A Ch 10 VHF
Dique del Oeste 39°32′·75N 2°37′·47E
Ibiza and Formentera Wk49/19
6.7
B Ch 11 VHF Atalaya de San Jousep 38°54′·64N 1°16′·42E
Diagrams pages 194, 195, 196 and 197
Diagrams pages 194, 195, 196 and 197
Weather
0933 2233 LT Weather bulletins for coastal waters, in Spanish and English.
Bulletins

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19 VI

PAGE 198, SPAIN (Mediterranean Coast).


PALMA MRCC.
Delete entry and replace by:

PALMA MRCC
Control Centre: 39°34′·02N 2°38′·72E
Mallorca and Menorca
Cala Figuera 39°27′·46N 2°31′·34E
A Ch 10 VHF
Dique del Oeste 39°32′·75N 2°37′·47E
Ibiza and Formentera
B Ch 11 VHF Atalaya de San Jousep 38°54′·64N 1°16′·42E
Diagrams pages 194, 195, 196 and 197
Weather 0835 1135 1635 2135
A, B: Weather bulletins for coastal waters and Sea Areas Menorca, Cabrera and Baleares, in Spanish and English.
Bulletins LT
VI
Spanish Coastguard correspondence (RSDRA2019000275560) 49/19

6.6
PAGE 198, SPAIN (Mediterranean Coast).
TARRAGONA MRSC.
Delete entry and replace by:

TARRAGONA MRSC
Control Centre: 41°05′·41N 1°13′·50E
Ch 74 VHF
Diagrams pages 194, 195, 196 and 197
Weather
1333 2333 LT Weather bulletins for coastal waters and Sea Area Baleares, in Spanish and English.
Bulletins

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19

PAGE 199, SPAIN (Mediterranean Coast).


VALENCIA MRCC.
Delete entry and replace by:

VALENCIA MRCC
Control Centre: 39°26′·63N 0°19′·73W
Ch 10 74 VHF
Diagrams pages 194, 195, 196 and 197
Weather
03151 04152 1215 2015 Weather bulletins for coastal waters and Sea Areas Palos, Cabrera and Baleares in Spanish and English.
Bulletins
1 Summertime.
2 Wintertime.

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19

PAGE 199, SPAIN (North Coast).


BILBAO MRCC.
Delete entry and replace by:

BILBAO MRCC
Control Centre: 43°20′·78N 3°01′·91W
Ch 10 74 VHF
Diagrams pages 194, 195, 196 and 197
Weather 0433 1033 1833 Weather bulletins for coastal waters, in Spanish and English.
Bulletins 0833 2033 Weather bulletins for Sea Area Cantábrico, in Spanish and English.

Spanish Coastguard correspondence (RSDRA2019000275560) 49/19

Wk49/19
6.8
VI
VI
VOLUME 6, PART 2, NP 286(2), 2019/20 PAGE 137, CHINA, YANGPU, Hai-Nan Tao, Pilots, PROCEDURE,
Published Wk 21/19
section (2).
Delete and replace by:
––––––––––––––––––
(Last Updates: Weekly Edition No. 47 dated 21 November 2019) (2) Pilot boards in the following positions:
(a) Circle of radius 1 n mile (Quarantine anchorage No 1) centred on position
PAGE 442, SWEDEN, diagram STOCKHOLM, VESSEL TRAFFIC 19°51′·00N 108°56′·28E
SERVICE. (b) Circle of radius 1 n mile (Quarantine anchorage No 2) centred on position
Insert Pilot Boarding Position symbol in position 60°11′·70N 18°55′·00E. 19°49′·00N 108°56′·28E
(c) Circle of radius 1 n mile (Quarantine anchorage No 3) centred on position
Swedish Notice 781/14453/19, (RSDRA2019000275291), 49/19 19°47′·00N 108°56′·28E
(d) No 3: 19°45′·40N 109°08′·00E (Anchorage No 8)
(e) No 5: 19°44′·40N 109°02′·60E
PAGE 443, SWEDEN, STOCKHOLM, Pilots, PROCEDURE, below (f) No 6: 19°40′·80N 109°08′·80E (Anchorage No 13)
section (6) (d) (ii). (g) No 8: 19°46′·81N 109°02′·00E (Anchorage No 5)
Insert: (h) No 9: 19°43′·61N 109°08′·20E (Anchorage No 10)

(iii) 60°11′·70N 18°55′·00E (NE of Svartklubben Lt) Chinese Chart 16561, (RSDRA2019000262843), 49/19

Swedish Notice 781/14453/19, (RSDRA2019000275291), 49/19


PAGE 325, RUSSIA (Pacic Coast), OKHOTSK, Rybnyy Port.
Delete entry and replace by:
––––––––––––––––––––––––––––––

OKHOTSK, Rybnyy Port 59°21′N 143°11′E


VOLUME 6, PART 3, NP 286(3), 2019/20 UNCTAD LOCODE: RU OHO
Published Wk 27/19
Pilots
––––––––––––––––––
CONTACT DETAILS:
(Last Updates: Weekly Edition No. 46 dated 14 November 2019) Call: Lotsman-Okhotsk
VHF Channel: Ch 11; 13
PAGE 370, TURKEY, CEYHAN LİMANI, Pilots, PROCEDURE, section
(2). HOURS: H24
Delete and replace by: PROCEDURE:
(1) Pilotage is compulsory for all vessels.
(2) Pilot boards in the following positions: (2) Pilot ordering: Vessels should send request for Pilot to the Hr Mr 72h, 48h and
(a) 36°51′·35N 35°57′·30E (Botaş 2) 4h in advance.
(b) 36°50′·30N 35°56′·40E (Botaş 3) (3) Pilot boards in position 59°19′·31N 143°08′·93E.
(c) 36°47′·00N 35°56′·00E (Botaş 4)
Ship Traffic Management System
Turkish Bulletin 45/19, (RSDRA2019000272481), 49/19
AREA:
The Ship Control and Management System (STCMS) covers the area of the seaport
–––––––––––––––––––––––––––––– and approaches bounded by the following positions:
(1) 59°21′·70N 143°14′·30E
VOLUME 6, PART 6, NP 286(6), 2019/20 (2) 59°16′·50N 143°14′·20E
(3) 59°16′·50N 143°01′·80E
Published Wk 3/19 (4) 59°18′·20N 143°01′·80E
–––––––––––––––––– CONTACT DETAILS:
Call: Okhotsk-32
(Last Updates: Weekly Edition No. 45 dated 7 November 2019)
VHF Channel: Ch 16; 11
PAGE 78, CHINA, LIANYUNGANG, Pilots, PROCEDURE, section (2).
PROCEDURE:
Delete and replace by: (1) Vessels heading for and departing from the seaport shall request permission from
the STCMS for entry/exit on VHF Ch 11.
(2) Pilot boards in the following positions: (2) Vessels sailing in the waters of the seaport and approaches shall provide the
(a) Anchorage area No 1: 34°49′·47N 119°37′·78E STCMS with the following information on VHF Ch 11:
(b) No 1: 34°47′·31N 119°40′·40E (a) Berthing/unberthing
(c) No 1: 34°46′·46N 119°33′·90E (b) Commencement and termination of ship’s movement
(d) No 2: 34°47′·73N 119°37′·33E (c) Pilot embarkation/disembarkation
(e) No 3: 34°49′·58N 119°41′·71E (3) On entry to the inner harbour of the seaport vessels should advise:
(f) No 4: 34°51′·76N 119°46′·93E (a) Vessel’s draught
(g) No 6: 34°44′·93N 119°34′·10E (b) ETA to berth or anchorage position
(h) No 7: 34°48′·39N 119°42′·09E
(i) No 8: 34°51′·24N 119°49′·76E
continued on next page
Chinese Chart 12581, (RSDRA2019000262831), 49/19

1
Wk49/19
6.9
VI
VI
Port
CONTACT DETAILS:
Hr Mr
Call: Okhotsk-32
VHF Channel: Ch 11
Port State Control Inspection
Call: Okhotsk-32
VHF Channel: Ch 11
Freight Terminal Dispatcher
Call: Okhotsk-31
VHF Channel: Ch 11
Tugs
Call: MB-371
Uelen
VHF Channel: Ch 11; 13
HOURS: H24
PROCEDURE:
(1) Information on vessels calling at the seaport shall be transmitted to the Hr Mr via
the Internet at www.portcall.marinet.ru.
(2) Vessels inside the port should maintain a continuous listening watch on VHF Ch
11.
TRANSMISSION OF NAVIGATIONAL, HYDROLOGICAL AND
METEOROLOGICAL INFORMATION:
(1) Hydrometeorological information for vessels within the port shall be transmitted on
VHF Ch 11.
(2) The Hr Mr shall transmit urgent nautical and hydrometeorological information as
well as storm warnings to vessels at berths or anchorages of the port on VHF Ch 11.
(3) When vital messages and storm warnings are received, vessels shall acknowledge
receipt.

Russian Federation Ministry of Transport, (RSDRA2019000262815), 49/19

––––––––––––––––––––––––––––––

2
Wk49/19
6.10
VII

UPDATES TO MISCELLANEOUS ADMIRALTY NAUTICAL PUBLICATIONS

There are no updates to miscellaneous Nautical Publications this week

7.1
Wk49/19
VIII

ADMIRALTY DIGITAL SERVICES

1. ENC / ECDIS and AVCS

a) Safety Notice

For a graphical way to establish that the ECDIS is correctly displaying the new symbols introduced in IHO S-52 Presentation Library
Edition 4.0 the mariner can check ECDIS Chart 1. ECDIS Chart 1 is a legend of the entire set of symbols that may be used within an
ENC and is installed on all type-approved ECDIS systems. See iho.int for further information. ECDIS Systems have been required to
use Presentation Library edition 4.0 since 1st September 2017 and previous editions are no longer SOLAS compliant.

ECDIS operating with Edition 3.4 of the IHO Presentation Library


Since 1st September 2017, ECDIS Systems have been required to use Presentation Library edition 4.0. Vessels using previous editions
must upgrade as soon as possible to maintain compliance. The IHO Check Dataset is not required for Presentation Library 4.0.

b) ENCs temporarily withdrawn from AVCS


To review a cumulative list of ENCs temporarily withdrawn from AVCS, please visit the ‘Updates’ tab on:
admiralty.co.uk/AVCS

c) ENC Readme.txt file


The README.TXT file located within the ENC_ROOT folder on the latest AVCS discs contains important safety related information
relating to the use of ENCs in ECDIS. The file is also available on the support tab at admiralty.co.uk/avcs.

This file is updated on a regular basis and should be consulted to ensure that all related issues are taken into consideration.

d) Temporary & Preliminary Notices to Mariners (T&P NMs) in ENCs


The use of T&P NM information is considered an essential part of keeping navigational charts up to date.

The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&P-NM-Status.pdf file in the INFO folder on the service media and at: admiralty.co.uk/ENC-TP-NMs

ADMIRALTY Information Overlay (AIO) shows ADMIRALTY paper T&Ps where they are not already included in the ENCs. Most
countries now include temporary information in their ENCs.

Further guidance can be found in the INFO folder on AIO discs.

e) Important notice regarding AVCS CD Service

From WK14/19, AVCS is only available by download or on the weekly DVDs.


For more information, please contact your ADMIRALTY Chart Agent.

f) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)

The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.

Email calls to AVCS OUS will receive an auto-response that asks the customer to resubmit their data request online by http. Please
contact your ADMIRALTY Distributor if support is required for use of the http service.

Due to the technology updates at UKHO, the ARCS Online Updating Service was withdrawn in July 2019.

2. ADMIRALTY Products Supporting Digital Navigation


i. ADMIRALTY ENC and ECDIS Maintenance Record (NP133C). This publication is designed to hold paper records on ENC
and ECDIS maintenance to assist information management and support inspections. Please note that V2.0 is the current
edition.
ii. ADMIRALTY Guide to ENC Symbols Used in ECDIS (NP5012). A companion to the ADMIRALTY Guide to Symbols and
Abbreviations Used on Paper Charts, NP5011. The 2nd edition of NP5012 includes the changes highlighted in the new S-52
standards and the new presentation library 4.0.
iii. ADMIRALTY Guide to the Practical Use of ENCs (NP231). Supports ECDIS training on the interpretation and use of ENC
data.

8.1
Wk 49/19
VIII

iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.

v. ADMIRALTY Port Approach Guides. Information from a range of official ADMIRALTY charts and publications on one
chart, helping bridge crews to plan for particular approaches and to support Master Pilot Exchange. Expanding coverage of
some of the world's most complex approaches, including Antwerp, Rotterdam and the Panama Canal. More information is
available at admiralty.co.uk/port-approach-guides

3. ADMIRALTY Digital Publications (ADP)

ADP V19 is available on the ADP Weekly Update DVD.


The UKHO only supports ADP V18 and V19. Users of older versions of ADP should upgrade to a supported version at their earliest
convenience. ADP V18 and V19 are the only versions that allow users to receive tidal updates as they are made available.

ADMIRALTY TotalTide (ATT): German Tidal Stations predicted on LAT


The TotalTide application computes predictions for all German tidal stations based on Lowest Astronomical Tide (LAT).
Mariners using charts which refer to Mean Low Water Springs (MLWS) in German waters, must deduct 0.5m from all predicted tidal
heights for these ports before applying them to the depths on those charts to determine the correct predicted depth of water. This advice
will also be contained in the ‘Notes’ tab on the Prediction Windows in TotalTide for each German tidal station.

For information: Please note that there will not be a 2020 ADP release.

Historically we have made new versions of the ADP software available in December of each year however, there will be no commercial
release of ADP this year. Previous versions have been released with yearly updates to tidal data and non-essential bug fixes however, as
tidal data is now updated weekly there is no need for us to release a new version of the software at this time.

The supported ADP versions continue to remain at V18 and V19.

The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.

Users can also download ADP directly on the Distributors FTP Site at ftp://ukho.gov.uk

For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@ukho.gov.uk

4. Status of ADMIRALTY Digital Services

Update status table

Product Last issue date/Week Reissue Date/Week


i. ADMIRALTY Vector Chart Service (AVCS) Base CD download 05 December 2019 - 49
ii. ADMIRALTY Information Overlay (AIO) Base CD 04 October 2018 - 40
iii. ADMIRALTY Raster Chart Service (ARCS) Regional disc 1 01 August 2019 - 31 23 January 2020 - 04
ADMIRALTY Raster Chart Service (ARCS) Regional disc 2 31 October 2019 - 44
ADMIRALTY Raster Chart Service (ARCS) Regional disc 3 12 September 2019 - 37
ADMIRALTY Raster Chart Service (ARCS) Regional disc 4 26 September 2019 - 39
ADMIRALTY Raster Chart Service (ARCS) Regional disc 5 09 May 2019 - 19 12 December 2019 - 50
ADMIRALTY Raster Chart Service (ARCS) Regional disc 6 22 August 2019- 34 06 February 2020 - 06
ADMIRALTY Raster Chart Service (ARCS) Regional disc 7 18 July 2019 - 29 20 February 2020 - 08
ADMIRALTY Raster Chart Service (ARCS) Regional disc 8 17 October 2019 - 42
ADMIRALTY Raster Chart Service (ARCS) Regional disc 9 21 November 2019 - 47
ADMIRALTY Raster Chart Service (ARCS) Regional disc 10 23 May 2019 - 21
23 August 2018 – 34
ADMIRALTY Raster Chart Service (ARCS) Regional disc 11
Small-scale Planning Charts

ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.

8.2
Wk 49/19
VIII

5. Supported ADMIRALTY Software Versions

Product Supported Versions


ADP V18, V19
ADMIRALTY e-Reader 1.3
ADMIRALTY Planning Station 3.4
ADMIRALTY gateway 4.2, 4.4
NavPac and Compact Data 3.4, 4.0

If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.

8.3
Wk 49/19
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

Reporting Port Information affecting ADMIRALTY Products

NAME OF PORT

APPROXIMATE POSITION Latitude Longitude

GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.

Number of ships or tonnage handled per


year.

Maximum size of vessel handled.

Copy of Port Handbook (if available).

ANCHORAGES
Designation, depths, holding ground,
shelter afforded.

PILOTAGE
Authority for requests.

Embark position.

Regulations.

DIRECTIONS
Entry and berthing information.

Tidal streams.

Navigational aids.

TUGS
Number available.

WHARVES
Names, numbers or positions & lengths.

Depths alongside.

CARGO HANDLING
Containers, lighters, Ro-Ro etc.

REPAIRS
Hull, machinery and underwater.

Shipyards.

Docking or slipping facilities.


(Give size of vessels handled or
dimensions)

Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)

RESCUE AND DISTRESS


Salvage, Lifeboat, Coastguard, etc.

SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)

Fresh water.
(with method of delivery and rate of
supply)

Provisions.

SERVICES
Medical.

Ship Sanitation.

Garbage and slops.

Ship chandlery, tank cleaning, compass


adjustment, hull painting.

COMMUNICATIONS
Nearest airport or airfield.

Port radio and information service. (with


frequencies and hours of operating)

PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.

VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.

ADDITIONAL DETAILS

NOTES:

1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.

2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)

NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.

2. Objective of GNSS Data Collection

The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.

It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.

It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.

3. Details required

a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.

b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).

c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.

d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at admiralty.co.uk/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services

For emergency information affecting safety of life at sea forward to: navwarnings@ukho.gov.uk
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@ukho.gov.uk
This form H.102 and instructions are available online: admiralty.co.uk/msi

Date Ref. number


Name of ship or sender IMO number
Address and general locality

E-mail / Tel / Fax of sender

Subject

Position
Latitude Longitude
(see Instruction 2)

GPS Datum Accuracy

ADMIRALTY Charts affected Edition

Latest Weekly Edition of


Notices to Mariners (NMs) held
Replacement copy of chart number IS / IS NOT required
(see Instruction 3)
ENCs affected

Latest update disk applied Week:

Make, model and or age of ECDIS if


applicable
Publications affected
(e-NP / DP number, edition number)
Date of latest supplement/update,
page & Light List number etc.
Details of anomaly / observation:

Name of observer / reporter

H.102A submitted Yes No H.102B submitted Yes No

Tick box if not willing to be named as source of this information

Alternatively use our H-Note App located here:


admiralty.co.uk/H-note

Вам также может понравиться