Вы находитесь на странице: 1из 236

1

AntonellaZara TheScienceofPassion

Every moment of seeking is amoment of discovery. When I soughtmytreasure,allofmydayswerebright,becauseIknew thateverymomentbecamepartofadreamtofind. PauloCoelho

PREFACE Everythingstartedwithagreatlove.Infact,Ibelievethateverything usuallystarts,somehow, throughlove.Inmycase,thegreatestchangesin mylifecamethroughthementhatIhaveloved.ThankstoLife,Iloveda lot,Ilovedprofoundlyandintensely,andallthatIhavelearned,Ilearnedby loving.Onlybygoingthroughallthepainsandallthepleasuresoflove, withoutthereservationsofnotlovingoutoffearofwhatwouldhappen,or whatotherpeoplewouldthink,thereIfoundwithinmetheenergynecessary tobelieveindreams. ThefirstbigdreamthatIfulfilledthreeyearsagowastowalkonfoot theeighthundredkilometertripoftheSantiagosJourney,anilluminating trekthatIrecommendtoanyonethatwishestogrowspiritually.Thistrip helped me understand newthingsaboutLifeandabout myself,andalso helpedmebetterappreciateitsbeauty.Afterthismarvelousexperience,I wentthroughaverydifficulttimeinwhichIalmostlostallvisionintheleft eyebecauseofanulcerinthecornea.TheJourneyhadgivenmethestrength toendurethatmoment.Istruggledhard,concentratingallofmyfaithandall of my energy into the recovery, and thanks to Life and the love of my friendsIwasabletorecoverthefiftypercentofvisionthatIhavetoday. AfterallthosebeautifulandallthoseharshmomentsthroughwhichI had endured, my faith in life had increased by leaps and bounds. I had comprehendedthateitherpleasureorpainaregiftsgivenbylifetothose whoseektofindthemselves. Itwasinthisway,fullofgratitudeandloveforexistence,thatIthen triedtofindagainamanwithwhomIhadlivedabeautifullovestory.This wasatthesametimeaheartbreakingandmarvelousreunion.Sad,because time and distance made that love change, then we could not revive the sublimepassionthathadunitedusbefore.Marvelousbecausethatpassion thathadbeensospecial,evenifitwouldnotmanifestitselfbetweenusas manandwomanonceagain,butonlyforthefactthatIsawhimagain,unleashed inmeaprocessthatwasmagicalandirreversible. EversincethatencounterIbecameawareoftheexistenceofanother personinsideofme.IrealizedthenthatShehadalwaysbeenpresent,but

morethateverIhadperceivedHerclearly.Atfirst,thisnewsensationwas strangetome,eventhoughitfilledmewithasortof happinessunknown untilthen.Iwonderedifthisphenomenonhappenedonlytome,ifIwas finallygoingcrazy,ifIhadtoseekmedicalhelp.Butitwassogoodthatit justcouldntbeasickness!Iresolvedthentodeepenmyknowledgeonthe subject, and I came across a vast literature that dealt with this kind of spiritualitythathadflourishedinme.IbegantounderstandthatIhadcome intocontactwithwhatiscalledtheSuperiorI,thedivinepart,thesoul,the particle of God that exists ineveryone! I noticedthat I hadreceivedan immensegiftfromLife asarewardfor goingaftermydreams.Formany peoplethismightbeincomprehensibleorevenabsurd,whichisperfectly natural, because it is not possible to understand something which is unknown.ButIhavealsocometounderstandthatforagrowingnumberof people,thespiritualsearchisnotonlyanintellectualpasttime,itisavital necessity,somethingthatisputintopracticeandliveddaybyday.WithThe Science of Passion, I hope to contribute to the search of some of these people,sincemygreatestdreamistobethechannelofLightformyfellow man. MorethanayearhadpassedsinceIcompletedtheSantiagosJourney whenI,againrealizinganotherdream,wentonatriptoParisfortwoweeks. There,whilewalkingthroughabookstore,Ifoundbychanceabooknamed Conversations With God by an American author called Neale Donald Walsh,whohadbeenmentionedwithgreatenthusiasmbyaFrenchyouthI hadmetinthefirstdayofmypilgrimage.Idecidedtobuyitandmonths later,Ireceivedasagiftfrommyparentstheothertwobooks,whichIfound tobepartofamagnificenttrilogy.Inthesethreebooks,theauthordescribes hisconversationsandhispersonalrelationwiththeSuperiorI,andhow this transformed his life. Going further, the author insists upon how the awakeningofthistypeofspiritualityineachhumanbeingcouldchangethe world.Ienjoyedthesebooksimmensely,andtheytaughtmealotofthings, Ibelievethateveryoneshouldreadthem. In this book, I will writedownmypersonal conversationswithmy HigherSelftoattempt,likeMr.Walsh,togivemypersonalcontribution tospirituality.Ibelieve,likehim,thattheworldisinastateofcalamityand needstobechanged,andthatitdependsoneachofustodoourbesttomake sure these changes occur the soonest. It does no good to lay the

responsibility onthe politicsandexpect thatonlythiswilltransformthe currentsituation.Itisuptoeachoneofustocontributedaybyday,sothat thisworldisnotliterallydestroyedbythepresentgreed,andfurthermore, thatitevolvesandfinallybecomeswhatitshouldbe:ahealthyenvironment inwhichpeoplelivehappilyandhealthy. I believe I have to explain two things: why I call my other me GoddessinsteadofGod,asabove,andthetitleitself.Well,surely,thename GoddessisnotderivedfromabeliefthattheenergythatIamreferringto hasadefinedsex.Onthecontrary,whenwereadtheBible,amarvelous philosophicalbook,thatGodcreatedmaninitsimageandlikeness,we knowthat,inthesamewayandsurelyinthetime,womanwascreated. Therearethosewhoworryaboutwhomcamebeforewhom;therearethose whosaythatEvewasmadefromoneofAdamsribs;therearethosewho saythatAdamwastheroughdraftandEvethemasterpieceIntheend,I sincerelydontthinkitmatters.Thetruthisthatwithoutawoman,aman doesnotexistandviceversa.Inorderthathumanbeingsexistandprocreate, botharenecessary.Itisafactandanaturallaw.So,Ithinkitislogicalfor those who believe that man and woman were created in the image and likenessofwhatwecallGod,andthatGodasaresult,isGodandGoddess atthesametime.Or,ifwerefertothemasenergiesforthosewhofindit difficultytodealwiththesereligiouswords,theEnergythatgaveoriginand isinherentineverything,hastodo,atthesametime,withthemasculineand feminineenergy.Everyoneaddressesthisenergyhowonechooses,andfor mybookGoddesswouldbeatributetothefemininepartofCreation,which hasnotbeengivenitdue.Beingawoman,andfromthebottomofmyheart, loving it, I believe there is nothing more natural than to talk to The Goddess.Besidesthat,IamBrazilian,andwithoutwishingtodisrespect themarvelousandverysensualBrazilianmen,IbelieveIcansaythatthe feminineforcehasprominenceinmycountry. IdiscoveredthattheGoddessisasortofenergyfullofhumor,purity, beauty,withgreatgoodness,mischievouslyfun,withauniquegenerosity, and of a happiness that I have only seen so far in very small children. MeetingHerchangedmylife,andeverydayIameagertoconnectwithHer, aprocessthatwillbeexplainedinthebook,andthatfillsmewithemotion andgratitude.

Asforthetitle,well,itadvanceswhatwillbemyprimarythemeinthis text.Weshallspeakessentiallyofpassionanditsfundamentalroleinhuman life.Psychologistsandphilosophershavesaidmuchaboutit.Generally,they refertothisenergyasiftheyweredealingwithadangerousandabsorbent illusion.IbelievethatheretheGoddesswillshednewlightonthisvery importantthemeinourlives.Shewillexplain,amongstotherthings,passion as being a real and necessary energy, in fact the most important of all energies,whichwehavetolearntodirectandmakeuseinourlives. Before we begin, I want to thank Her, for providing me with this beautifulmomentinmylife. AntonellaZara

Imnervous. Why? BecauseitlookslikeImfinallygoinginsane Sowhat?

Iknow.IknowitdoesntmaketheslightestdifferencewhetherIamcrazy or not. Whatsimportant isthatIamhappyandthatIcontributetothe happinessoftheworld.Isntitthatthisway? ThatswhatIhavealwaystoldyou. Andyouareright!Asusual.WhatdoYouthinkofmyideaofwritingdown someofourconversations? Itsanexcellentidea.Itswhatyouwant,isntit? Well,YouknowwhatIwant... Allright,ok,butifyouwritethisforothers,youhavetoexplain alittlebitaboutwhatyouwantexactly. ButIwantsomanythings! Ok,Antonella,Iknow,Iknow.Besides,I tolerateyouevery day(justkidding) Iknow...Everylittlejokehasalittlebitoftruthinit.Andthetruthisthat sometimesIcantstandmyself!Ifthesamehappenstoyou, infact,Ican understand. Ofcourse.Afterall,wehaveeverythingincommon. Everything?You,fromwhatIunderstoodsofar,arethisdivinepartinme, itswhattheycallthesoul,orGod,orGoddess,or...Well,Ithinkthatits betterifYouexplainit,because,truthfully,Ididntunderstandverywell. Iamyou. Thatsallthatyouhavetoexplain? Isntitenough? YouaremakingfunofmelittleAntonella Yougiveme,pardonmebutitis,theridiculousnameoflittle Antonellaanditsmethatismockingwithyou?Allright!

Youdontlikeit,doyou?IhavecalledYouthatmanytimes,becauseeach timeIfeelYourpresence,itsasifIfelttheenergyofalittlechildinsideof me.Somethingpure,cheerfulAndthenIthoughtthat Wouldyouliketobecalledthat? No...Honestlyspeaking,Iwouldnt Verywell.DontdotoMewhatyouwouldntdotoyourself. So,whatshouldIcallyouthen? Whatisthisinsistenceongivingmeaname? ButhowcanIhaveaconversationwithsomeonethatdoesnthaveaname? Youarejustdoingit. But, I dont know...Honestly, I would like it to be more of an intimate conversation.Weshouldtalkliketwogreatfriends. Andwearetalking. Really? Ofcourse.Doyouthinkanameisgoingtochangeanything? Youknowbetterthananyonethatitwouldntbe righttogive Meaform.Sometimesyousensemelikeafriend,sometimes yousensemeasalover,orafather,oramother,orwhatever youfeellikeatthemoment. Itstrue.SoIhavetogiveYouamoreunisexname. Youarestubborn.ButIlikethat. Doyoureallylikeit? Ido.YouknowthatIadoreit! SometimesIdoubtit. Iknow.Ifeelthat.Butwhy?

Idontknow.AtthemomentsinwhichIcantsenseYou. YoucantsenseMebecauseyoudontwantto. WhatyoumeanIdontwantto? JustwhatIamsaying.Youdontwantto.BecauseIamalways here ButIdontalwayslistentoYou. DoyouthinkIhavetheobligationtotalktoyouallthetime?If theGoddesswerelikethat,shewouldbeabigmouth,abore, anditwouldntmakesensetogiveyou,humans,theabilityto talk, because you would have to listen to Me all the time. SometimesIliketoremainsilent,andifyoucanthearMe,its becauseyoudontwanttohearmysilence.Everythingspeaks toyouallthetime Whatdoyoumean?Well,Ithinkwehavestartedtotalkaboutanimportant subject.Listen,beforethat,whatdoyouthinkofthenamePimpa?Itsthe nameofthesecurityblanketthatmygrandmothergavemewhenIwasa baby. Antonella,honestly,youcancallmewhateveryouwouldlike. Anyway,Idontliketheideaofhavingonlyonename.You,on Earth,needthattoidentifyoneanother,toknowwhoyouare, etc.Idontneedthat.IAm. Justamoment...Didntyousaythatwehadeverythingincommon?Then, theoretically,IalsoAm. Butyouare!Iamalwayssayingthat!Youare,nomatterwhat you do, what anyone thinks; you are an eternal energy incarnatedinaphysicalbody,goingthroughthisexperienceon yourownfreewill.Thatsall.WhenIsaythatyouneednames, Imean inthepractical andmaterial dimensionthatyoufind yourselfatthismoment,butyoudontnecessarilyneedthese names,andinfactyouhavetobecarefulwiththem.

10

Whatdoyoumean?Wow,IthinkIamgoingtobeaskingthatallthetime. ItsthesecondtimeIaskYouandYoustillhaventansweredmyfirst. Thatswhywearehere,isntit?Thesecondquestioniseasy: allofyoudontneednamesbecauseallofyouarebeingsthat cannotbedefined,thatareconstantlychanging.Youcantever knowanyone,notevenyourself,completely,becauselifeisan incessant process of selfknowing that doesnt end even in death.ThatswhyIsaythatnamesfillonlyapracticalneed, becauseitisntpossibletoanyonetobein this way or that. Allofyouarewhatyoudecidetobeateverynewinstance. ThatremindsmealinethatIreadinaFritjofCaprasbook(infact,itsa remarkablebookworthreadingunderthetitleTaoofPhysics)thatsaid: Themapisnottheterritory.Whathemeansisthatwecantthinkwe knowsomethingbecauseweknowitsnameorbecausewehaveavagueidea of its form. The description of a thing is always less absolute and correspondslesstothetruththanthethingitself. Thatsit.Thatiswhyreligionsmadesuchconfusionsleadingto manywars.Because,initially,wewouldsaythattwoormore peoplefeltMe,orfeltGodandwantedtodescribeHim,butin describingHimtheyforgotthattheyhadtogobackandfeel and describe that energy anew at every new instant. They started to think God,nottofeel,andboundthemselves toa descriptionofmetheyhadinformertimesandthatiscurrently obsolete; and transformed that description into an absolute pseudotruth(becauserealTruthisimpossibletobedescribedin humanterms),and,worseyet,theyresolvedtoimposethistruth onothersasiftheyknewbetter,wheninfact,becauseofthis, theyknewless!Thisisinrelationtothedogmas,thenamesthat youinventedandtherulesthatyouinsistedonstipulatingand imposing on your fellow man. Do you think that you know anything?Celebrateitandshareitwiththeonenexttoyou,but neverforgetthatessentiallyyoudontknowanythingandthat youalwayshavemoretolearn!Or:Constantattention!

11

Well,wewillgobacktothefirstquestioninrelationtomy phraseeverythingspeakstoyouallthetime.Areyouready foranexplanation?Itseemsacomplicatedmatter,butinfact itsverysimple. ExactlyasIseeYou!Simpleandcomplicated! Iamexactlylikeyou,mydarling.ItsjustthatIamalittlebit morerelaxed,freer,smarter...Butyoullgettheresomeday... (Laughter). Well,lets get serious. As it has been writtenin manytextsbeforeandwillbewritteninmanyafterthisone everythingisenergy.Thisisafact.Sometimeago,therewasnt anyknowledgeoftheexistenceofelectricalenergy,butthatdid not mean it didnt exist before that. Its the same with the energyofthesoul.Everythingcomesfromthesameenergy, letscallitacosmicenergy,ordivine,orfromtheGoddess.I amaneternalenergy,absoluteandomniscient.Inordertothis energy to experience in the diversity, it fragmented itself in infiniteanddistinctfrequencies.Thisway,forexample,matter isadensespiritualenergy;itsvibratingfrequencyisslowerthan the frequency of the spirit in an immaterial state. Lets not discussthisatlengthbecauseitsnotyourcupoftea,itsnot whatIwanttoexpressthroughyouanditsnotwhatinterests youthemost.Thisisthefoundationoflife.Whatmatters,in fact,isLifeitselfandhowtomake the most of it.Well,to that effect its better to talk a little about the foundation. Whoever wants to know more about the workings of the Universe, please read Mr. Walshs book that Antonella mentionedinthepreface. Tosummarize:whenIsaythateverythingspeakstoyouallthe time, I mean that everything is the same energy. Only the frequencieschange.And,ifeverythingisessentiallythesame energy, everything is inevitably interconnected. Nothing that happens to you comes to you by chance. You vibrate in a specific frequency and attract what corresponds to your frequency. The great fun about spirituality is to start taking noticeofthis!

12

Wait a minute, You just said The great fun about spirituality...People alwaystalkaboutspiritualityorreligiousnessasbeingsomethingserious, necessaryforevolution...AndsuddenlyYoucomeandtalkaboutgreatfun! Asifitwerealeisureactivity!!! Butwhatdoyouthinkthisisallabout?Antonella,lifeisan importantgame!Everyonessoul,rathersaying,allofthesouls together;inotherwords,IinventedthisgametoamuseMyself throughEternity,togettoknowMyselfbetter,toenjoyMyself! Thisiswhyallthewisemenalwaysarriveatthesameexcellent conclusionthatGodisLoveandthentheywalkaroundina stateofecstasy.BecausethatswhatIam.Thisenergy,whatI am,ispureLove!RealLove,Antonella.Iwanttoplayallofthe time! I am like this! For you humans this means, like any games,that,toplaywellorevolveinthegame,itsnecessaryto exert oneself, to commit oneself, to concentrate, to play seriously,butitsstillagame. DoYoumeanthatwearehereonEarthtohavefun? Exactly!Idontmean,ofcourse,asuperficialfunlikesome peopleimagine.Idontmeanthatallofyoucanstopeverything andstartmasturbatingallofthetime.Thatwouldendupbeing agreatbore.No.ThegameofLifeisthemostrefinedgamethat couldexist,agamethatchangeseverysecond,everyinstance,a gamethathasalifeofitsown! Wow!Itsreallyfascinatingtothinkitcouldbelikethat.Please,explain everythingtomeaboutthat! Ofcourse,tchutchuquinha!(IlovedthiswordIinvented) Youinventedtchutchuca???? Mylove,youstilldontunderstandMe?Ifeverythingisthe same energy, everything comes from Me!!! Brazil is an excellent place because everyone is very much connected to Me,veryopenabouttheenergies,andinthiswayIcancreate many wonderful things through them. My only job is to manifestMyselfthrougheverybeing,everymoment,inevery

13

partoftheplanetandtheuniverse.Itsapitythatpeopledont collaboratemuchmorewithMe. But,ifeveryoneisYou,howcanitbethattheydontcollaboratewithYou, orwiththemselves? Good Question! Well, to be modest, the game that we have inventedissobrilliantthathumanbeingshavethe possibility andchoiceofevolvingornotintheirpersonalgame.Andsowe returntoyourquestionaboutthegameofLife.Howdoesthis gamework?(laughter)Antonella,youwontbelieveit!Itsa greatinsanity! Insanity?ThatmeanstheGoddessisinsane? Quiteinsane,Antonella,Iamcrazy!Yahoo!!!Justbetweenus, toinventagamesuchasthis,onehastobeverycrazy!And veryfuckedupaswell! Allright,besidesthat,Youareapottymouth!TheGoddessisvain!You guys,Iamreallygoingnuts.Well,atthispointitdoesntmatter.Speak, Goddess,explaintomeYourinsanity.Iamcurious. All of you humans are, as I told you and many other messengers, eternal spiritual energy, or, souls, expressed in flesh by your own free wills. All of you agreed, like Earth actorsthatagreedtobeinafilm,allofyouagreedtotakepart inthegame.YouagreedtoforgetyourdivineoriginfortimeX, which is the length of the game, which your own souls stipulatedatthebeginningofyourownjourney!Ithinkwecan use someknownterms,thenletscall thisgameMaya.Ina higher spiritual dimension, time does not exist, neither does space, or cause and effect. But, by lowering the spiritual frequencyofthespirit,Icreated,orWecreated,thesocalled dimensions,inwhichallthespiritsareinvolvedinthegame ofLife. Thisisreallyincredible...But...Tellmesomething:ifitsagame,thenthis gamehastohaveanobjective!

14

Verygood!Ofcourseithasanobjective!OnEarth,theactof playinghasatitscore,theinteractionwithyourfellowbeings, socialization,todevelopyourowncapacitiesandcreativity,to testoneself,andintheendtofeelpleasureandhappinessfrom a challenge. Pleasure and happiness, when real, is pure celebration,theyarethegreatestmanifestationsofLove,orof Me.Byplaying,humanbeingsgetclosertoMe.Theobjective ofLifeisthesame,itstorememberandknowbetter,inoneor many lives, the divine or spiritual origin of each one of us throughtheinteractionwiththeworld.Themoreahumanbeing remembers itsdivineorigin,morepointsaregainedinthe game.Theonethatgetsthemostpointsreacheswhatyoucalled illumination,orecstasy,orliberationfromtheKarmicWheel. Fromthatpoint,ahumanbeingcan,initsphysicalform,feel, manifestandcelebrateitstruenature,whichismadeoflove, happiness and pleasure, and becomes free from the material illusion..Hestopsactingbecauseoffearofdisease,death,pain, or,hedoesnttransformtheseintosufferingbecauseheknows these are necessary experiences to the human character! He ceases to identify himself completely with his character but doesnotceasetoliveitfully.Wesaythat,inthemomentof illumination, human beings understand emotionally that they carryGodwithinthemselves,thattheyaresoulsexpressedin flesh,andthatfillsthemwithwarmthorLIGHT,whichis the emotional sensation that takes place when the entire emotionalblockageisdissolvedandtheenergyofLoveflows throughthehumanbody.Atthismomentandmanyothertimes, after this moment, anytime that the LIGHT flows freely throughtheirbody,youwillfeel,andotherpeoplewillfeelas well,Shining,radiating,enveloping,asifyouhadamagic whichwascontagiousandmadeonefeelgoodasapproaching you.Ifwespeakinmetaphors,wecouldsaythatthehuman beingbecomesastar,becauseitfindsitsownlight,orthathe, after a process of cleansing and deconditioning, reveals the spiritual diamond that everyone carries within himself or herself.

15

Letstakeiteasy,littleGoddess.LetsimaginethatwhatYouaretellingme is the truth...This would mean that nothing has any importance since everythingonEarthisanillusion!Whatfunisittoreachthatconclusion? Whereistheecstasyinthat? Well, in fact, the illumination sometimes happens in various stages, as it did to you, and in this case the person doesnt readilyunderstandtheecstasyistobeabletogiveeachthing theimportancethatyouwanttogivetoeachthing!! Wait!!AreYoutellingmethatIhavereachedillumination?Dontyouthink youaregoingalittletoofar?Whatwillpeoplethinkofthis? Scared,eh?Listen,Antonella,itstimetostopthinkingthatyou have to be someone special to have the experience of illumination, or that something supernatural happens in that instance.Itstruethatsomeoftheilluminatedonesdeveloped somesupernaturalpowers,becauseithadtodowiththeirrole inthegame.Jesus,forexample,wentaroundcuringpeople,but heneverstoppedinsistinguponthefactthathewasaregular person.AsonofGodand Goddesslikeanyotherperson.A personthatdidmarvelousthingsbutalsomademistakes!He hadtomakemistakes,andallofyoudotoo,becauseitspartof thegame,becausemistakesmakeyougrow,evolve,learnfrom oneanother,andloveoneanother.Itisonlythrougherrorthat you understand that you need to learn, that you need your brothersandsisters,andthisway,understandtheexistenceof love:tobebetteryouneedoneanother.ThisiswhyJesuswas one of the first ones to talk of forgiveness and compassion! When he saw people throwing stones at a woman, he said: Thatwhohasnoterredmaythrowthefirststone.Andhedid notthrowastonebecausehetoohaderred,andbecausehehad compassion! Inyourcase,thisisthetruthAntonella.Nomatterwhosuffers the consequences, You have reached illumination. And you knowthis,andyouknowthatitsperfectlynormal,thatitcan happentoanyone,anditsnotbecauseofthisthatyouwont commitanymistakes.Youstillcan,likeanyone,doabunchof bullshitandforgetoncemorewhoyouare!Well,wehopethat doesnthappenYoucandoalotofcrap(infactyouhave,

16

eversinceyourillumination),buttotrulyforgetthatdoesnt reallyhappen. Iamgoingtotellyousomethingveryimportant:nothingthat existsintheEarthlydimensionisinthestateofperfectionand, at the same time, everything is perfect. In other words: everythinginthisdimensionissubjecttotimeandspace,or,its inprocessofconstant changeandevolution,oryetagain,it hasnotreachedperfectionyet!WhenIsaythisstateisatthe sametimeperfection,itsbecausetheprocessitselfisoneof perfection. We could compare this with the process of the creationofamasterpiece.Untiltheartistdoesnotdeclarethe piecefinished,itsbecausehethinksitsunfinishedandhasto makeitbetter.Buteverystepinitsimperfectionisthebeststep, theperfectstepatthatmoment,inthedirectionofitsobjective, and so, on the necessary routetodiscover perfection! Inside imperfectionslivesthelittleseedofperfection.So,intrinsically, everythingisperfecteventhoughitappearsimperfect.Theevil, theerrors,thediseases,thedisasters,etc.,areperfectpartsofa pathtowardsperfectionwherenoneoftheseexist,orparadise, ifyouprefer. Goingbacktoyourillumination,Irepeat:nothinghappenedto youbesidesagreatchangeinperception.Yourhumanroleis notheretocurediseases. Well,thingsarereallystartingtobecomeinteresting.Weareeventalkingof paradise! But, please, lets go step by step. Its true that a change in perceptionhashappenedtomeinthelasttwoyears,whenIsawagainthat greatlovethatImentionedinthepreface.Itstruethatthateventchanged mylife.Before,Iadmittedtheexistenceofagreatintelligentenergyaround me,andIstartedtocommunicatewithHer,prayinginmyownway,trying todevelopmyownintuition.Butuntilthenmyspiritualitywaslimitedto that.Itwasonlyafterthatevent,thatchange,thatIreallystartedtolistento You.BeforeIdidntbelieveinpastlives,thensuddenlyIstartedtobelieve inallofthat,becauseIstartedtofeelYou!Ireallystartedtofeelthatwe wereeternalenergies,thatwehavemanylives,thatmanyofthepeoplewe meet we have met beforeIt was something really extraordinary that happened.Bytheway,thankyouverymuch!

17

HowevernowYouaretellingmeaboutaveryimportantpoint.Yousaidthat Iamnotheretocurediseases.ThatmeansthatIamhereforsomethingelse? Iflifeisagame,whoseobjectiveistorememberthedivineessence,doesnt thatmeanthatthegameendswhenwereachillumination?Well,itsnot possibleforittobethisway,otherwiseIwouldhavediedButthenhow doesitwork?Therearevariousstagesofillumination?Everyonehasa mission?Andwhatismymissionnow???IfIamilluminated,doesntthat meanthatIhavearrivedattheendofmypersonalgame,whatdoIhaveto donow? Youhaveaskedalotofthingsatonce.Asyousaid,Ithinkits betterifwetakeitstepbystep.Princewouldcallthisslow love,letsmakeloveslowly,themostexcitingwaytodoit. Well,weshalltalkaboutitlater. Arewegoingtotalkaboutsex??? Ofcourse!Wearegoingtotalklotsaboutsex!Afterall,you andthegreatmajorityofhumanityjustthinkaboutthat!Ithink itstimetotalkaboutthis,dontyouthink?Letstakeitslow! Alittlesuspenseisgood,especiallyinsex,andyouknowthat. Ofcourse,thatweallhaveamission,Antonella.Letsimagine thatlifeislikeacomputergame.Thatsright.Andtheobjective of this game is to remind you of whom you are. And this, obviously,doesnotendwithillumination.Illuminationisbuta trampolinetogofurtheronthispath.Fromthenon,everything becomes more incredible, because at last you have the consciencethatlifeandeveryinstanceisauniqueopportunity toexpressyourdivinenature.Furthermore,althoughyoudont ceasetohavefears,whichareahumancharacteristic,youstop livinginfunctionofthosefears.Youcometounderstandthatto act is more important, despite the fears. Every action, every instance becomes a self challenge. You constantly challenge yourselftobebetter,withoutforgettingtoappreciatewhatyou alreadyare. Lets go back to the stages of illumination, well, previously,Icomparedtheilluminatedhumanbeingtoastaror adiamond.InAlchemytherealsoistheimageofturninglead into gold, because gold is a noble metal, which does not transformanymorebecauseithasreacheditschemicalplateau.

18

Inthesameway,humanbeingsthatilluminatethemselvesreach theirhighestlevelatthemomenttheyilluminatethemselves,or, theyfeeltheirabsoluteandeternalpotential,forwhichhasno superior stage, emotionally. When I say that you have illuminatedyourselfinphases,Imeanthattheprocessthatled toyourilluminationstartedmuchearlierthanthedaythatthe changeinyourperceptiontookplace. Previously, I also said that in illumination an emotional unblockingoccurs,andthatfromthenon,theenergyofLove flows freely throughthephysical body.Butthat,contraryto whatyoumaythink,isnottheend,itsapointofmutation,its thebeginningofanewpath!Fromthatpoint,asitisforan athlete that has reached his peak physical form, who has conqueredarecordandmustpassintoanewphase,itsupto theilluminated todirecttheenergythathehasfoundwithin himself.Hefeelsmanyemotionaltruths,truthsthatseemtobe esoteric clichs, but, even though, they dont cease to be intrinsictruthsofthehumansoul,aseverythingispossible, youcanreachyourdreams,etcandsoforth.Andthenthey startthepathtolearntoliveconsciouslywiththesetruths,and putthemtothetest,andattempttotransmitthem,whichisa morearduouspaththattheonetakentoreachillumination,but itisalsomoreinteresting. Wow,thatstrue.Ihavebeenfeelingthat.Butexplainmoreaboutthegame. Ihavesuchthirsttounderstand! Iknow,andIwantsomuchthatallofyouunderstand.Iamalso sick and tired of seeing people crying, when they could be happy and making other people happy! The game has been interesting so farbutitcouldbemuchmore,andallofyou knowthat.WhatitseemstoMeisthatallofyouareunwilling tounderstandthatyouareallresponsibleformakingthegame better,andthisimprovementmuststartfromwithin.Well,lets go.Suppose,aspreviously,thatlifeislikeacomputergame, butalivegame,abeauty,thatinteractswithyouallthetime. How do you proceed in this game? How to act in the best manner to win in your own personal game? Because, of course,itsnotaboutasitisinanerroneousearthyconception

19

beatinganotherperson.Therealobjectiveistobeatyourself, toimprove,evolve,toelevateyourownvibration!Ibelievethat themeanstoreachitisoneofthebasicquestionsallofyou have.Beforeallofthis,Ibelieveitsimportanttorestatethat everyone, withoutexception,canandwill,inthisor another life,reachilluminationinonewayoranother,becausethisis thecommonobjectiveofallsouls.Because,verysimply,sooner orlatereveryonewillrealizethereisnosuperiorhigh,thereis nodrugmoreinterestingorstrongerthantheenergyoflove flowing freely inside each and every one of us. There is a motiveforspiritualitysspreadingacrosstheworldandforus writingthistext.Thesoonertheworldperceivesthisthebetter, becausewewillcelebratetogether,besides,wewillavoidall thecatastrophesweareheadingtowards. Well,Iwilltellyouthebasictoolthateveryonehastodevelop toreachthatpoint:Attention!Payattention!Whenpeopleof the east speak of meditation, they arent talking about a complicated process; they are talking only about paying attention.Payattentiontothecomputerthroughwhichyou play,or,yourbody,yourmindandallofourperceptions.Itsa complexmechanism,butlikecomputers,itisatthesametime, veryeasytomanage.Insidethislivingmechanism,youhave variousdistinctpiecesthathavetobeinperfectworkingorder, inorderforthewholemachinetoworkwell.Isthatclear? Yes,Ithinkso. Very well. Oneof these mechanisms, thevisiblepart,isthe body.Thebodyisthetempleofthemind.Ineverypartofthe body,ineverycellisstoredallthenecessaryinformationfor your personal game. Its the body that receives, at every instance, the information from the outside world on how to proceed in its personal game.Daytoday,thefunctioning is elemental.Youneedliquid,nourishment,whichisthephysical energy consumed, and you need movement. If you are well programmedoreducated,youwillbeeatingcorrectly,and you will automatically know what to do with this energy, convertingthisenergyintoactionandmovementtowardsonly

20

what benefits you. The energy that you dont need is then expelledastransformedenergy. Howeverthebodyisonlythevisiblepart,whichobeysanother instancywhichwewillnamespiritormind.Themindisone thatstudies,interprets,andprocessestheinformationthatthe bodyreceives,andtakescareoftheperfectfunctioningofthe body.Bothareequallyimportant.Bothareinterdependentand need one another to manifest themselves. But who commands,letssay,isthemind.Havingreceivedwhatever informationthatyouwish,themindprocessesandtransforms thisenergyintotheenergyofdesire,whichtakesthebodyto the next movement, and so it interacts with the world that surroundsit.Inthemind,thoughtsaremanifested,anditsthis, Irepeat,thisforceorenergyofthought,orwillingness,which willdecidewhatthephysicalbodywilldo,andintime,itwill mold the shape of the body and it will be responsible for everythingthathappenstoit. Thethirdpartisthemostunknowntomanuntilnow,andso, themostimportant.Itsthepartoftheinformationthatthebody andthemindreceive.Generallythisinformationispartofthe inevitable process of cause and effect: theminddecides, the human body acts, the World reacts, and the body react in responsetotheWorldsreaction.Theinformationwithwhich you are familiar with comes from physical sensations and emotions.Currently,intheworld,humanbeingshaveverylittle conscience of this process, and they only succumb to it, believingthattheyareonlyvictimsofallthathappenstothem. Thegreatchangehappenswhentheybecomeawareofthefact (andthiscorrespondstothedevelopmentofspirituality,ora spiritualconscienceinthehumanlife)thattheycaninterferein thisprocess!Peoplearestartingtoperceivethattheycandoa lotfortheirphysicalhealth.Theyhavetotreatthebodywell becausetheyareresponsibleforthismachine.Inaddition,step bystep,allofyouarestartingtoperceivethattheycanalsotake controloftheirmentalhealth,or,theirspirit!Andfinallywe reachthemostimportantpartofthehumangame,thenecessary knowledgetoevolveinthegameofLife:themostimportant

21

part of the human mechanism, the part which we are all subordinatedto,itsthesoul. Thesoulisasubtleandeternalenergy;itsessentiallywhatyou are;itstheactorthatisencasedinfleshonEarth;itstheI Superior, the invisible conducting wire that sends all the information that the body and spirit receive in the form of emotions. If human characters are imperfect entities, within spaceandtime,aspiringtoanabsoluteandevolvingtowardsa desired perfection, it is because they carry all this inside themselves!Thesoulistheperfectandabsolutepartofhuman beings;thesoulisMeinsideandaroundeachandeveryoneof you.Theinterestingthingisthatallofyouhumansalwaysfelt thatsomethingdivineexisted,butyoualwaysbelievedthatit wassomethingdistantandsupernatural.Itstimetochangethat and to understand it as something present, real and more palpablethanyoueverimagined!GodorGoddessisinsideeach andeveryoneofyouandeveryonecancommunicatewithMe! PaycloseattentiontowhatIamgoingtorepeattoyou:thesoul manifests itselfthroughemotions.However,toknowhowto decodethisinformationthatthesoulsends,itsnecessarytobe awarethatthisisnotacasualprocess. Wow!Thisreallylookslikeinstructionstoacomplexgamethatisfilled withsuspense! Thatisitexactly!Thisgameisgreatfun,andIloveit,Ireally lovethesuspense.ButIthinkthatitistimeforallofyou,not onlysomesmartpeoplelikeJesusandBudaandallthatjazz,to startenjoyingthisgame! Bytheway,allofthemandallof thosethatstartedtoperceivewhatisreallyhappening,about whatlifeisreallyallabout,theyalllefthometryingtoshare thatwithothers.TofeelGodortheGoddessistofeelrich,but it is such richness that it is impossible to keep it only for yourself! Well, we shall go backto thesoul, or ME, if you preferImanifestMyselfthroughtheemotions.Thatiswhy attentionisessential.Becauseitsnecessarytoperceiveandto understandemotionsinordertoactasbestasonecan!First, then,itdealswithunderstandingthebasictruth:you,myloves, areessentiallyemotionalbeings!

22

Whatdoesthatmean? Imeanthatalltheintrinsictruthsmanifestthemselvesinyou emotionally,thatyoursoulismadeoutofemotionalenergy,the subtlestenergythatexists,andtolivefully,allofyouhaveto understand, before anything else, who you are emotionally, becauseallofyouareunique.Thatiswhythelaws,therules andtheformulasarenotenoughtoreachastateofwellbeingin society.Asocietythatreallywantstoevolveunderstandsthatit has to collaborate with the development of each individual human being, and this development only occurs when the emotionalworldofeachpersonistakenintoaccount. Ok,butwhilethatdoesnthappen,wehavetorollupourownsleevesand starttodevelopbyourselves,isntthatright? Yes, this is the conclusion you have to reach if you want somethingbetter.Letsgototheapparentlyhardtask:howto understandyourownemotions Apparently???Youhavethecouragetosaythat?Sincerely,theworldof emotionsisachaos!Itsnosurprisethatpeopledontputintheeffortto reallylistentothem!TheygothroughAnalysis,trytounderstandbyputting apsychologicaltagontopofeachofthem,andtrytodominatethem;they doeverythingbutlistentothem.Becauseemotionsare,infact,awhole bunchofcraziness.WhenIstartedtobequietandlistentomyemotions,I understoodthatIwascompletelydifferentfromwhatIthoughtIwantedto be!Ibegantohaveseriousdoubtsaboutmymentalhealth!AndIfoundout, thatdeepinside,allthatIthoughtIwantedtobewasinfactsomethingthat family,society,etc.taughtmetowant. IknowAntonella.Iaccompaniedyouinallofyourstruggles, andIamsincerelyhappywiththe outcome.Youimprovedso much!Totellyouthetruth,youwereveryinsipid,arealbore. Youwerealittlemissgoodytwoshoes,alwayswantingtodo good... ThereyougoagainwithYournews.Whatdoyoumean,alwayswantingto dogood?Isntthat,intheory,whatGodwants?

23

Godyes,theGoddessno...Hihihi.Justkidding,butasyousay, thereissometruthinthatjoke.Theanswertothatquestionis: yesandno!IfwearetalkingofthedivineGood,thatwhichis bestintheperspectiveofaneternalsoul,thatisevolvinginits personalgametogetclosertoitsdivineandlovingessence, thentheanswerisyes,becauseIwantalwaysandforeverwhat isgood.Whathappensis,withoutthisperspective,everything becomesprofoundlyconfusing.Allofyou,bybeingemotional mules (with all respect to the mule which is an adorable animal),youhadtocreatecodesofmoralconductbecauseyou just did a bunch of shit. Its just that, besides being so pigheadedtohavetoinventrules,youbecameslavesofwhat youcreatedasanaid!Infact,itworksoutthatwaywithmany ofthethingsyoucreate.Youcreatedlawsthatare intransigent and unfair; created an economic system that instead of facilitatingyourlivesmakesyouprisoners.Aneducationthat givesyourchildren,insteadofanopportunitytoflourish,makes themintofrustratedandaggressivelittlerobots! Well, without extending too far from the main question, Ill repeat: the Good is relative. Everything in the Earthly dimensionisrelative,withtheexceptionoflove.Love,whenit manifests itself, it does not matter what form it takes, it is alwaysabsoluteanddivine. Therestdependsonthemoment. Atagivenmoment,whattwohoursbeforecouldbegoodcan turnouttobebad.Inthisway,toacttrulywell,humanbeings havetodeveloptheircapacitytoreactwellemotionally,and youcantguideyourselfbyanyimposedexternalforce,you havetolistentothevoiceoftheheart. Infactthereisabookthattalksaboutthisvoicemagnificently,andthatis TheAlchemistbyPauloCoelho.Illbecitingliteraturethatisusefulin building spirituality for people to note down, read and make whatever spiritualsaladtheywant... Yes, do exactly that. Moving on: to only follow moral or rationalconceptsinordertotaketheirowndecisionsparalyses humanbeingsemotionally,andcreatesituationswheretheytrap themselves,andinevitablytheyendupmakingmistakeswith others, frustrating themselves, not knowing the reasons. The answer is very simple: because they did not listen to their

24

Hearts,didntdowhatwasbetterfortheirsouls,andsothey didntdowhatisbetterfortheworld. Wow,itseemsreally puzzling.HowdoIknowwhatisbetter?HowdoI listentomyheart? Hahaha,Igotyouthere,didntI?Itsagiantjigsawpuzzle! Youretellingme!SometimesIamcompletelylost,withmyself! No,thingsarentsodramatic.Infact,youhaveatendencytobe dramatic, Antonella. You and a large part of humanity. Everyone is taking things too seriously! I dont know why? Maybeyouthinkthatthingsbecomemoreexcitingwhenthey become dramatic, honestly, thats not the way. Ill tell you something: dramainexcess always becomesmelodrama;its tacky,boringandstupid.Itsnotgoodforyourhealth,itcan even kill and to make things worse its a sickness that is extremelycontagious.Doyouknowwhattheperfectenergyto counteractdrama,andtoequalizetheastralmoodis?Humor! When you are in the heights of drama, try to change your perspectiveandseethefunnysideofthings.Inthebeginningit willseemalittlehard,butwithtimeandpractice,everytimeit willbeeasier.Attention!Iamnotsayingthatyoushouldlaugh onsomebodysmisfortune.Butwhenyourownmisfortuneis inevitable,youshouldlookforwhatyoucanlearnfromitlet outagoodpealoflaughter!!! Oh,Goddess,sometimesIcantbelievewhatacrazythingitistohaveYou insideofme.Totopitof,Iammadlyinlovewithyou. Thatfeelingisreciprocated,Antonella!Ifyoudidntthinkthat itwastrue,whywouldIwastemytimerepeatingtoyouandthe othersallthethingsIcouldtellyouinmysleep?Itcanonlybe agreatlove,right?Ilove,lovethiscrazyworldofyours,this world,whichyouarecrazyenoughtofuckover.Iloveallof you,andIdontwantyoutodestroyyourselvesdoingwhatyou aretryingtodoDoyougetit?IbelievethatIambeingvery clear,arentI?Whenitstartsdawningonyouthatthereisareal andalivehistoryoflovebetweenMeandeachoneofoneof

25

youWow! Its going to be a great turnon. Life is BEAUTIFUL,youhavetofinallyunderstandandcelebratethis, not merely understand it literary, intellectually or philosophically.No.Youhavetolearntoliveaccordingtothis. Hereandnow.Rightaway!Thereisnotimetowaste! Butjustbetweenthetwoofus,dontyouhavealittletendencytoalittle drama,Yourself??? Youarealittledarling.Mymasculinesideiscrazyforyou! Touch.Sometimes,mysweetie,andsowegobacktotheidea that everything is relative, and sometimes, a little drama is necessary.Itspartofthegame.Inthiscaseitis.Thesituation iscritical,andthatsnojoke.Youaredestroyingyourselves, ruiningthisgreatgame.Youhavetochangethisnow,Now, thatiswhyIamnaggingawholelotofpeoplelikeyouwithmy message,sothatthewholeworldisinformed,sothateveryone knowsandunderstandsitassoonaspossible.Iamnotsaying thatdeathisnotanaturalprocess,everythinginthisdimension is born, grows, dies and is transformed, and this happens in natureandithappensinthelovebetweenamanandawoman. Whatiswrongwrongnotbecauseitsbad,butbecauseitis not the best for you, and its not the best of what you are capableofistokillthisprocessbeforeithasreacheditsfull potential and decidestodiebyitsownsake. All ofyouare doingitallthetime,killingtheEarth,killinglove,killingeach other,andspeciallykillingeachotherwithyourhabits!Nature istiredofallofyou.Nature,rightnow,likeamarriedperson, whohaslosttheirintensepassionfortheirhusbandorwife,and isstilltryingandtrying,untilreachingthepointthatitsnot worthanymoreandthenshewalksouton.Doyouunderstand whatIamtryingtosay? Doyoumean thatitislikewalkingoutonamarriage???Ithasbeenless thanamonthsinceIleftafteratenyearrelationship!!!Andthisisbecause, suddenly, without any exterior push, I started to feel the hearts voice, insistingonmethatIhadtodothat,atthatspecificmoment!Whatareyou goingtodo,uh??IhavealreadyunderstoodthattheHeartdoesnotplay around,that,whenitwantssomething,itwillnagyouuntilyoudoit.Inthis

26

case,ithadbeenalongtimethatIhavebeencontemplating,inmyHeart,an eventual separation. But I didnt want to act until I was sure. One day, feelingthatthemomenthadarrived,Iputalmyclothesintotwosuitcases andwalkedoutofacomfortablepositionandagorgeouslittleapartment. We hadnt argued with each other, nothing bad had happened, but neverthelessIfoundmyselfinthislittlehotelroom,whichIfindmyself now.(Which,intheend,Ienjoy.ThankYou)IunderstoodthatIhadtodo whatIfeltrightbecausethebiggestregretthatonecouldhaveisnottohave done something. It wasnt aneasy decision, but,as incredible as it may seem,IthinkthatthisstepwaswhatgavemetheenergytotalktoYouthis way.Well,thisandofcourseallthethingsthathappenedtomewhileIwas marriedandwhathashappenedtomeduringthesedays Ofcourse,allofthegoodandapparentlythebaddonothappen bychance,everythingispartofthesoulsstrategytomakeyou evolveinyourpersonalgame.Everyeventistheresultofall thestepstakenuptothatspecificmoment,inwhichsomething seemstosuddenlyhappen. Howeverofmarriageandthelove betweenmenandwomen,weshalldiscusslater.Afterall,we areheretodiscussspecificallyaboutthis,eventhoughwealso havetotouchonotherthings,sincetheyareallinterconnected. Ofcourse,inspeakingofthis,wehavetotalkaboutalltheshit youhumanbeingshavedonetoloveandsex! Sowearereallygoingtotalkaboutloveandsex?Wow!Youknowthatits thesubjectthatinterestsmethemost Behonest,Antonella.Itstheonlysubjectthat trulyinterests you.Youdonthavetobeashamed,no!You,orthatpartofMe thatisyou,thatshowthingswork. Itstrue.Iamthatway!Dearme.Werereallygoingtolaythecardsonthe table.Youeventalkedaboutallthebullshitthatwedo(whichmakesme think of all of mine)...You know how to be very harsh, dont you? I understoodthatitwontbeeasytolistentosomeofthethingsYouhaveto sayNow I understand why some people call You Father and others Mother:Youarestrictlikeafatherandcompassionatelikeamother Andlovingandsensuallikealover,andanaccomplicelikea friend, and playful like a child...I am all of these and much

27

more,Iameverything,Iamwonderful!IreallyAm!Whydo youthinkyourneighborputonsomeSalsamusic,whichyou love,atmaximumvolume?Becauseyouandhimandallthe peoplewalkingonthestreetsneedthat kindofenergy!Thats whyIimpartedtohimtheidea!Becausemusicisoneofthe most sensational things that human beings have created or ratherthatIhavecreatedthroughthemWell,letstakeitstep bystep,Antonella,becausewebothliketorush.Weshallspeak ofmusiclater.IbelieveIhavetogobacktotheissueofyour Heart,right? IthinkitwouldbehelpfultoknowhowtolistentotheHeart,andhowto figure out what we hear, because I thinkthis might be one of themost importantthingstoadvanceinthegame... Anditreallyis.Well,Iwastalkingaboutattentionbefore.Iwill havetorepeatthiswordmanytimesinthistext,becauseIdont thinkthatyouhaveunderstoodmuchaboutit.Attentionisthe essence!!!Allofyouliveinaworldwhereagoodpartofwhat you have invented serves to trap yourselves; its a way to hamper advancement in the game. You live surrounded by thingsthatdirectyourattentionstotheexteriorworld,youlive by being bombarded by spiritually useless information, information of all kinds that fills your minds with anxious thoughts, and as a consequence, creates a nervous and unbalancedlife.Well,ifnowyouhavedecidedtobelievein andtobetonhappiness,itstimetochangeyourhabits!Every moment and every bit of information that you accumulate counts!Everysecondthatyouspendshapesyourdestiny!So, thinkreallycarefullyanddirectyouractionsandthoughtson therightpath. First:nourishthebodyandthespirithealthily,sincebothof themworkinasimilarway.Whenyoueat,youhavetobevery attentive.Youhavetoaskyourself:AmIhungry?Iftheanswer isyes,choosethemostsuitablekindoffood,takethetimeto sit,eatslowlyandenjoythetasteofthefood.Theidealwould betohaveakindaconversationwiththebodyso,itgivesyou theinformationthatisnecessarytokeephealthy.But,because of the world that you live in, you have to generally obey a schedule,itsappropriatetoeducatethebodytoeatattheright

28

time.Sometimesthough,maybeonceaweek,breaktheroutine anddosomethingdifferent,becauseroutinedeadensthebody andthespirit.Youcouldfast,forexample.Doingthatisagood waytocleansethebodyandsharpenthesenses. Goingbacktofood,ifyouwantfoodtobenourishmentandnot anuisance,eatonlywhatisnecessarytofeelsatisfied.Ifyou wanttoevolvespirituallyatthesametimethatyouarefeeding thebody,feedthespiritatthesametime.Andhowdoyoudo that? Just by feeling. Enjoy the food! But enjoy it with attention.Thebodyactslikeanemotionalsponge,itabsorbs,at everyinstance,millionsofsensationsanditsuptothespiritto convert this extremely sensorial richness into high level emotions,so thatthebodyandthespiritbenefitfullyofthe nutritionalvalueofwhatisintaken!Theprocessofreceiving informationorfoodgoesthroughvariousphaseswhichhaveto be carefully developed. So,beawareof what youaredoing everyminute!Ifyouareeating,tasteeachthingthatgoesinto yourmouth.Developthepleasurethatyousense,eatlessand moreslowly,toreallyfeelthequalityofthefood.Gothrough thedifferentflavorsandsensationsthatthefoodprovokesin yourbodyatthatmoment. Illelaborate,withanothermetaphor,whichwillbeveryuseful when we talk about sex: your bodies are like musical instruments.Itstimetolearnhowtotunethemsotheymake thebestsound!Learntomoveyourbodies;learntoknowthem, tofeedthem,tofeelthem.Thisisessentialforyourwellbeing. Ofcourse,manyofyoumayask:buthow,ifIhavesomuchto do?Youmightsay:Idonthavetimeforthis!AndIwouldsay: whoeverwantstime,findstime.Nothinginpracticallifecanbe superiortoyourwellbeing,becausewithoutit,humanbeings canreallydoanythingthatsworthadamn.Andplease,dont confuse wellbeing with being accommodated or living in luxury.No.Wellbeingisaposture,astateofthespiritthat eachofyouhavetoeducateyourselveson,inordertoadvance inyourpersonalpath.Orrather:discoveryourselves!Devoteto Life, day by day, for example, three hours for your own development. I knowmanypeoplewouldlaughat this. And

29

theywouldsay:Threehours!Itsimpossible!AndIwouldsay, no. Onehourwouldbeforatleastforonecompletemealwiththe timetoenjoyandshareitwithpeopleyoucareabout.Another hourwouldbeforthebody,whichcouldbedividedintotwo 30minuteperiods.Discoverthemovementsthatgiveyouthe most pleasure. Welldirected pleasure is the key energy to existence.Weshallspeakofpleasurelateron.Themovements couldbetoswim,todance,towalk,whateveryouwouldlike. Practicethesemovementsforhalfanhour,forexample,andin the other half hour develop your flexibility through yoga or stretching.Inafewmonths,youwillseeyourenergysoar,and flow much better! You will feel more alive, more awake, lighter,andhappier.Itssosimpletomakemagicoutofthe energy,justbychangingyourphysicalhabits! Well,theotherhour,forexamplebetweenthe30minutesafter youawakeandthe30minutesbeforeyousleep:torelaxlighta candle,orincense,listentomusic,breathe,andenjoyamoment withyou.Fromthose30take10minutesinthemorningandat night and just breathe! Dojust that!Breathe,staysilent and observe your own thoughts. Dont imprison your thoughts! Generally,whatyouareusedtodoing,atthemomentthata thoughtpopsup,beforeyounotice,youholditinyourmind withtheenergyofyourwillandcircleitaroundandaroundup there.Takenoticeofwhatyouaredoingandstopit,stopforten minutesanddontwastetheenergy!Letthoughtsappearand dontholdthemandjustletthemvanish.Soonyouwillnotice thatotherthoughtswillappear.Dothesamethingwiththem. Observethisprocess.Youmightfeeluneasyinthebeginning, butitslikeusingamusclethatyourenotusedto.Youmay feelbothered.Thisbothersomefeelingmaymanifestitselfas uneasiness, anguishorfrustration.Observetheseemotionsas well.Itsnotbadiftheycomeup;onthecontrary,itsasign thatyouareclearingyourmind.Itsthebasicmaintenanceof yourcomputer.Observetheseemotionsandletthemequally pass.Ifyouhavegreatdifficultiesinstayingcalm,likeitsthe casewithyou,Antonella,wholovestothinktoomuch,inthat caseconcentrateonthenoise.Listentoeverylittlenoisearound

30

you.Orfocusonyourbreathing.Lettheaircomeintoyour bodyslowly,fillyourbelly,waitabit,lettheairoutslowly, thenbreatheagain,repeatingthisprocess.Bydoingthisthesoul startstorealizethatyouwanttocommunicatewithHER.Or, focusoneachpartofthebodyfortenminutes.Onthefirstdays ofdoingthis,youmightfallasleep.Butifyouexertyourself, youwillsoonbegintoconqueranewqualityofperception!!! Thisisverygood.Itsanewandunknownfeeling,asifadoor hadstartedtoopeninsideyou,andtherealenergyunblocking beginstotakeplace.Youbegintofeelmoreclearheaded,more attentive, the apparently insurmountable problems appear to dissolve and the solutions come by themselves. Everything changesatthementallevel!Andthenthemagicbegins Suddenlyyoustarttoknowthemovementsandrhythmsofyour minds! This is a great and marvelous voyage. You will suddenlynoticethattherearetwodifferenttypesofinformation inthemind:thesuperficialandtheprofound.Thesuperficial informationisfleetingandconfusing,itslikedirtthathastobe removed from the carpet. Generally, its dealing with fears, preoccupations,pains,andpleasuresofallkinds.Ifyouarewell relaxed,youwillnoticethattheselockupthemind.Because, whenyouletthoughts,sensationsandemotionsflowfreely,a newkindofperceptionemerges.Inthebeginningitwillonlybe anewsensation,butlittlebylittleyouwillrecognizeanew quality of thought. I call this profound information, and its whenyouhaverealaccesstoyoursouls. WiththisyouresumetheprocessoflisteningtoyourHeart,and whenyoulearnhowtodiscerntheconditionedthoughtsfrom thoseofthesoul,youbegintounderstandwhattodoatevery newmoment.Thethoughts,orrather,letscallthemideas,the ideasofthesoulsareclearer,andtheywilltellyouwhatyou shoulddotofeelhappier.Butitsessentialtoallowyourself sometimetogettoknowthem! Thesoulissomethingalive,likeeverythingthatsurroundsus.I amthesoul,andIneed,reallyneedtobeabletotalktoallof you,tofeelthatyouarepayingattentiontoMe!Previously,I spokeabouttherelationshipoflove,andIthinkitsthebest way to describe what the relation of man and its ISuperior

31

should be like. I said that your bodies needed to be felt, studied,listenedto,nourished,andmoved,inordertobeableto serve you in the best manner and in the same way the soul needs attention. Feel My presence inside yourselves, around you,noticethatIamhere.Iamalwayslovingandtakingnote ofallofyou,butIcanonlyhelpyouifyoudemonstrateareal willingnesstoknowMeandfeelMe,tocommunicatewithMe, andfinallyloveMe!Exactlylikealoverelationship!Whothat loves,lovesindependentlyofwhatitreceivesback,independent of the fact whether you are noticed or loved, but each and everyoneofyouknowsthatloveonlytrulyflourisheswhenits reciprocated!INthisbookIshallspeakmuchaboutlove,but much about love, because thats what I am. I am love. The strongestandthebrightestlovethatanyofyoumightknow.I amthepowerofPassion,whichIwillalsotrytoexplaintoyou. Well,letsgobacktotheideaofthesoul.You,Antonella,for example,wentandwalkedtheSantiagosJourneybecausethe ideawasconstantlyinyourmind,anditwasMe,oryoursoul, thatinformedyouthatyouneededthisexperiencetoevolve.In fact,itwasthisway,somemonthsafterthattrip,whichyou rediscovered your mission, in which you insist on being in doubtbecauseyourelazy,becauseitseemstoohard! Youmean Thatsit.Tobeawriter.Youonlyrememberedthisessential piecetoyourpersonalrealizationafterwalkingthe Santiagos Journey.Andwritingiswhatyoumostliketodo,isntit? Well,yes,besides,makingout,traveling,dancing,meetingandtalkingto people...TotellYouthetruth,whatImostlikeistolove,thinkoflove,talk aboutlove,makelove,andwriteaboutlove... Iknow,Iknow,andyouknowwhat,beingawriter,youcan fully develop all thethingsthatyoumost enjoy.However whenyouwentintoabookstoreandyousawthatpileofbooks, youthoughtthatyoucouldneverrealizeyourdreams,sinceit seemed impossible, right? Nevertheless its not impossible, nothingisimpossible,andtodayyouknowthis.Eventhough

32

yourestillafraidandstillhavedoubts,becauseitissomething difficulttoaccept!Thesoullikeschallenges,andyouknowthat faithcanmovemountains.Youknowthatwhenathought,ora profoundinformation,swimsinthemindforalongtime,its becauseitsthewishofthesoul,itsthepathmarkedforits humancharacter,andifyoubelieveanddoeverythingsothat thiswishisfulfilled,theWorldwillalsohelpittobefulfilled. Ordontyouknow? Iknow.Itrulyrealizedthat,itstillseemsverycrazytome.Itstoobeautiful tobetrue.Andyet,itstrue!!! Theprofoundtruthisalwaysmostbeautifulandmarvelous,my darling.Well,Ibelieveitstimetotalkalittlefurtheraboutit.I am explaining the process, but I think I have to give an example.Youhaveconstantlychallengedbutyouhavealways gottenresults. Yes, but there is a piece of theexplanation thats missing. Youhaveto explainwhathappenswhenwefinallystarttounderstandwhattheHeart wants. Youareright.Ilikeitwhenyouareright,becausethatdoesnt happen often (laughs).Youaretalkingabout acting.Inyour personal path, you will have constantly to switch between contemplation and action. Contemplation is always the first step,anditsessential.Itstheactoflisteningtotheprofound nature,asIexplainedabove.WhenyoulistentoyourHeart, yousuddenlycomeacrossyourdreamsandwishes.Iamtalking abouttheprofoundwishesanddreams,discoveredthroughthe Science. These are, you might say, the fuel of the soul. By realizingthem,yourealizethesoul,orIrealizemyselfthrough all of you, in the physical realm. Its very important to pay attentionandnottolabelthem,nottonametheemotionsbefore youreallyknowwhattheyare.Becausesometimesawishisnot what it seems! For example, sometimes you might feel a naggingsexualattractiontoaperson.When,infact,thedesire mightfadeawaywhenyourewiththatperson.Why?Well,it couldhavebeenforvariousreasons.Oneofthereasonscould bethatinthatmomentbothofyouwerevibratingindifferent frequencies,whichIlltalkaboutlateron.Theimportantthing

33

inthisexampleistounderstandthat,inthatmoment,thesexual desiredidntkickin,becauseitwasonlytherebeforesoyou wouldgetclosetothatperson!Thefactthatasexualencounter didntoccurorthatthattheotherpersondidntwantsexdoes notmeanthatyourwishwasinvain!Ifnothingisbychance,no encounteris,especiallythosethatyoulookforwardtoo!There isalwayssomethingtolearnfromeverymoment,andanacute attentionisnecessarytolearnfromthethingsthathappen.That iswhyitisbesttoavoidgivingthingsformswhichyoumight attach yourself to. If, because feeling sexual desires toward someone,wemayfurtherconfusethatwithaloverelationship, andwecanquicklybecomefrustrated. Well,toknowifawishcomesfromthesoulissimple:thetrue wishistheonethat,afterlisteningtotheHeart,repeatsitself manytimes,duringalongorshortperiodoftime.Fromthe momentthatyourecognizeawishasbeingacommandfrom thesoul,youhavetoswitchtoanactionmode.Itsawishthat ispossible,becauseitcomesfromthesoul,andyouhaveto realize it to become happier! Going back to the previous example,itsveryimportantthatyoudontattachyourselfto theformofthedesirebutitssubstance.Youfeelthatrepeated sexualdesireforsomeone,thatdoesntmeanthatyouhaveto be with that specific person. It might mean that the person crossedyourpathbecausetheyhavespecificqualities,which correspond to your desires, but maybe they dont have the combinedqualities,whichyoudesireinasexualencounter!I thiscase,theencounterhelpyoufigureoutwhatyouwantand what you dont. Its very important that you understand the conceptofnotgettingattachedtoformsofdesirebecauseto becomeattachedcaninterfereintherealizationofyourdreams. Letslayoutanotherexample:youwishtohavemoremoney andyoudontknowhow.Youkillyourselfworking,youare alwaystired,andyoustillcantgetwhatyouwant.Thisisa typicalcaseofanattachmenttoaformofdesire.Always,when youwantsomething,youhavetoaskyourself:whydoIwant this?WhatdoIwanttoachievewiththis?Inthecaseofmoney, itsusuallyaboutmobility,comfort,security,andhappiness.I

34

believe that we should talk about the lessons learned in the SantiagosJourney,Antonella.Doyouremember?Thelessons thattalkabouttheJourneyandthegoaloftheJourney.Please, speakofthem. Yes,theyareverybeautifulandimportantlessons.And simple.Whenthe pilgrimswalk,allofthemknowthatwhattheywantistoreachtheendof theSantiagosJourney.Itsthebiggestwishforthosewhotravelthepath, thegoalthat,slowly,allofthemarestrivingtowards,walkingeveryday.But atthesametime,theyknowthat,iftheygotooquicklytheywillbecomeill, andtheywonarriveattheirdestination.Theyknowtheyhavetotakeitstep bystep.And,bygoingstepbystep,theydiscovermanythings.Theyfind outthateachonehasitsownrhythm,andifyoudontrespectthatrhythm,it willbehardtoadvance.Theydiscoverthateachstepisimportant,andits necessarytobeveryattentive,becauseamisstepcouldendupinabroken leg,couldkillyou,ordivertyoufromyourpath.Andtheyalsodiscover, littlebylittle,thatthetripismoreimportantthanthegoaleventhoughits essentialnevertoforgetthegoalbecauseitisonthepaththatyoulearn about yourself. The way that you walk the path to your dreams is as importantasyourdreamsthemselves!IntheSantiagosJourneythereare manydifficultstretches,daysofrainthatmakeyouwalkonmud,dayson steepinclines,daysofwalkingthroughdry,aridandmonotonousfields.One ofthegreatlessonsoftheSantiagosJourney,besidesfaith,courageand perseverance,thethingthatismostimportantisenthusiasmandhappiness. Withoutthem,itsimpossibletoadvancefar. Ofcourse!Itsabouthavingtherightkindofenergy,agood energy,theaxenecessarytoattractwhatyouwishtoattract! Thepersonthatwishestoearnmoremoneytobehappyhasto become happier to earn more money! Because, to only kill yourselfbyworking,youareonlyseeingthegoalandnotthe path youre taking to get there! If the goal is to have more money and it always is, the important thing is to become happiernow.Hereandnow!Because,evenifonereachestheir goal,iftheydidntlearnanythingonthepaththere,theywont be able to enjoy the goal they have reached. Or, the most importantthingwhenyouwanttomakeadreamcometrueis how you walk in the direction of that goal! If a job, for example, tires you out, and drains the spirit and makes you

35

extremelyunhappy,itrarelywillbringyoutoyourdreamof beingricher. Youcanonlyberich,ifyouarefirstrichinside yourself! However,quiteoftenyouwilltellmethatthedreamseemsto benonsense,somethingimpossible.Inmycasetheexamples aremany:yourwishtowalktheSantiagosJourney,togoto ParisandtomeetthewriterAlexandreJardin,andyourwishto beawriteramongothersIbelievethatyouwillhavetotell these stories to explain how this really works! But all your wisheseventhoughtheyseemedabsurdinthebeginning,they were there because they were necessary to you personal development, and thats why they were possible. If you consciously direct this energy you can achieve anything that you want! Or, action is affirmation. Soon, and back again, contemplation, or observation, or attention returns, to know whatthenextstepis.Italwayssurfaces,becausewecallforit, or we start to attract this specific energy in the moment we assertourselves! So,whenawishsurfacesandseemsimpossible,whatdoyou do? Start by directing your thoughts and energytowards the wish.Informyourselfaboutit.Imaginethatyouhavealready conquered it. It seems ridiculous, it seems like something a childwoulddo,butwe,thesoul,wearechildren,andweinvent theworldthisway.Thoughtisanextremelypowerfulenergy. ThebasistorealizethewishesoftheHeartisexactlythesame onethatyoudiscoveredthatapilgrimneedstoadvanceinthe SantiagosJourney.Or,toevolveinthepathoflife,theseare indispensable elements: Contemplation, assertiveness, faith, persistence,courage,enthusiasmandhappiness.Andfromthen on,nothingcanstopyouonyourpersonalpath.Butyouhaveto believe!!!Always!Evenifyouhavedoubts,evenifyouhave failures,doubtsandfailurescomeonlytotestthestrengthof yourwishes,totestwhetheritsarealwishornot.And,oneach newday,itsuptoyoutodecideifyouaregoingtoinvestthe energy of your thoughts upon that wish. I would say that it woulddependonyourachievements.

36

Moreandmoreitseemslikelivingisacrazyscience. Anditis.Becauseitisnotanexactscience,asyouwouldsay, notinthatithasunchangingrules.Eachmomenthasitsown rules, or better yet, every moment is a specific emotional reactionthatfitsitselfwithperfection.Thescienceoflivingis thesearchforthisperfection,andsoitsmorecomplex,more completeandmorefascinatingofallsciences.ThatiswhyI toldyouthatyouhadtocallthebookTheScienceofPassion. LaterIwillexplaininmoredetailswhattheenergyofpassion consistsof,butIcantellyouthatitis,insidetheperceptionsof Love,orofMe,thegreatestvibratingfrequencyahumanbeing cancometoknow.Intheenergyofpassionresideseternity,the absolute, illumination, and perfection itself. But before that, letstalk aboutthedreamsrealizedthroughthescienceuntil now. DoyoureallythinkthatIhavetotellthesestories?PeoplewillthinkIam nuts! Arent you? (Laughter). No, seriously, Antonella, tell me please:Lookingattheworldthatyoulivein,haveyoubeen successfulindeterminingwhoiscrazyandwhoisnormal?You cant,right?Sodomeafavorandstopworryinganddowhat youhavetodo! Allright,allright.Again,yourecorrect.WheredoIstart? Howaboutfromthebeginning? Well,Iwilltrytodescribehere,twodreams(eventhoughtherearemore thantwo,butIbelievethesewillsufficeasexamples)thatIrealizedby followingthetacticsdescribedabove.EversinceIbecameawarethatit waspossibletohaveaconsciousconversationwithLife,everythingchanged forme.MoreandmoreIguidemyselfbythismethod(Iknowitsasilly waytorefertothis,butintheenditsexactlywhatitis).Itrytolistento myHeartateverynewinstance.Iputthisintopracticealmosteverysingle day,becauseeverydaywehavemanylittledecisionstomake.And,mostof thetime,thechoicesdontcomewithinstructionmanuals;itsnotpossible

37

to rationally know how to choose correctly, even what to choose. Its necessary to feel. Its not thoughts that lead us to the best action, its emotion;andthoughtisonlyatoolusedbyemotion.Emotion,forexample, willberesponsibleforchoosingbetweentwooptions,whicharerationally equallygood.Oritwillindicatethatoneoptionisnecessary,eventhough nothing rationally indicates it. Its about studying and developing our emotionaluniversestointuitivelychoosethebestpath. Well,IhavespokenatlengthaboutmydreamofwalkingtheSantiagos Journey.IthinkthatIshouldtalkmoreaboutthepracticaldetailstothe fulfillmentofthatdream.ThemomentthatIbegantoperceivethatitwasnt justanideathatcameandwent,themomentthatIbecameaware,through theScience,thatthistripwasarealwish,adream,somethingthatfrequently popped up in my mind, I put it into action. Practically, it seemed very difficulttomakethistrip,almostimpossible.Second,Iwasmarried,andI knew,IknewbecauseIfeltit,thatIhadtomakethisjourneyonmyown. Whatitmeantwas,beingphysicallydistantfrommyhusbandforalong time,forthefirsttime.ItwasadifficultpointbecauseIhadtohavethe necessarycourageandthecertaintytofightforwhatIwished.Third,Ihad nevertraveledalone,letaloneonfoot,withabackpackonmyback!Forall thecouragethatIhad,myfearwasgreat.Evenso,Istartedtoassertto myselfthatthedreamwaspossibleandthatIwantedandwouldrealizeit.I startedtoinformmyself,Italkedtopeoplethathadalreadydoneit,read moreaboutit,tryingtounderstandwhatkindoftrekwasbeforeme.Atthat moment,mentally,IhaddecidedthatIwouldmakethattrip,Ijustdidnt knowhoworwhen.ButIknewifIassertedandinsistedongoinginthis direction,soonerorlater,theopportunitywouldpresentitself. Myperceptionwasstartingtochange.BeforeIactedinaccordancewithmy materialpossibilities, Iplannedbasedonthem,andIwaitedforthemto change before I began to conquer my dreams. Suddenly, I began to understandthematerialobstaclesareonlytemporaryenergetichindrances. Thethingwastoperceivethemnotasroadblocksbuttobesurethat,ifIhad thatdream,somehowitwouldbefulfilled And,likethewaveofawandthingsbegantohappen.Maybeitsimportant tomakeitclearthatitwasnecessarytobeveryattentiveandpositivetosee thatthingswerehappeningandtotakeadvantageastheopportunitiescame along.SuddenlyIstartedtorunintopeoplethathadwalkedtheJourney,and cameacrossliteratureaboutit.MyhusbandandIwereplanningonspending

38

theEuropeansummerworkingonaSpanishisland.Weknewthatwewould gettherewithnomoney,sincewewouldhavehadspendallofitonthetrip. Itwasthenthatpossibilityofworkingaweekonanindustrialfairashort timebeforethesummer!IknewitwastheopportunityIwaswaitingfor;I feltthatitwastherightmoment.Inside,IdecidedthatIwouldmakethe JourneybeforetheEuropeansummer,inthemonthofMay.Inaweekof working,Iwouldmakearoundsevenhundreddollars,whichwouldbewhat IwouldneedtowalktheJourney.Ihadnoideaifthatwasgoingtobe enough,butitdidntmatter.Mymottowas:nowornever.Myprofoundest intuition was to dedicate one trip to Life, or to the Goddess, or to find myself,anditwaslikethisthatIhadfaiththatLifeitselfwouldhelpme. Justtoopenaparenthesisinyourbeautifulstory,Ibelievethat wehaveto emphasizetheimportanceoffaith.Not,likesome might think, a faithinadistant andterribleGodwhom you mustsubmitto.No!!!Whataboringthingwoulditbeifthings werelikethat!Iamtalkingaboutfaithinyourselves;faithin thismagicalthingthatyoucarryinsideyourselvesandthatis aroundyou,faithinExistenceasbeingadelirious,divine,and intelligentprocess!Beconsciousofthis!!!Giveyourselvesreal timeduringtheday,manytimesduringthedaytorealizethat youareALIVEandthatitissomethingmagicalandincredible, and that you have to use EVERY instance, because every momentisauniqueopportunity!Dothisandyouwillsee.You willstarttofeelenthusiasm,love,abundance;youwillbeginto feelMe,becauseIamallofthese!Thewordfaith,inHebrew meanscertaintyintheuncertainOr,dontwaitonexternal certainties to act, act with great certainty, the only certainty possible,thecertaintyofwhatyoufeel,whichisthefaithin whatyoufeel. Infact,withoutfaithnothinggetsdone.Itwasduetofaiththat,stepbystep, Ienduredthelastobstaclesthatwereonmywaytorealizemydream.I spokewithmyhusband,whohaddifficultyinunderstandingmymotivesfor wanting to take that trip by myself. But he had to accept it, when he understoodthatIhadalreadydecidedtodoit.Eventhoughwewerevery goodfriendsandhehadnevertriedtointerferewithmyplans,evenso, duringmytrip,inthefewtimesIspoketohimonthephone,Ialwaysfelt thathedidnotemotionallyagreewithmydecision,ordidntunderstand,

39

which made my adventure that much harder. But at that moment I had alreadyunderstoodthatthedifficultieswerechallengesbytheJourneyto testmywill.AndIfeltifmuchstrongerthatthistripwasessentialformy personaldevelopment Fromthenon,Ionlyhadtobuyabackpackandapairofsneakers,whichI endedupreceivingasagiftfrommymother,eventhoughneithershenor anyoneelseinmyfamilyknewofmyplans.Ididntwantanyonesopinion aboutmydecision.Besides,Iknewmyparentswouldworry,andwithout wantingto,theywouldbothermewiththeirworryingenergy. InthiswayonMay12,1999,IgotupinBarcelonaatfiveinthemorning, ate a yogurt, put my backpack, that I prepared the night before, on my shouldersandwenttothetrainstation,whereIwouldtakethetraintothe place where the Journey begins. I still remember perfectly that intense emotion of starting to realize a dream that seemed impossible. And the primitivefearthatIfeltwhenIstartedtowalkaloneonthestreetswiththe backpackonmyshoulders,fearthatmademewonderwhathellIwasdoing there,whywouldImakeatriponfoot,alone,inastrangecountry,whose languageIdidnotgraspatthetime.ButIalsoremembertheincredible energythatitgaveme,makingmecompletelyawakeafteronlythreehours sleep,andalsoagreatfaiththat,besideseverything,Iwasmoving.And little by little, more signs appeared and they started to help me get underway. Ilovedthistrip,Antonella.YourJourneywasgreat.Thankyou forbelievinginMe.Ithinkitwasworthofit,right? ItsmethatshouldthankYou!Itwasoneofthemostbeautifulthingsinmy life!!! Andyoutalkedaboutsomethingveryimportantintheendof thestory,whichwouldbegoodtorepeat.YouknowwhatI talkingabout,dontyou? Yes.Aboutthesigns. Yes.Oftheopportunities,thesignsandthecoincidencesthat comeupwhenyoustarttolistentotheHeartandfollowyour dreams.Ibelievethisisanimportantpoint.

40

Whataresigns?Moreandmorepeoplebecomefamiliarwith thisterm.Whenyouhearthisword,youmightthink,andwith reason, of traffic signs. When you are driving a car, youre usingamotorizedvehiclewithgreaterspeedtowhereveryou want to go. Traffic signs are helpful, they indicate the way, preventaccidents,andinformyouaboutroadconditions.The signsinthegameofLifehavethesamefunctions! Inthebeginningthegreatquestionwillbe:howdoIrecognize them?Atfirstthemindrefusesthispossibility,discardingitlike acomputerthatrefusesapieceofdatathatitdoesntfindinits programming. Later,littlebylittle,if thepersonal emotional searchofthepersonisreallyintense,shestartstotakenotice thatthereexists,evenifitssmall,possibilitiesthatthistypeof intercommunicationwitheventsreallyhappen.Morealert,the mindbeginsaprocessoftryingtodiscernwhatareandarenot signs,thinkingthattheyareseeneverywhereandmanytimes notperceivingthemoutofexhaustion. Well,firstofall,wewalkthepathsinthegameoflife,soasto allofyouperceivethesignsyouhavetodevelopaspecialkind ofattention,exactlyliketheonethatittakesforyoutodrivein traffic. Yes, a diffused attention, or, to pay attention to everything that is happening and at the same time, nothing specific.Sincethesignsaredeeplypersonal,somethingthathas emotionalvaluetoyoumightnotmeananythingtotheperson nexttoyou.Allofyouareemotionalbeings,andthesignsarea symbolic language that life, or the Goddess, developed to emotionallycommunicatewitheachandeveryoneandonly afterthisthattheydecideiftheywanttocommunicatewith Her. The workings of the communication are very simple and dependonly,Irepeat,ofyourattention.Toperceiveasignal, youhaveto,beforeanything,beawarewhatishappeningto youemotionally.Ateverynewinstanceyouhavetotakeinto accountwhatyouarefeeling.Howdoyoufeelatthatexact momentthatyouarealive?Whatobjectivedoyouhaveinthis

41

moment?Whatdoyouwanttoachieve?Thefirsthastodowith whathappensinsideofyou.InyourexampleoftheJourney, Antonella, you observed that, with the passing of time, you wishedmoreandmoretotakethejourneyonfoot,alone,and discoverandunderstandthemeaningofyourlife.Whenyou began to hear about the Journey again and again, you understoodthatitwasasignforyou,youunderstoodthatsuch atriprepresentedtheemotionalexperienceyouwerelooking for!Fromthenon,youstartedtomakegoals,eventhoughyou didntknowhowtoreachthem.Youobservedthatyouwould needmoneytorealizethisdream.Again,youwereattentiveto everythingaround.Andso,whentherightopportunitytoget moneycamealong,youdidnthesitatetotakeadvantage. Thingsreallyworklikethat!Observeemotionalmovements;be consciousofthem,makegoals,fighttoreachthemandatthe sametime,informingthemtoLife.AndIwillanswer! Themostincrediblething,littleGoddess,isthatyoureallyanswer!Inthe SantiagosJourney,Iputthistothetestmanytimes,anditalwaysworked! Itsjustlikethat,youlittledummy,youhadtheballstodoubt this and create that whole big drama after the Journey! I couldnt believe that you were such a crybaby after living throughsuchasbeautifuladventure! Iknewit.Ifeltthatyouwerepissedoffwithmeandjudgedmeonit No,no,no.Iwaspissedoff,yes,Iwassad;Ifeltsadnessand angerbecauseIamyoursoul,becauseIammadeofemotions. Butnoonejudgedanyone!Infact,youhavetoexplainwhat happenedtoyou. However,beforethat,Ihavetomakesomethingclear:Inever judge,Antonella!Iammadeofemotions,Iampureemotion, transformingateverymoment,buttojudgeisafunctionofyour mind.Youalldecidesomethingasgoodorbadandmeasure everythinginaccordancewiththeseparameters.Imnotsaying thatitswrongtohavestandards,inyourdimensiontheyare evenusefulsometimes,butitstimetounderstandthattheyare relative,thatgoodandbadarenotabsoluteconcepts.

42

Pay attention: nothing that happens is intrinsically bad! The simplestreasonforthisisthattheessenceofeverythingislove, the extraordinary energy that I am and that I am trying to explaintoyou.Loveistheonlyabsolutething.Inaway,of course,youcouldsaythatloveistheabsoluteGood,andthat evil,inthislevel,doesnotexist.Thesetruthscannotbedefined intherationalpatternsthatyouarefamiliarwithbecausethey deal with unchanging and eternal truths, and since human beingsarefleetingandshifting,theycantunderstandordefine them.Youcanonlyinferorfeelthesetruthswithyoursouls. Understandthis:allevilisonlyafleetingtestofwhathastobe overcomeinthetraveltotheBetterGood. Thisway,whensomethingthatisapparentlynegativehappens, trytounderstanditinthisprofoundway.Frequentlysomething thatisapparentlyterrible,intruth;isthebestthatcouldhappen to all of you at that moment. Try to understand why your unconscioustookyoutothatexperience,andifyoustudythe situationwell,youwillalwaysfindthatyouhadtolearnthe lessonyoulearned.Youaretheoneswhoattracteventsthatyou see as negative, when you act in ways that have disastrous consequences, because unconsciously, youre all tired of yourselves and you finally want to be more emotionally intelligent!Unfortunately,allofyouworklikethis,youlearn faster from sorrow and tragedy than from happiness and abundance.AndIonlygiveallofyouwhatyouwishedforand createdforyourselves.Whensomethinghappens,Mydesires are nothing more and nothing less than the wishes of all of you!!! Sincerely: if it was up to Me all the drama and the tragedywouldstopandwewouldbecelebratingallthetime! ButIhavetogivewhatyouwishfor! DoYoumeanthatIcreatedtheproblemthatIhadaftertheJourney? Ofcourseyoudid,andyouknowthat.Youweregoingnuts, youwerelettingyourselfbementallydraggedtoanemotional whirlpool that was, energetically, a catastrophe, and that attractedanimmensehealthproblemto you.Itsagoodthing thatSantiagosJourneywasuseful;atleast,tohelpyoureact wellatthetimetheproblempresenteditself.Atleastatthat

43

momentyoutooktherightdecision,youunderstoodthatthe waythatyoufelt,thought,andactedwouldberesponsiblefor everything that happened to you from then on. You stopped thinkingnegatively,toblameyourselfforalltheinsignificant things and concentrated all your strength on the present moment,ontheimprovementofthingsandontheattemptto comprehendallthathappenedtoyou.Youdecidedquicklyto no longer be a victim and youtook control of thesituation. Well,all ofyoucandothis!Youonlyhavetochangeyour perspective and suddenly, the worst situations become a challengeandaschool!!! Well,IbelieveIhavetoexplainwhathappened... Ithinkyoushould! (Deepbreath)ThetragedyhappenedaftermyadventuresintheSantiagos Journey. During that trip I puttothetest thosemethodsoftheScience, whichwereexplainedabove.Beforethis,Ialwaysfeltthatthingsworked likethis,butIstilldidnttrulybelieve,Istillhadntputitintopractice.I tookthattripbecauseofthat,todevelopmyintuition,mycommunication with Life. To that end, I left behind, for that space and time, rational parameters.TheonlythingthatwasdecidedrationallywasthatIwouldstart theJourneyatSt.JeanPieddePortandthatIwantedtofinishinSantiago. Besides that, everything was open. I didnt set a date in which I would finish,Ididntsetanydailygoals,IdidntevenhaveaguidetotheJourney. I only had a map of Spain, faith in Life, and an immense desire to understand and find my pace to advance in my personal path. I was confidentthatYouwouldgivemetherightemotionalsignssothatImight evolveinmyjourney.Ievenwascarefulnottogetattachedtothepeopleor groups during the walk. Just so I was more attentive to all that You indicated! Although I still would relate and communicate with a lot of people,IwasonlyaroundthemwhenIfeltthatourenergiesandourwishes meshed.And,itworkedbeyondallofmyexpectations!Everythingflowed inanamazingandmagicalway! Iknewthateachnewdayrepresentedanewchallenge,andsoIwasalways profoundlyalerttoeverythingthatIfelt.IfIfeltthedesiretostopandsleep underatree,Idid;ifIfeltIonlyhadtowalkfivekilometers,Idid;ifIfeltI hadtowalkfiftykilometers,Idid!Iamspeaking,ofcourse,ofemotional

44

desiresandnotsensoryones,whichIdiscoveredweretwodifferentthings, eventhoughtheymightcoincide.Infact,itwouldbegoodifyoumadethis pointlater! Anythingyouwant,mydarling.Ibelievethatitwouldbeuseful totalkaboutthiswhenwegetclosetotalkingaboutsex...Its veryimportanttobeabletodiscernbetweenafleetingsensation andarealemotion. Anditshardtoo.SometimesIfeltphysicaltiredness,butIemotionallyfelt thatitwouldbeworthittoovercomethattirednessandgoon.Or,evenifI felttired,IfeltIhadtocontinue.Othertimesthough,Ifeltthatthetiredness was,infact,morethansimpletiredness,itwasanappealbythebodythatit really needed to rest. So I would stop. In this way, I discovered the differenceandtheinterrelationbetweensuperficialsensationsandthemore profoundemotions. DuringSantiagosJourney,dreamsandobstaclestothosedreamshappened astheydointhepathofLife.Ihadto,forexample,astrongandincreasing desiretoleavethepathandfindaplacecalledTheValleyofSilence. However,sincethewaytherewasnotsignaled,itwentthroughaforest,and I didnt think I had a bit of a sense of direction, this seemed like an impossible thing to do alone. I started asking for information about the place, to talk about it with the peopleontheJourney,andinsist onmy solitaryconversationswithlifethatIhadadesiretogothere.Iendedupina refugethatwasafewkilometersoffthedetour.Ibefriendedthecaretakers thatwereinchargeoftherefuge;Icooked,celebratedandtalkedalotwith them,andgottheinformationastoreachthevalley.IfeltthatIcouldntdo italone,andbesides,somepeopleoftheregioninsistedondiscouragingme, sayingthatitwascraziness.But,atthesametime,myfaithwassostrong thatIreallybelievedthatIwouldmakeit,though.AslongasIdidntfigure outaway,Idecidedtowaitanotherday.Whatwasnotsurprisingtomewas thatonthefollowingday,duringaconversationwiththecaretakers,two pilgrimyouths,approachedusandsaidtheyheardtheconversationandthey alsowantedtotakethedetour!TheywereSpanishguysthatcamefroma mountainous region and had a great sense of direction! Together, we conqueredourcommongoals

45

AndthisisthewaythingshappenedtoyouintheSantiagos Journey.Onemagicmomentafteranother,onewishfulfilled afteranother! Butsoon... Whatif allofwhathappenedlaterhadnthelpedmesomuch,Iwouldbe ashamedofwritingit.WhenIfinallyfinishedtheJourney,Icametoagreat conflict. It was as if there were a real battle between reason and my emotions, between faith and doubt. I was lost within myself! I didnt understand what was happening! It was a true emotional whirlpool, a storm...And,insteadofremainingcalm,breathingdeeplyandobservingthe events,Ibecamedesperate. DuringtheJourney,IhadlivedtheScience;Ihadproventhespiritualtruths, whichIhadread,andalsothosethatcametomebyintuition.Ihadlet myselfbeguidedbyYou,Ihadenteredtheflux,livingfrommomentto moment,Iobservedandfeltthebeautyinthedifficultandhappymoments. But,afterIlefttheJourney,IwasovertakenbyaterriblefearthatIwould notbeabletolivelikethat,andasIgavemyselfawaytothefear,Itook myselfoutoftheenergyflux! By opening a new parenthesis, lets explain that which you foundtobethe flow,whichisveryimportant.Theflowisan emotionalsensationofaconnectionwithMe.Goingbacktothe exampleofacomputergame,tobeinsidetheflowmeansthat thehumanbeingfindsthemagicpasswordandcangointo anotheruniverse.Inpractice,thisisapurelyenergeticdomain. The energy of a connected person changes its vibration frequency,vibratingfaster,andshemoves,eventhoughinthe physicalworldnothingchanges,inanenergydimensionmore elevated.Allofyouhavetounderstandthat,inthesameway thatthereisamacrocosmos,thereexists,energeticallyinsideof you,themicrocosmos.Thesamewaythateveryplanethasits specific orbit, tobe ableto interact with perfection withthe worldaroundit,allhumanenergyactsinthesameway.Itsjust that,whileinuniversethis(whatdoyouthinkofcallingita dance?)happensnaturally,inthehumanuniversethisdanceis yettohappen,allofyouhavetoreachit.Bybeingconsciousof thisprocess,allofyoucanlearnthesteps,littlebylittle,inyour

46

own energy orbit, or, you will find your own perfect movements.Irepeat:allofyouareindividualenergyuniverses connectedenergeticallyasone.Everyonehastheirindividual vibrationthat,exactlyasinadancebetweentwopeople,where the rhythms of both bodies have to meet and form a single rhythm, the vibration of each one has to try to meet the vibrationoftheone,sothatthevibrationoftheonecanbe thatoftheindividual.Ifwewentfurtherinthediscussionofthe energymacrocosmos,wewouldtalkaboutotherdimensions, oflifeafterdeath,extraterrestrialsandmore,butotherpeople aretransmittingthesemessages.Throughyou,Antonella,Iwill speak only of the individual universe or, the energy micro cosmosthatallofyourepresent. Therealsearch(sofar,mostlyunconscious)ofallofyouisto increasetheenergyvibrationofyourindividualuniverses.This is the grand objective of the game, because the faster you vibratethe moreyoushine,themoreloveyouwillfeel,the more you feel Me. When a person achieves an emotional unblocking through the Science of Passion, or the emotional studyofoneself,theyarriveatanewexistentialfeeling!Igave youthetermflow,becausethepersonfeelsasifemotionally theyareflowingthroughariverofevents.Everythingseems strangelynewandrightatthesametime;everythingcomesas onehadwished.Itsaverysimilarsensation;infact,itsthe same energy vibration we feel when we fall in love with someoneandwehavethatfeelingreciprocated.Itspassionfor Life, or for Me, or for yourselves, its an almost physical sensationtobeconnectedtoasuperiorprocess.And,whena personfeelsthis,itsbecausetheyare,itsbecausetheyhave achieved, through their emotional search an energy level in whichtheycommunicateactivelyandconsciouslywithMe! Thatsright,becauseIfelt thatintheSantiagosJourney.But,whenIleft theJourney,everythingwasstrangelyconfusing. Dont.Dontforget:youmadeeverythingbecomeconfusing. Youhadoneofyourepisodesoffearandimpatience,andso youdisconnectedfromMe.

47

Youre right. I really did. Suddenly I started thinking that it was only possibletoenterthefluxbecauseIwasintheJourney,becausetheJourney is,noshadowofdoubt,averystrongenergyexperienceIwonderedhowI wasgoingtoapplytheScienceineverydaylife.Truthfully,Istilldidnt have much conscience that I had practiced a spiritual science. But I perceivedthatIhaddiscoveredmanyimportantthings.OntheJourneyit was easy to live them and share them with close people, because the pilgrims are normally the people that are searching, people open to the spiritual. But it was there, in the socalled normal world of work and routine,myentiresearchseemedabsurd.Withdespair,Itriedtounderstand howIwouldliveeverysingledaythewayIhadintheJourney,or,being consciencethateverymomentinlifeispartofabiggerpaththathadasits goaladreamthatIwastryingtoachieve,andthatithadtobelivedand enjoyedstepbystep.Ihadjustreachedagoal,Ihadlivedasensationof mindblowingfreedomduringthattrip,andsuddenlynothingcalledoutto meemotionally:nodream,nospecificemotion,nothing.Withmyhusband andfriends,Itriedtoappearnormal,Itriedtoacceptthefactthatinafew daysIwouldbeworkingtoearnsomemoney,butinsideIwasfilledwith anxiety. FinishingtheJourneywaslikeadeaththatIhadtoberebornfrom;Ithink youarerightwhenyousaidtheonlywaymyunconsciousfoundformeto remembertheessentialthingswastomakemesick.Ithenhadanulcerin thecorneaandIalmostlostmyvisioninmylefteye.FourdaysafterIgot homemyeyehurt,itwasredandswollen,andIcouldonlyseeawhite cloud.BecauseofitIcouldntworkandIhadtobealoneinBarcelonafora while. There the doctors told me that a corneal transplant might be necessary. To avoid that operation, I went through a whole month of intensivetreatment,withoutbeingabletoleavethehouse,readabook,write orbeexposedtoalotoflight.Withoutnoticing,thosedifficultmoments enabledintrospectionthatIneededaftertheJourneyandIdidnthavethe couragetorecognizebefore.OnlythenIwasabletogobackandremember thethingsthatareofrealimportance,thatbeingmyconnectionwithLife, withthepresentmoment,thecertaintythatweareresponsibleforallthatwe feel,think,do,andsotheeverythingthathappenstous,andwealwayshave thepossibilitytochangethesituationinwhichwefindourselvesthrougha changeinperspective.FromthatmomentonIneverstoppedpraying,taking sometimeforsilence,andreservingmomentsduringthedayforexercisesin listeningtoYou.

48

Whatitwas,afterthatgreatwhirlpool,anexceptionalreaction toatragedyyouwerelivingthrough! Yes,itwas.IfIhaderredbeforebecauseoffear,suddenlythesicknesscame intogivemeunknowncourage,eventomyself!Yes,suddenlyIsawmyself practicinginlifecourageequalorsuperiorthatofIhadpracticedinthe Journey.Peoplearoundmewereshockedwithmycalmandevenwithmy humorinrelationtowhatIwaslivingthrough.Whattheydidntunderstand wasthatthesicknesshadremindedmeofaveryimportantspirituallesson: that nothing is by chance. Knowing this, I started to observe and try to understandwhyIwasgoingthroughthis.AndIdiscoveredsuddenlythatthe sicknesshadgivenmevariousopportunities:firstithadgivenmeagoalto achieve,whichwastheimmediategoalofnotlosingmysight.Thenitgave methechancetospendawholemonthinabsoluterest,toreconnectwith Life. Fromthatmomenton,Irarelysuccumbtothosekindsoffears,eventhough theydosurfacefromtimetotime.IbelievethatitwasalsoimportantthatI understandthatwhileIwasintheJourneyeverythinghappenedveryfast,(I thoughtorwishedsomethingandsoonafteritcametobeinsomeform),in thepathofLifetheconquestsareslower,butarejustasstrong!Suddenly myfaithreturned,andthefaithtoldmetolistentomyheart,becausesooner orlateritwouldinformmeaboutmydreamsandofthepathIwouldhaveto follow.Andmyhearttoldmethat Itsaid:bepatient,Antonella.Becalmandobserve.Dontforget thateverythinghasitsowntime.Letsgostepbystep,exactly aswedidontheSantiagosJourney. Yes!AndsoIwasabletorecoverpartofthevisioninmylefteye!Andin thesameway,suddenly,thedreamsandwishesstartedtoreemerge.Ibegan torealizethemagain;Ibegantofeeltheflux.ItstruethatIdidntfeelthe sameintensityasIdidintheJourney,butIstillfeltitmanytimes. Iamveryhappythatwearetellingthistogether,Antonella! Well,please,tellusanotherdreamthatyourealizedthroughthe Science.Afterthatweshalltalkabouttheessentialdreams,like theoneyouarerealizingthisinstance,bywritingthisbook. Andweshallspeakofthelargedream,whichisthedreamof reachingcompletenessthroughaloverelationship.Wewilltalk aboutthebigdreams,themostdifficultchallenges,butwhich

49

take you straight to the desired vibration, or, love and happiness. But,repeatingwhatwassaidbefore,toreachany goalinthedimensioninwhichyoulivein,youhavetotakeit stepbystep.Acontractorthatwantstobuildahouse,knows thisbetterthananyone,heknowsthatitsnecessarytostartat thebottomandgoupbitbybit.Withenergy,theprocessis similar.Youwillhaveflasheswhichwillpermityoutosee and feel what could be achieved if you reached the needed energy,butthevibrationgoesdown.Thishappensbecauseyou havetodiscoverhowtomaintainit,howtobuild,orbetteryet, howtocreateyourlivesinsuchawaythatitpermitsyouto haveahighervibration.Intheend,alifethatpermitsallofyou tobeyourselves,tothemax. Icanhardlywait toarriveattheseessentialsubjects!Besideswritingthis bookfortheWorld,becausemybiggestdreamistobeaconduitofLight, helptheWorldtobehappier,ItakenotethatIamalsowritingformyself. TherearesomanythingsthatIwanttotalktoYouabout,somanythings thatarenotcleartomyself. Iknowthat.Iknowthatyouareveryimpatient, asalways,to knowallthatyouwishtoknow.ButIalsosee,andIamvery satisfied to see it; that you are no longer a slave to your impatience: You know how to enjoy the wait, because you knowthateverythinginlifehasitsmoment.Thereisatimeto write,thereisatimetoreflect,anothertomoveoneself,another tomakelove,andsoforth.Andyouknow,youknow,because youhavefaith,thatwhathastohappenwillhappen,sodont despair.Atthesametime,Iseethatyouarealert,becauseyou dontwanttomissanyopportunitythatIofferyou.Verygood, Antonella!Today,youarehappy,anditsbecauseofthatIam abletotalksowellthroughyou!Thankyou! Yourethankingme??? Ofcourse!!!IneedyouasmuchasyouneedMe.Ithoughtthat wasclear!IaminsideofyouasyouareinsideofMe.Itsalove relationship,andexactlylikeinaloverelationship,itcanonly flourishwithitsentiresplendorwhenbothpartiesarehappy!If

50

youarehappy,itmakesMehappy,ifyouaresad,itmakesMe sad. But...IthoughtYouwerealwayshappy! I am! I am love, and by consequence my nature, or, your profoundnature,iseternallyhappy.Iamhappiness!Seehere:I amhappy,butatthesametime,Ifeelthatyouareunhappyat thisexactfleetingmoment,thisexactmomentIamnothappy! Thinkaboutloverelationships,andyouwillunderstandthatit worksoutlikethis.Onepersoncanbeveryhappy,butifthey know that his/her love is not happy, then theymight not be completely happy. Well talk about that later.Continue your accountplease. WellIlldescribetwocrazydreamsthatsurfacedwithinmethatIdecidedto realize.Twoyearsago,sometimeafterIcompletedSantiagosJourneyand afterIwentthroughallthoseadventures,goodanddifficult,Sandro,my companionorshouldIcallhimexcompanion?... Itdoesntmatter.Callhimbyhisnameandforgetthelabels. Rememberwhathesignifiestoyouandthatwillneverchange independentlyofevents. Thatstrue.Well,SandroinsistedthatIreadabook.AtthattimeIwasin ArrialdAjuda,inBahia,theplaceIlivewhileIaminBrazil.Itwasabook thathehadreadduringmyabsence,whichwasalovestoryandaboutlove ingeneralbetweenmenandwomen.Thenameofthebook(whichisworth aread!)isTheIslandoftheLeftHandedandtheauthorisAlexandre Jardin.Itwasabookthattouchedmeprofoundlybecauseitdiscussedmy favoritesubject:thelovebetweenmenandwomen.Allmygreatfindings, alltheimportantthingsthatIlearnedinmylifecamebecauseofmylove encounterswithman.IreadthatbookandintimeIreadotherbooksbythat author.But,fromreadingthatfirstbook,Ifeltasubtleandstrangecertainty: Ihavetomeetthiswriter!Idontknowwhy.But,wheneverIreadoneof thechaptersofthatbook,IwascertainthatatleastonceinmylifeIhadto comeacrosswithanauthorofthesebooks,orthesourceofthatmagnificent energythatIfeltinreadingthoselines.

51

EversincetheSantiagosJourney,maybeevenbefore,Ifeltthesecurious intrinsiccertaintiessurfacefromtimetotime,soIstartedtoaffirmthiswish tomyself.Icantdenyit:Ifeltridiculous.Itwasasif,forsomemoments,I becameachildagain!Toaffirmthatsubtlewish,imagineforacoupleof secondsthatitcouldbepossiblemademehappy.And,yetagain,themagic process,ortheScience,wentintoaction. Some time afterward, I ran into an acquaintance of mine, a Portuguese photographerthatlivedinParis.SheinsistedthatIhadsomepicturestaken onthebeachwithher.IthoughtitwasafunideaandIdecidedtotakeher uponit.Onthedayoftheshoot,IhadmymakeupdonebyayoungFrench woman,whoalsolivedinParis.Whilesheputonmymakeup,wetalkeda lotaboutlifeandaboutspirituality,whichwasasubjectthatinterestedher verymuch.Itwasthen,duringtheconversationthatIrememberedthatIhad readthisbookbyAlexandreJardin,wholivedinParis.Idecidedtoaskher ifshehadeverheardofhim.Tomybigsurprise,sheknewafilmdirector thathadworkedwithhim!!!Hewasverywellknown.Idecidedtotakethe opportunity,andsendaletterthroughher.ButInevergotaresponseback. ShewentbacktoParis,timepassedandIkeptintouchwithher.ButIknew that, because he was well known in France, he probably received many lettersdailyandwouldrespondtoveryfew.Atthatmoment,besideshaving adesiretomeethimoneday,IhadnoideahowIwouldgoaboutmakingit so.Nevertheless,Ineverdiscardedthepossibility. Monthslater,IwentbacktoSpaintoworkagainduringthesummerseason inaSpanishisland.IhadtoworkbecauseIonceagainIhadnomoney.But Iwasalreadythinkingthat,atleastafterthesummer,Ihadtogoonatripby myself.TheSantiagosJourneyhadawakenedinmeatasteforadventure. Paris,backandforth,popsupinmymind.Ontheonehand,becauseitisa beautifulcity,thatIhadonlyvisitedbrieflytenyearsagoandthatIwas dyingtoseeagain,ontheotherhand,itsthecitywheremysecretdream livedat,whichIdidnthavethecouragetotellmanypeople.ButIknewthat themoneyIwouldearnwasnotenoughtogotoParisandgobacktoBrazil forthewinter,asIwanted.Ineededtofindajobforafterthesummer.I startedtotalktopeopleaboutfairs,whereIcouldwork.Tomysurprise, whenanacquaintanceofminetoldmethatinOctobertherewouldbeafood fairinParisandtheyneededpeopletowork!Iexcitedlyaskedhertoreserve aplaceforme.

52

Itwasthisway,inOctober,besidesmanyproblemsIhaduntilthatmonth;I usedallthestrengthatmydisposaltospendthosedaysinParis.AndIdid. Thoseweremarvelousdays,inwhichIvibratedalot,Iwasoncloudnine. Atmyarrival,IwassofascinatedbythecitythatIalmostforgotaboutmy dream. I didnt knowhowIwouldevenget tomeet thewriter.When I wasntworking,Isimplywalkedthroughthestreets,admiringthebuildings, observingthepeople. Oneday,asIpassedbyatouristinformationbooth,andIdecidedtostop andasksomequestions.Irememberedmydreamthen,andIdecidedtoask aboutit.IaskedtheattendanthowIcouldfindsomeonethatlivedinParis. Heaskedmethenameofthepersontoseeifhecouldfindhimonthe computer.Hefoundthatthenamewasonaredlist,meaningthatitwas impossible to have direct access to the person. I walked out of there frustrated.ThatmeantthatIwouldhavegonetoParisandIwouldntmeet Mr.Jardin!IwalkedsomemoreandIsatdiscouragedonabench,Ilooked atthepeoplegoingby,untilIthoughtthatIwasinsistingonmydreamtoo little,forapersonthatwassetonrealizingit! Ofcourse,Iwastheonethattoldyouso... ThatwasYou?!Well,ofcoursetheseideascanonlycomefromYou.I decidedrightthentogobacktothebooth.Iaskedthesameattendant,who wasbythewayverynicetome,ifitwaspossibletohavethenumberofthe publisherwhoputoutMr.Jardinsbooks.Hesaidthathecould,andina coupleofminutesIhadinmyhandsalistofphonenumbers.Iwentoutand calledthefirstnumberonthelist,whichwasbusy.Thesecondnumber,I wasabletotalktoamanwhotoldmethatifIwantedtogetincontactwith thewriterIshouldwritealettertothepublishinghouse.Eventhoughit seemedhard,IfeltIwasgettingclosertomyobjective. Idecidedtoinsistalittlemoreandmakeupawhitelie.ItoldthemanthatI wasajournalist,andthatIwasinParisonlyforafewdaysandIcamefrom BrazilspeciallytointerviewMr.Jardin.Botheredbymyinsistence,hegave methenumberofawomanwhowasinchargeofpressrelationsforthe writer.Ihappilycalledthewoman,whodideverythingtomakemydream harder,repeatingagainandagainthathewasaverybusyperson.Insidemy headIwouldsay:Iknow,andIamjustanordinaryperson,butifIwantto meet him, I will! Inside myself I fought off feelings of doubt, discouragement,lackoffaithandcourage.Withoutmuchenthusiasm,she

53

askedmetocallbackanotherday.Icalledmanytimes,butnooneever pickedup.Ionlygottheansweringmachine. Inthemeantime,Ineverstoppeddreamingaboutthatapparentlyimpossible meeting,anddidlittlecrazythings,likestandinfrontofamirrorandsaying outloudthatIwouldmeethim,dancingbymyselfthinkingaboutthatand etc.IwasalmostacceptingthefactthatIwouldnotbeabletoachievemy dream, when I made a last attempt: I left a message on the answering machineaskingthatshecallmeback,andIleftthenumberoftheplacethat I worked for. I was surprised to receive that same day a call from the woman,whogavemenothingmorethanMr.Jardinscellphonenumber!I calledandheanswered! But,onceagainIhadtohearhowdifficultitwastogetanhourwithhim thathedidnthavetime,etc.HeevenaskedmeifIcouldinterviewhimon thephone!Itoldhimthatitwasimpossible,thatIhadntcomealltheway fromBraziltointerviewhimonthephone.Ihadtoseehimpersonally.He wasresoundinginhisresponse,hetoldmeno,andhungupthephone. Ididntbelieveit!IgottoParis,Iwasabletocontacttheman,hadspoken withhim,Istillcouldntmeethim!!!Irememberthat,duringworkIwould pacebackandforthlikeawildanimallockedinacageasIdesperately thoughtofasolution.Itwasthen,inasubtlerage,thatItoldmyselfthat didntcarewhatthatmanthoughtofme,Iwouldkeeponinsisting!Icalled himbackandItoldhim:ImsorryImbeingsuchapainintheass,butI thought, even if it was implausible, there is always a small chance that someonewouldchangetheirmind.Ifsuchisthecase,Idecidedtoleavemy phonenumber.Helistenedtomywords,therewasamomentofsilence, andintheendheaskedmetocallthenextday.Icalled,andhesetatimefor ustomeetinhisoffice!!!!!!WOW!!!!Iwasinheaven! Ontheagreeduponday,Iwenttohisoffice,itwasaverysimplestudio, containingonlyabedandadeskwithacomputer,wherehewouldwrite.I broughtwithmeabagofchocolatesforhischildrenfromthefairIwas working,tobreaktheice.Hebroughtmeaglassofwaterandwesatonthe floor.Foranhourwespokeofhisbooksandhislife.Itwasaveryfriendly conversationwherewelaughedthewholetime.WhenIleft,Ifeltwonderful butempty.Well,wonderfulbecauseIhadrealizedadream,andemptyfor thesamereason.IaskedmyselfwhyIhadinsistedsomuchonhavingthis adventure,whichintheendwasonlyanhourofconversation.

54

SometimepassedandIunderstoodthedeepermeaningofit,thatitalljust camedowntolessthenanhourofconversation.Itcamedowntoasentence that Mr. Jardin told me when he was explaining a huge project he was developinginFrance.Thatsentencethathetoldmejustifiedthelongand difficult process of finally meeting him! The project was to resolve the problemofilliteracyinthecountry,whichIdidntthinkuntilthentobea greatproblem,whereretiredpersonswouldteachchildren.Hetoldmethat inthebeginningeveryonethoughthewascrazy,butheinsistedsomuch withthepoliticalauthoritiesthatitbecameareality.Theprojectreceived helpfromthestateandwascontinuallyexpanding.Mr.Jardinturnedtome, with a childs face, a child that believed in dreams because its worth believing,andhesaid:Anythingispossible.ForalongtimeIremembered thatmomentandIunderstoodthatitwasexactlywhatIneededtohear!I hadfulfilledthatdreamtotesttheScienceinreallifeandtounderstandthat, asdifficultasadreammaybe,whenitcomesfromthebottomofyoursoul, itispossible! Thatwasanothermagnificentstory,Antonella.Youhaveavery richlife,haveyounoticedthat? UnfortunatelyImnotalwaysconsciousofthis.QuiteoftenIfeelthatitsan undeniablefact,thatalthoughIhavealotofdifficultmomentslivingasIdo, myexperiencesareveryenriching.Othertimes,generallywhenIamgoing throughanemotionalwhirlpool,Imsad,weak,tiredorgoingthroughapre menstrualtensioncrisisWellinthosemomentsitshardertobeawareof thisrichness Infact,Ibelievethisisanimportantsubject.Whyisitthatmyenergylevel alwaysfalls?WhycantImaintainthatdelicioushappinessthatovertakes mesometimes? But you have been doing well, Antonella. Ever since you discoveredthatyouhavetoliveyourdreams,eversinceyou decidedtolistentoyourheart,yourenergyhasreachedmany heights! Well, its true, this last month for example, ever since I decided on the difficultstepofleavingmyhusband,Ihavehadmanymomentsinmylife whereIfeltalevelofenergysimilartotheoneIfeltduringtheVoyage. Nothing changed on the outside, I was alone, but I felt an incredible

55

lightness,myperceptionofbeautywasprofoundlyacute,itwasasifIwas moreconnectedtoYou,asIlistenedtoyoumoresharply And,ofcourse,ifyoufeelit,itsbecauseitshappening... Thisistrulyverybeautiful.ButIstilldontunderstandwhyIfeelthese strongfallingouts.Beforeyesterday,forexample,Iwasvibratingintensely, Iwasatthepointofbeingoverjoyedoveraslightbreeze,aleafonatree, anythingbeautifulthatcrossedmypath.Yesterdaythough,Ifeltcompletely spend,physicallyandpsychologically,myperceptionoftheexternalworld becamesoftened,Ionlythoughtofsleeping,andIwonderedhowIhadlost mystrength. Firstofallyouwerephysicallyexhaustedbecauseyouworeout yourself physically! Sometimes things are really easy to understandBut,ifyouwanttoknowifthereisanemotional reasonforyoutobephysicallyexhausted:yes,ofcoursethere is. Everything is emotional, even though all of you are a combination of different parts; you have to be perfectly balancedtobeabletoprovide,withconsistency,asensationof realharmony.Goingbacktotheideaofthebodyasamusical instrument,thestringshavetobeperfectlyintuneinorderto giveoffthebestsound.Youarecurrentlylivingarichmoment, andeventhoughyouhavetoworktoearnmoney,youwere abletofindajobthatyouhavefundoing,whereyoucanlive yourdream.Youarerealizingsmalldreamsthatyoualways had,likelearningcapoeiraandlearningtodance,activitiesthat furtherdeveloptherelationshipbetweenyouandyourbodyand yourintuition.Butthisjobofabarwomaninaclubisnotyour perfectbalancedstate,andyouknowthat.Aswellasyoumight live;sometimesthejobdemandsmoreofyouphysically.You sleeplittleandbadly,andbreatheinalotofsmokewhileyou are working. And yet, you noticed, by being closer to your dreams,youhavemoreenergythanyouhadbeforeeventhough youhadahealthierlifestyle!Thisisbecausethespiritualand emotionalsidesalwayspredominate.Whenyouareinlovewith someone,forexample,youfeelgoodinexteriorsituationsthat youmightotherwisehate.Passiongrantsareallyhighenergy leveltosomemoments.But,ofcourse,tomaintainthisenergy theexternalandinternalfactorshavetobeinbalance.Inyour

56

caserightnow,youhavesomeexternalconditions,whicharea bother,butyoualsohaveemotionalfactorsthatdestabilizeyou evenmore.Theexcessesyoucommitbecauseyoumisshaving alove.Amongthem,yourexcessindrinkingoryourrelationto theoppositesex,forexample. Excessindrinking? Yes,youknowthis.Idontmeanthatyoudrinkalot,youdrink thingsyourbodycantsupport,andyourbodytellsyousoby itsburningsandothersymptoms. IknowIshouldstopeverything;Ididforawhile,becauseIfeltmybody tellingmetostop.Itwasagoodphase;IfeltthatbynotdrinkingIfelt clearerinmyperceptions.Evenso,IwentbacktodrinkingbecauseIam crazyaboutwine.ItslikefeelingthatwineandIhavearealrelationship! Becauseofthat,Itrytocometoanagreementwithmybody.Iknowthatmy biggestobjectiveistovibrate,andfeellifetothemax,andmyconflictin thiscaseis,becauseIlovewine,IvibratewhenIdrinktoo,eventhoughat thesametimeitsoftensmyperceptionSoIdrinkwineonlyduringmeals andItrytoavoidothertypesofalcoholWhatdoYouthinkofthat? Ithinkthatyouknowandfeelwhatisbetterforyourbody. Thereisnothingevilinsomeglassesofwine;evensomeone like Jesus loved it.But if your objectiveisclear perception, winedoesnthelpyoudevelopit.Letsputitlikethis:when wellutilized,thisisadrugthatdoesntcausemuchharmand cantemporarilysuspendsomeenergyblockage,whichteaches thepersontotrymoretopursuetheirenergypotentials.Or,if youwanttodrinkwine,dosoattherightmoments,drinkasan art,withreverence,drinkcarefullysipbysip,feeltheflavor, enjoy and observe what kind of changes it causes on your tongue,feelingitdeepwithinyourbody.Wineisalsoasocial druganddrinkingwithreverenceandwithpeoplethatyoulike, couldadjusttheenergyfrequenciesofthepeopleandmakethe interrelationbetweentheenergiesflowbetter.Butbecareful! Because,likeanysourceofpower,ifitsusedbadlyordrankat the wrong time, it could provoke aggressiveness, violence, sicknessorsomethingworse.Iwillrepeatthismanytimesin

57

thisscript:moreimportantthanwhatyoudo,ishowyoudoit! Ifyouarecareful,andbeattentiveandreverentaboutallthat youdo,consequenceswillrarelybedisastrous. Evenworsethandrinkingwine,istofeelyourbodytellyou thingsandnottolistentothem,itstonotholdupyourendnot to drink only wine, or little damages that you impose on yourselfthatyoukeeprepeatingandthatyoualwaysfeellater onWhydoyoudothat?Certainlyforthesamereasonthat youabuseofsex.Youneedandlikelovesomuchthatyouhave tocompensatethisinsomeimpatientway,andsoyouendup havingsexthatdoesntfulfillyourneedforlove!Illtellyou: observeyourneedforlove,observeanddirectthisenergyof love that you have inside of you in a constructive manner! Whenyoucantexpressittoaman,dance,vibrate,talkabout life with people, do something that is worthwhile and dont wasteyourtimeonencountersthatareenergeticallypoorand dontadduptoanything! Shallwetalkaboutsex,littleGoddess? Ibelievethatwearealmostthere.Besides,wearetalkingabout pleasures and happiness. Until what point are they the same thing, and when do pleasures become toxic to the greater objective?Wehavetotalkaboutthat!Beforethat,itwouldbe goodtorestatewhatyoulearnedwiththerealizationtoyour smalldreams. Well,IlearnedthatIhadtostopbeingafraidandbelieveinthebigdreams! Becausebeforeyouresoafraidthatyouhaddecidedtoforget yourrealdreams! Yes,itwasduringthe VoyagethatIdiscoveredthatIwasntsoscared.I foundouttwothingsthatIwasamazedaboutmyself.Ifoundoutthatdeep inside,IalwayswantedtowritebutIdidntbelieveIwasable,andIwould nevertakethatdreamseriously.BecauseIwasafraid! IalsofoundoutthatIcarriedaroundwithmeanimmensesadness,which alwaysleftmefeelingheavy.Itwasaprofoundsadness,whichdealtwith thestateofthisworldandthelackofspiritualperspectivesthatitoffers.I

58

felt as if only money were important in this world, and this sensation burdenedme. Anotherthingthatmademeverysadwasthelovebetweenmenandwomen. BecauseeventhoughIopenmyselftolove,andIhavelovedmanymenthat havecrossedmylifepathfordays,ormonths,inthecaseofmycompanion, foryears,Ihaddifficultybelievingintherealityoflove.Itshardtolove;it doessomegoodbutalsoaterribleevil.Myrelationtolovealwayshasbeen thesameasmyrelationtomyself,anenergeticallyupanddownprocess, somethingmarvelousandalsosomethingunbalancinganddifficult. Icansaythatfearofsufferinghasneverstoppedmefromexperimenting someemotionthatIwishedtotaste,asithappenstomanypeople.Buton theotherhand,itmadeitsoIneverbelievedthatIcouldbehappywithone man.Ilivedthroughmanymomentsofgreathappinesswithmanymen,but Iwasneverabletomaintainasatisfiedfeeling,thatvibrationyoufeelinthe beginning,withanyofthemformorethanafewmonths.Soonerorlaterthe sensationthatoneofthetwolovedtheothermoreorlessthantheother,and thatwasalwaysverypainfultome.But,sinceIneededsomuchloveand affection,IalwaystriedtocontinuetherelationshipeventhoughIfeltan unbalance. Andthishasnowchanged... Yes,Ithinkso. Well,wearefinallytalkingaboutthebigdreams,ofthegreat dreamsinyourlifeandinthelifeofmostpeople.Yousaidyou feltfearandsadnessbecauseofthewayyousawtheworld. Andnowthishaschanged.Why? Because,IfinallyunderstoodthatitwasthewayIsawtheworldthatwas wrong!IntheSantiagosJourneyIhadsomeexperienceswithfearthatalso mademerealizethat.Inthemomentsthatfearparalyzedmeandmademe feelthattheJourneyasadifficultanddangerousjourney,thatshowthetrip was. FromthemomentthatIfacedandfoughtoffmyfear,theJourney becameafascinatingtrip,atrueadventure!Or:theworldwasneithergood norbad.Thewayinwhichweseetheworldcausesittobecomeexactlythat way!!!Ifweseetheworldasadifficultanddangerousplace,ittendstoturn into that. On the other hand,if westart tobelievethat itsamarvelous

59

challengeandwithactinaccordancewiththatsentiment,itstartstobecome amarvelousplace! Isuddenlyunderstoodthatitwasmethatwasgivingtoomuchimportance tomoney,itwasmewhowasscaredoftakingrisksandtodowhatIwould like,Iwastheonescaredoflove!ItwasonlywhenIunderstoodthisthatI wasabletofocusinanotherperspective,andbelieve,thattochangethe world,Ihadfirsttochangemyself! Yes,andatthatmoment,andonlyinthatmoment,didyoustart living with a double perspective, or living the Science. The greatdreamsofallofyouare:torealizefullyprofessionallyand emotionally.Or,todowhatyoulove,livefromwhatyoulove andtolivewithandwhoyoulove.Tolivefeelingpleasureand love!Thisisit,insomefashionoranother,thatallofyouare searchingfor. Itsashamethatmanytimesweloseourselvesinthissearch. And how you lose yourselves! But its okay; its not that serious...Whatisseriousistogiveupsearching.Wegoback then,tothegoalofthesearch.Ibelieveitsimportanttoclarify thispointbecause,whenthegoalismadeclearer,thepathshall becleareraswell.Beforewesaidthatthegreatestfeelingin LifeistofeelMe,tocelebrateMe,tobeunitedwithMe.And whoamI?Iamtheenergyfromwhateverythingisborn,the energythatisineverything,themostpowerfulenergy,Iamthe beginningandtheend,andtomakeiteasierforallofyou:Iam Love.Orrather,whenyoufeellove,youfeelMe!Itstrulyvery simple,butallofyoumanagedtomakeitcomplicated. We??? Yes and the complication started whenyou forgot the basis. When you forgot that all of you are really souls, loving energies,orratherpartsofMe,livinginatemporarybodyto experimentandtounderstanditselfbetter. Butifthatstrue,whydoweforgetthat?

60

Well,inacertainwaythatforgetfulnessispartofthegameof life.Youarebornasbabiesthatforgoteverythinginrespectto your past lives, and this way you have the opportunity to experimentwithoutthememoriesofpainandthemisfortunes thatyoucouldntfreeyourselffrominpassedlives.Thiswould normally be the ideal condition for the soul to evolve in its personalgame.Thegreatcomplicationinthegamehappened withthecollectiveforgetfulnessbyallofyouofyourdivine origin. Religion, which had as its initial objective to remind peopleofthis,intheendsuccumbedtotheillusionofMaya. Whatisthat? WedecidedbeforethatwecallthegameoflifeMaya.What does this game consist of? The eternal soul is born in a temporaryphysicalbodytoknowitselfbetter.Theillusionof Mayaoccurswhenahumanbeingforgetsthisfactandstartsto believethemaximumrealityiswhatheislivingthroughtheir physicalbody.Andthisillusionistakingplaceeverydayandin all parts of the world. The religions, for example, lose themselves because they want power over people in this physicalrealminsteadofsimplygivingspiritualsupport,which iswhattheyshoulddo. Youtalklikethismaximumrealitywassomethingobvious,likeitssoeasy tomaintainthisperspective!And,meanwhile,itsveryhardtodotwothings atonce:seriouslyplaysthegameoflifewithouttakingthingstooseriously! Ofcourseitshard!Ifitwasntthanthegamewouldntbeany funtoplay!WhenIsaythatitsverysimple,itsbecause,inthe end,toresolvetheproblemofliving,youonlyneedtofinda secret formula, like in a mathematics problem. From the momentthatyouhavethisformula,everythingbecomesmuch easier, even though it doesnt cease to be difficult. To be clearer,fromthemomentallofyouareabletomaintaindouble perspectiveofeveryinstanceofeternalsoulsandthephysical body,everythingwillchange!Trytodothis!Manypeoplewill saythattheywontdoitbecausetheycantbelieveinthissort ofthing.AndIsay:eventhosethatdontbelievecanpractice theScience!

61

How? Verysimply:becauseitswhatisbestaboutallofyou.Itsthe bestwaytolive,independentofthefactthatitstrueofnot! Thetruthissomethingverypersonal,thatway,everynewday, everyhumanbeingchoosestheirowntruth,whateverwaythey wanttolive.Iamnottalkingaboutadogmahere,notevenan obligation;Iamonlysayingthatthisissimplythebestwayto live that you could take up! Understanding life as a game createdbyandforthesouls,agameinwhicheverymomentisa challengeandachanceforunderstandinganditsnotatallby accidentThisisthemostintelligentwaytoseeit,comprehend andpracticeliving! Inpractice,itworksthesamewayaslookingthroughacamera, wereyoucanchangethefocusatanytime.Inthecamera,the moreyouopentheaperture,themorelightyouwillhaveinthe picture. Its very similar in life! When something becomes incomprehensible, change the perspective, try to see the situationfromtheoutside,andmorelightwillenterinyour mind.Suddenlyyouwillunderstandwhatyoudidntbeforeand whenthathappensyouwillfeellove,orratheryouwillfeel Me Toknowofthispowerwhichyoupossessinsideofyouisthe basisforanyonetobeagoodplayer.Whenyoumakethisan intrinsictruth,natural,whenyoucancontrolthisdevicelike you can control expelling of urine from your bodies, at that momentyoucangoontothenextphaseinthegame,whichis therealizationofdreamsandyourpersonalmission.Thebasis is then essential because without this base you will always despair,allofyouwillalwaysthinkthatwhenthingsdontgo asyouwishtheywould,itsalwaysatragedy,wheninrealityit doesnthaveanythingtodowithtragedy.Itsonlyachallenge onthepathtoagreaterrealization. Allright.So? From thenon comesthestoryoflisteningtoyourHeartwe talkedaboutbefore.Andbylisteningtoyourheartyoudiscover thesmallandlargedreams.Ifthesmalldreamishard,ofcourse

62

the larger ones will be as well. The great conquests are definitelynotforthelazyandmuchlessforthefrightenedOr rather,whomeverwantstoplaywell,whomeverwantstowinin theirowngame,hastoexertandriskthemselves!Wearehere, toanalyzetogetherthebestwayinwhichwecanachievethe heroicdeedswedreamabout. Wetalkedaboutpreviouslythatifsomeonewantstoberich theyfirsthavetofeelrichinside.Everythingthathappensinthe physicalworldisaresponsetowhathappensinthespiritualand emotionalworldineachoneofus.Youforexample,itwas discovered,anditwasnteasytodiscoverandacceptthefact thatyouwantedtobeawriter,thatyoualways,deepinside, longedforthis.Andhowdidyoudiscoverthis? Well...Ibelieveitwasthroughsearching,bybelievingthatthemeaningof mylifewasmorethanmyownsurvival.Ifirstfeltliketraveling,soIdid.It wasduringthosetravelsthatIaskedLifewhatIcoulddotobeusefulinthis Worldandtomyself.IunderstoodthatthebestwaytoservetheWorldwas bybeinghappy,byfeelingandgivinglovetotheonesclosetome. You also understood that you, Antonella, are a specific instrument,withaspecifictask.Youcantaskaguitartosound likeapiano.Everyinstrumenthasitsspecificcapacitiesandthe bestwayinwhichitcanbeenjoyed.Inyoursearchforself knowledge you discovered that there are specific things that wouldmakeyouhappy. Yes.Amongthem:totravel,totalktopeopleaboutloveandspirituality,to write,toloveandbeloved.AndsoIlearnedthatthebestwaytolivelike thiswastobeawriter.ItwasverydifficulttoaffirmthistomyselfbecauseI reallydidntfeelthatIwasabletofightforthis,andinawayIalwaysfelt likeanextraterrestrialinthesocietyinwhichwelivein.Ihadtodevelop myemotionalstrengthalottobeabletoawakenmyselfconfidenceand acceptandfightformydeepestdreams. Itwaslovethathelpedme.Amongotherthings,SantiagosJourney;my intense relationship with Alberto, a Spaniard, during the Journey; my beautifulreunionwithSandro,mycompanion,aftertheJourney;andmy mostbeautifulreunionwithDaniel,themeetingthatIspokeaboutatthe beginningofthebook,inwhichmychangeofperceptionoccurred.They

63

providedmewiththenecessaryenergyformetobelieveinmyselfWell,I hopenottohavetogodeeperintomyturbulentlovelife Ofcourseyoudo!Idontmeanthatyouhavetogointodetails, becausetheywouldntevenbeinterestingformostpeople,but youwillcertainlyhavetotalkaboutyouremotionalpath,which hasbeenanuncommonandriskyone.Itsnecessarythatother peopleunderstandthattheydonthavetobethesameasother peopletobehappy,thattheyhavetodowhattheyfeel,andyou areagoodexampleofthis ButIneverfeltanexampleforanything! It was Me that choseyouasagoodexample,becauseIam transmitting through you a truth that I want people to comprehend: live your own insanity without worrying what otherpeoplethink.Onlythenwillyoufindthetreasuresthe Heart hides for the people that ventured themselves by believing in happiness and love. And you are one of those people,Antonella,andthisconversationisoneofthetreasures youconqueredbylivingthroughallthepainandthepleasures thatyouhadtoliveinthefaceofallthefearyoufelt.Well,of youremotionalandsexualeccentricities,weshallspeakinabit. Before that, explain what happened from the moment you understoodthatyouhadtobeawriter. Well,Istartedwritingandobservingthatwritingwasntenough.Therewere specificmomentsinwhichIwroteaboutthewaythatIwantedtowrite,but thatdidnthappenoften.Inthosemomentsthewordspouredfrommeand thewritingflowed,theactofcreatingbecameindependentofmydesireand itputmeinastateofeuphoria.Inothermomentsthough,itfeltasifIwasa blockedfaucet,nothingflowed,Icouldntbefilled.Ibeguntounderstand that, to realize my dream, towrite fullyI hadtolivefully,I hadtobe vibrating! ThiswasthepointIwantedyoutoreach.Wegobackagainto theexampleofthepersonwhowantstoberich,butheonlygets therethemomenthefeelsrichinside!Allofyouareemotional beingsanditsveryimportantthatyouunderstandthatifyou wanttoprogressinyourowngames.Toreachthemaximum

64

potential,youhavetovibrate.And,thismeanspurelyasenergy. Youaremadeofemotionalenergy,andthisenergyonlyflows inthebestwaywhenyouarevibrating.Orratheryouhavetobe feelingit.Theworstsickness,theworststatethatanyonecan findhimselforherselfin,isinthestatewhereyoudontfeelor rather,youdontvibrate.Ifyouaregoingthroughamoment likethis,dontdespair.Thisis,likethedifficultstagesofpain and sadness, nothing more than an emotional challenge, a signal,somethingtobeovercomeandcomprehended. Whenyouwanttoreachforsomething,observehowyouare vibrating.Observehowyoufindyourselfemotionally.Ifyou arenotwell,ifyouarenotfullofenergy,ifyouarenotfeeling anything,trytodiscoverwhatisblockingtheflow.Onlythen, from the moment in which you recognize and remove the blockage,thatswhenyouwillbeabletogoahead.Itsvery importanttounderstand,withoutwellbeing,withoutemotional vibrations;itwillbeverydifficulttoadvanceinthegame. Infact,aftertheJourney,mydespaircamewiththerecognitionthatIwasnt feelinganythingIhadlearnedalotaboutdetachment,IunderstoodthatI needsometobeabletosurvive,butsuddenlyIhavedetachedmyselffrom everythingandIdidntknowwhattodo,wheretogo,or whosesideI shouldtake.Nothingspecificcalledouttome. Verygood,wehavereachedanessentialpoint.Thepointabout detachment is very important. All the mystics and spiritual masters talk aboutit,but eventoday,itsapointthatisnot interpretedwell.Fromthemomentthattheyareabletoadopta constantdualperspective,suddenly,achangeinperceptionwill occur.Youwillallbegintonoticethatlifeisjustabiggame, where nothing reallymatters. Itsanastounding sensation of freedom,itsreallymarvelousItsfeelingasifyouareapart ofamagicalprocessandnothingreallybadcanhappentoany ofus.Ifyoulivelikethis,thissensationwillaccompanyyouin allthestepsinyourlife.Inlove,forexample,youwillbeable tolovewithgreatintensityandtodeliveryourselfcompletelyto it,becauseyouwillunderstand,thateventhoughyoumightget hurt, laugh out of happiness or cry out of pain, nothingcan affect the connection you have with Life or with Me. This

65

connection will always be superior to anything that you are livingthroughnow. What happened to you then, we shall call: an attachment to detachment.Youvibratedsomuch,inyouremotionaldiscovery ofthedualperspectivethatyouendedupgettingattachedto that feeling of freedom. Suddenly, when you finished the SantiagosJourney,youstagnatedonyourspiritualperspective, andyouforgothowtogobacklivingyourpersonalperspective. Then,nothingmatteredanymore,andthatwasntinapositive sensebutinanegativeone,orrather,youdidntfeelmuchfor anyone,andthatswhyyoudidntknowwheretogoorwhatto do.Thishappenedbecauseoffear;youhadanintensefearof thegreat changethatwouldoccurifyoudecidedtolivethe thingsyouhadlearned,orrather,toliveasyoufeel.Itwastoo muchwork! Iwillnowtellyousomethingthatisanessential point.The spiritual perspective is useless if you cant go back to the personalperspective.Allofyouaresoulsoccupyingphysical bodies,andyouhavetoknowwhatthatmeans,alwayscarrying thedualpersonality.Onepartofyou,thesoul,isgoingthrough thisexperiencerightknowandwantstogothroughit,soyou willadvanceinyourpersonalgame.Butanotherpart,thatis equallyimportant,isthecharacterthatyouarelivingas,liveit fully,withallthejoyandallthepain,becausewithoutboth, youcantliveacompletelife.Thegreatconfusion,andthebig difficulty that you had was: how to feel passion, pain, happiness,howtolivethesethingsandbedetachedfromallof thisatthesametime?Itseemsimpossible,right?Butitsvery simple. Paycloseattention,becausethisisthetricktoacompletelife, onewithoutbeingcaughtinemotionalturmoil:tovibratetothe maxyouhaveonlytofeelittothemax,onlythatwhichyouare livingthroughrightnow!Thegoodthingaboutdetachmentis beingabletousetheemotionalmemory.Livethehereandthe now!Liveinthepresent,butdontgetlostinit.Whenyoulive throughsomethingmarvelous,enjoyit,laydownandsquirmin pleasure;whenyouarelivingthroughsomethinghard,livethe

66

pain,butwhenthatmomentispassed,trynottoprolongitby thinkingaboutit,livethenextmoment! Tobehonest,thisseemshard. Butitisnt!Itsjustanotherchangeinperspective.Letsgoto somepracticalexamples,becauseonlythenwillyoubeableto understandhowitworks.Weshallleaveitasagiventhatsince thestart we arepracticingtheScience,orratherthatweare observingourownthoughtsandfeelingsatleasttwotimesa day.Ifyouallarepracticingit,inashorttimeyouwillnotice thatyouwillpracticeitmorethantwotimes.Inthesemoments inwhichyouarenaturallyfocusedonwhatishappeningonthe insideandoutsideofyourselves,theSciencewillbecomepart ofyourlives. Letssaythatduringyourvacation,youmeetsomeonewhois marvelous and you live an unforgettable moment with this person.Butthispersonismarried,andhastoleaveandgoback totheirfamily.(Infactthisisagoodexamplebecausewecan talkaboutthemoralproblemsthatthisappliestoyoumostof thetime.)Well,soonyouwillnoticethattoseparateyourself fromthispersoncausesyouacutepain.Allrightthen,observe thispain.Livethispainandunderstandthat,ifyouarefeeling it,itsbecauseyoulivedthroughastrongemotionaldelivery. Youopenedyourselfup,energetically,toanewuniverse,and love had so much strength that it suddenly made you feel everythingdifferent.Thebigsecretistounderstandthat,even thoughthispersonhelpedyouopenanewenergyleveltothose specificemotions,hedidnttakethemawaywhenheleft!You havetounderstandthatallthethingsyoulivethroughareinside ofyou,thatitspartofyouremotionaltreasure,theyaregifts fromLifetohelpyouprogress!Everything,everythingthatyou perceive emotionally is experience chosen by your soul. Or rather,everyevent,everymeetingthatyouhaveistoshowyou somethingaboutyourself.Cry,butrightafterit,raiseyourhead andaskyourself:Whathasthisexperiencetaughtme?Whatdo Ihavetodonow?Whatismypath?Andneverloosesightof yourpersonalpath.Sometimesyourheartwilltellyouthatyou

67

havetotakeaflightafterhimtomakesurewhetherthatwasthe loveofyourlifeornot.Ifthisisreallywhatyoufeel,dontbe scared!Goforwhatyoufeel,butneverforgettorespectthe freedomoftheother.Inthiscase,ifthismanorwomandoesnt wanttostaywithyou,itisbecausetheyprobablydonotfeelit isthemoment for this.Respect theotherschoiceanddont forgettoenjoyandliveeachmomentofyourownlife. Whatdowedowhenthethoughtswontleaveusalone,whenwecantstop thinkingaboutsomeperson? Observethethought,distanceyourselffromit,anddontget lostinit.Beawarethatyouareonlysufferingbecauseyouare prisonersofyourmind.Whoeveralreadylearnedthetrickofa dualperspective,willsoonunderstandthattheirbeingsarenot boundtotheirthoughts;thatabeingexistsbesidesthatofthe thinker.Youdonthavetobewhatyouthinkyouare.Youhave to think about what you are. Or rather, dont obey the superficialthoughtsinsideyourselves!Createthethoughtsthat youwishthroughtheprofoundconscience. Whenathoughtisblockingyourvibration,emptythemind,asI taughtyoubefore.Breathe,observethebreathing,observethe noisesandthemovementsoftheoutsideworld,defocalize theenergyofthought.Doingthisisequivalenttopullingthe plug of an electrical appliance, andgive some time tothe computer,andtoallowthemindtocool,andlateron,observe theeventsfromadistancesoyoumayactmoreclearly.Ifyou dont short circuitthemind,thenitwillalwaysprovideyou withtheanswersthatarerightforthemoment. If Descartes, in some moment of certainty, said: I think, thereforeIamnowthereisahistoricmomentinwhichallof youperceivedthatthemaximumrealityisbeyondthought.The moreappropriatephrasewouldbe:Iamconscious,thereforeI am. Conscience is superior to thought; in the conscience, emotion and thought forge themselves together and form a unity,theyformlove.Whenyoudiscoverthatyoucanobserve yourthoughtsandemotions,youdiscoverthatyouaremasters over them, and dependingonhowyoudirect them,youcan changeevents.Themomenthasarrivedwhenyouhavetocease

68

tobevictimsoftheWorldandgettoknowwhatyouaredoing hereeveryday,throughyourownthoughts! Waitaminute.Idontunderstand.FirstYoutellmethatthesoulmanifests itselfthroughemotions,thatwehavetolistentoourHeartsanddowhatwe feel.AndnowYouretellingmethatwehavetocontrolourfeelings!That seemsterriblyrational!Andfurthermore,itscontradictory Good observation. Its just normal that there are apparent contradictionsinourdialog,becausewearetryingtodescribe in words a process that is very subtle, which hasnt been described. There arent any words to differentiate between emotionsthat arefeltoremotionsthatarethoughtof!Weare talking about sensations, emotions, and thoughts. However, wheredoesonestartandtheotherend?Itsverydifficultto discernthis,butitisnecessaryifyoudontalwayswanttobe victimsofyourselves. Emotioniswhatyoufeel,butfromthemomentyoustartto thinkaboutit,whatyoufelthasbecomeathought.Thisisa cultural dysfunction in all of you. Thought is something wonderfultosolve,withlogic,practicalproblems,butinthe worldofemotionstheyareveryharmful.ThatswhyIinsist that you observe what you are thinking about and distance yourself fromthethoughts.Attention!Idontmeanthatyou shouldstopthinking;Imeantothinkwithoutbecomingbound toyourthoughts,toletthemcomeandgonaturally,toobserve thegapsbetweenthoughts,themomentsinwhichthemindis silent,andyouwillfinallynoticetherhythmsinyourminds. Trytounderstandtheserhythms!Onlythenwillyouknowwhat youfeelandthenyouwillknowwhoyoureallyare.Mostof you,bynotdoingthis,becomewhatyouarethinkingnotwhat youfeel. Theproblemiswhenwestarttoperceivewhatwefeel;veryoftenitcomes inconflictwithwhatwethink! Yes,andthatswhyIsaythat,ifyouarentmastersofyour thoughts, you will always beprisonersof them,youwill do whatyouthinkandnotwhatyoudeeplyfeel,andyouwillbe unhappy. We have been talking about the importance of

69

vibrating emotionallyso that peoplewill develop themselves professionally.Andwhatdoyouhavetodotovibratemore? The first step is the unconditioning and unblocking of emotions.Theprofoundemotionswillonlybefoundwhenthe momentcomesinwhichyoustarttorecognizethesuperficial emotionsandstarttodifferentiatethemfromthepureemotions, those emotions that are independent of thoughts. The pure emotions,theonesthathavetobefelt,arethosethatsurface andfadeawaywithoutbecomingboundtothoughts.Itcouldbe anger,orhappinessorapain.Feelthemandlettheemotiongo sothatitmakesroomforanotheremotion.Aprofoundemotion isonewhich makesyouadvance,theseareyourwishesand dreams;theywillbeonesthatwillnaturallycomeagainand again. Youspokeofangerasifitweresomethingnatural. Ofcourseitsnatural! AndifwhilebeingangryIjustwanttokillsomeone? Inthiscaseitsabouthatenotanger.Andthatdoesnthappento you. Well,itstrue.SometimesIgetangry,butIdontusuallyhavedesignsto kill... Conditionedangerturnsintohate,andyouhaventexperienced this specificconditioning.Atleast,youdonthavethatgoing! Itsbadenoughforallthosethatyouhavesuffered... Thatsalsotrue.InthelastfewyearsIvediscoveredmanytrapsinmymind thatmadeithardtofeelgoodandbehappy!ThatincludesthewayIusedto seepeople.ItwasintheJourneythatIdiscoveredthatotherpeoplewereno betterorworsethanIwas,anditdoesntmatterwhatwealldo,becausewe areallinthesamepathoflife.Whatdiffersisthewaybywhichwetakeour paths.IreadabookbyShirleyMaclaineaboutSantiagosJourney,anda passagereallystuckwithme.Itsaidthatanytimewepointafingertojudge anyone,wearepointingthreefingersatourselves,sojudgingourselvesthree times.IstartedtobecomealertandIdiscoveredittobetrue.Wheneverwe

70

lookatsomeoneserrors,weareforgettingtolookatthemanyerrorsweare committing ourselves, at that same moment. I understood that it was impossibletojudgeanyonebecauseweallhaveshitinourlivesandno onesshitisbetterorworsethantheothers! Thatsright,youunderstoodthat,inthegameofLife,fearsare a large trap and the great challenge for everyone, and that everyoneexpressestheirerrorsinonewayoranother.Toerr isnottoknowthebestwaytoact.You,forexample,didntturn your anger into hatred, but instead you transformed it into depression,orhatredtowardsyourselfAndyoumightmake excuses, saying that at least depression didnt hurt the ones aroundyou,andIwouldsaythatitisalie.Everythingthatyou dotoyourselfaffectstheWorldinaprofoundway,specially thepeoplearoundyou. Understand this: anger is a natural emotion, and hatred is a thoughtaboutanger,oraconditionedemotion.Whoeverfeels hatredtothepointwheretheywanttokillsomeone,isaperson whoconstantlymaintainsthoughtsofanger,orrather,aperson whoisntwellbecausetheenergyofloveisblockedbytheir conditioning.Manyofyouremotionsareconditioned;theyare culturally taught and transmitted genetically.Your minds are computers that are programmed by the society and by the familyinwhichyouareborninto.Tochangetheprogramming, tobreakthebadhabitsandreconditionyourself,itsnecessary togettoknowyourself,tolearnbyselfobservationthatnotall thatyouthinkcomesfromyou;orrather,fromyourprofound naturewhichisalwaysloving. InMr.Walshsbook,hesaysthattherearetwobasicemotions andthattherestofemotionsarederivedfromthese:loveand fear.Observethesenegativeemotionsandyouwillseethat,in facttheyallhavetheirbasisinfear.Fearofpain,fearofshame, andfearaboutwhatothersthinkofyou,andsoon.Whenyou areabletoseethefear,whenyoucanrecognizethefearthatis camouflagedunderneatheverybadfeeling,atthatmomentyou shallfreeyourself.Becauseyouwillunderstandthatyoudont havetobeafraid.

71

There is something that bothers me in all this. You talk about this unconditioningasifitweresomethingthatsveryeasy. Ineversaidthat.Itoldyouthattheprocessiseasy,butitsnot aneasyprocess.Itsdifferent.Ialsosaidthat,whoeverwantsto advanceintheirpersonalgamehasalotofworkaheadofthem! All of you are still deeply conditioned and the work to unconditionisajobthatrequiresattentionineveryinstance, days,months,andyearsonend.Therecomesamoment,where attentionitselfopensadoorinsideyou,andsuddenlyyoufeel freeandrewardedforallthetimespentonsearching.Itsreally justlikethat.Onlytherisktakerswillberewarded!Ibelievewe cannowtalkaboutlovebetweenmenandwomen.Withinthis topic,itsessentialthatwebreechthetopicofjealousy,which is another conditioned anger and another deep fear, and its somethingthatyouknowwell.Sandroandyouworkedhardto freeyourselvesfromthisconditioning. Itwaslikeawar,heagainsthimselfandIagainstmyself. Iknow.Whatdoyouthinkoftellingusalittlebitofthatstory? Besides, it was you that said that the greatest lessons you received,wasfromthelovebetweenmenandwomen. Yes,infactitwas.IbelievethatIcametounderstandmanythings,but manythingsstillarentclear.IhopeYouwillbeabletomakethemclear. Thatswhywearehere. Well,SandroandIstartedgoingoutwhenIwasnineteenyearsoldandhe wastwentyfour.Westayedtogetherfortenyearsuntilmoreorlessamonth ago.Duringthesecondyearoflivingtogether,wedecidedtotrywhatsome peoplecallanopenrelationship,meaningthatwecouldbothdowhatever wewanted.Westayedthatwayfornineyears.Itwasagreatrelationship, fullofbeautifulmomentsbutalsomanyhardones,butwheneverwemeet eachothertoday,welookintoeachotherseyeswithgratitudeandwehug withtenderness.IthinkitsagreataccomplishmentwhenIseehowother relationshipsend. Anditreallyis.

72

Well,inthebeginningofourrelationshipwewerebothverypossessiveand jealousanditmadelifehardonbothofus.Butwehadastrongandsincere pact,andSandrohasagreatqualitythatIlearned,tobehonestwithhimself. So,Istillremembertheday,moreorlessayearafterwestartedgoingout, inwhichhesaidthathehadnoticedanotherwomanonthestreet.Itwas just that, he had only felt a fleeting interest for another person, but, in observingthat,heknewthathecouldnthideitfromhimselforfromme.I wasveryimpressedwithhissincerity.Iwasawarethatinthebeginningof ourrelationshipthathappenedtomeinamoreintensewaywithaschool mateandIhadntadmittedtomyselfnortohim. Fromthatmoment,westartedtotalkaboutit.Ihadalwaysdoubtedthe faithfulness model which we have been taught, and I only accepted it becauseSandrohadinsistedthatwetrytohaveafaithfulrelationship.At thatmomentthough,Istartedtoquestionfaithfulness.Whatdoesitmeanto befaithful?Icametounderstandthatnofaithfulnesscouldbesuperiortothe loyaltyweoweourselves. Myquestionsaboutlovewereandstillaremany,butsinceSandroandI werentafraidofriskingourselves,Icametodiscovermanyanswers. Attherightmoment,Igaveyouthat. Yes,ofcourseithadtobeattherightmoment,becausebeforethatIwasnt prepared to listen, much less tounderstandthem.Thetruthisthat these answerscandestroymanysandcastlesthatarebuiltontopoflove,and peoplewillhardlyeveracceptthis. Theywillonlyacceptiftheyaretiredofmediocrelovesandif they want to evolve in their personal game. But thats their problem and not yours. Youare only the conduit of truth.I thinkthatitstimetoreformulatethequestionssothatImight answerthem. Yes.Doyouthinksomeonecanbelongtosomebody? No.IfwegobacktotheScience,andthedualperspective,the answertothisbecomesveryclear.Allofyouaresoulsencased in temporal physical bodies, and nothing can belong to you. Any possession is an illusion. If it has to do with material possessionsorevenyourownbodies,youareresponsiblefor maintainingthem.Butthatsit.Butanyonewhohaslostsome

73

materialpossession,orlostaleg,oraneye,forexample(asit almost was the case with you), they will know that nothing really belongs to them. There was a great error made in conditioning, when instead of passing on the concept of responsibilityandcare,theconceptofpossessionwaspassedon instead. This error is deeply ingrained in all patriarchal societies,itslikeallofyoucarryitasadefectivegenetictrait, which makes your lives more difficult. This has to do once againwithafearthathinderseveryonesgame.Manyofyou defineyourselvesfromwhatyouhaveandthen,ofcourse,you liveinanxietywhenyouloseyourpossessions.Freedomcan only occur when you realize that its impossible to have anything.YoumightsaythatthisistheorybutIthinkthatits practical. Everythingchangeswhenyoustarttolookatyour materialpossessionsastemporaryloansmadebyLife,thatis whatthosematerialpossessionsreallyare. Inthecaseoflove,whichisofinteresttous,thisisevenmore obvious,eventhoughallofyouaregoingthroughhellfornot graspingthis.Ifyourownbodiesarenothingmorethanaloan madefromLife,howcouldyousaythatyoupossesanyone elses body? Ill tell you: love a lot, love with insanity, but nevertrytopossesoneanother.Whenyoudothat,youstartto killlove. Buttothinkthatway woulddestroyallthemythssurroundingmarriage, fromtheuntildeathdouspart,andhappilyeverafter! Thismythisalreadyselfdestructingallovertheworld.Toget marriedisnolongerseenasanunbreakablecontract,andthats verygood,becausepeoplefinallyunderstandthatthesearchfor quality is more important than the search for ease. But sometimes,itisstillthetrueway. Thetrueway??? Yes,becausesometimesyoufeelapassionandlovethatisso strong,thatitisasifyoufeltEternityitself.Andyoutrulyfeel it!Everygreatlovehappensbecauseoftherespectivewishesof thetwosoulsinvolvedtomeetandloveoneanother,orevery loveisbornfromthedivineandeternalpart,ineachoneofyou

74

andthatswhyitcantdie.Whatchangesispassion,passion is what guides usthroughphysical realityanditswhat you havetofollowtobeabletoselfrealize. Wait a minute. Everything is becoming very confusing. Love is eternal, while passion is temporary?What isloveandpassion betweenmenand women?Howdoyoudiscernbetweenthem?Whataretheirdeepmeanings? I am Love. Its the eternal energy from where everything is born;itsapieceofMe thatyoucantasteineverythingthat exists.Youonlyhavetofocusyourattentioninthebeautyof whatyouhaveinfrontofyou,andyouwillfeellove,andyou will see Me. This is eternal, unbreakable, and unchanging. Thats why, when you feel love for someone, you are experiencingsomethingdivine,youarecelebratingthedivine partinbothofyou,makingyourselvesmorecomplete,making yourselveshappy,makingMehappy.Thisistremendous.And thisislove. Passionisthestrongestlovingvibrationthatanyofyoucould feel.Passion,inaqualityscale,isthemostvibratinglove,the onethattransformsyouthemost.PassionisLove,orMein movement,itsthelovethatisexpressed,itsthelovethatis born, grows, dies, and transforms, is reborn, and so forth. Passionisthechangingandchangeable,likelifeitself.Passion is the indispensable expression of love and life, and its the Leitfaden, its the most important sign that you have to follow.Humanlife,itcouldbesaid,isagreatPassion.Passion is the sparkle that happens when a fusion of thought and emotion occurs; itsthedispersedattentionmanifestingitself throughalloftheorgans. Payattentiontothis,becauseitsaveryimportantpoint.Love isineverything,becauseIamlove,andIameverything,so loveneverdies.Howeverallofyou,ashumancharacters,even though you are interconnected with everything, still have to directyourlove,ortheenergywithin,ateverymoment.Since you find yourselves in a dimension where everything is temporary,youhavetocometounderstandthatitsfutileto attachyourselvestoothers,toobjects,eventolifeitself.Lovea lot,takegoodcare,vibratealot,butdontgetattached.When

75

you understand this subtle balance between love and attachment,whenyoufeelit,youwillstarttoexperienceavery, verystronglove.Thisloveisaconsciousnessofthevalueof everymoment,thisloveisPassion. Calmdown.Calmdown,littleGoddess.Youreconfusingeverything.We aretalkingaboutlovebetweenmenandwomen,andwiththisbasis,passion isalwaysseenassomethingillusionary,almostdiseased!Agoodfeverto which,preferably,youcantnourishbecauseitmightkillyou. Thatsthevoiceoffeartalking,andyouknowthat.Passionis notasickness; Passionisthesharpeststateofconsciousness thatonecouldreach,itswhatallofyoucrave;itswhatyou dont want to believe while going through it because its so strong and magical. The thing that transforms passion into sicknessareyourownfears,andthefactthatyouknowthat Passion informs you that to live a full life, youd have to completelychangeyournarrowlives! Readthiscarefully:thegreatobjectiveofhumanlifeistolearn, toremember,tolivewithPassion!Youknowthatstateofalpha andomegathatyoufindyourselvesinwhenyouareinlove? Thatsit,thisisthestatethatyouwanttomaintainandoneday youwillbeabletomaintainitforever,thisisthetreasure,thisis theobjective.Thisistheparadisewhichallofyoudreamabout, thevibrationwhichallofyoucraveforexcusemylanguage evenifitmakesyoubescaredshitless!!!And:thegoodnews! Soonerorlaterallofyouwillgetthere!Unfortunatelyyouare takingtoolong,muchtoolongtounderstandthisiswhatyou reallywant. You talked about sickness, and its true that many times sicknessandPassionareassociated.Why?Why,Antonella? Well...I...becauseofattachment? Thatsit,verygood,youareagoodstudent.Itsallofyouthat goteverythingconfused,really,everything.You mixedupthe factthatloveiseternalwiththemistakenideathatithadto manifestitselfasaneternalpassion,eventhoughnothingcanbe eternalinyourworld!Or,whenyoufeelpassionforsomething orsomeone,youwanttoimprisonit,youwanttopossessit,and

76

youwanttotransformitintoarelic,intoanobjectofesteem! When,inreality,whatyoushoulddoistoobservewhythatis happening,beawareofwhatitdoestoyou,whatyouarelike when you are impassioned, and to strive to reach within yourselvesthisvibrationthatyouregettingtoknowintwos Reachitalone??? Thepassionisnotwithintheother.Theotherisonlyacatalyst sent by Life, or Me to speed up the opening of this energy gateway,itsonlyanaidtohelpyoutogettoknowthepotential of Passion inside yourselves...It doesnt mean that you dont needanybody.Firstofall,youneedoneanothertorediscover God,ortheGoddess,orthepassioninsideyourselves.Then, whenyoucanmaintainanawakenedPassionallofthetime, you will need others to spread the beauty which you have discovered.Butbecareful!Thereisdifferencebetweenneeding anothertoshareourhappinessandneedinganothertobehappy. Thefirstisanidealstateofabundance;thesecondisavicious stateoflacking. I am going to open a parenthesis here and draw a little illustration to better explain the problem of attachment. Im goingtotellyouastory There once was a bird. A beautiful animal, adorned with a perfect pair of wings and beautiful, shining colors. Its an animal made to flyfreelyandlooseintheskyandtomake anyoneseeingitfly,fillupwithjoy.Oneday,amansawthis animalflying,andthefirstthingthathappenedwasthathefell inlovewithit.Hewatchedwithhismouthopen,inawe,with hisheartbeatingeverfaster,andhiseyesshiningwithemotion. Inthosemomentsthebirdandhimwereone,thebirdflewin the sky and in his heart, and this was a great Passion. He admired, revered and celebrated the bird with his emotions. Wordswerentnecessarytodescribewhathefelt,becausewhat hefeltwassuperiortoanywords.Butthenthebirdflewfar awayandhefeltfear.Fearthathewouldneverfeelthatagain. Hefeltalone.Sohethought:Iamgoingtobuildatrap.The nexttimethebirdappears,andIamgoingtogetit,putitina cage,sohewillneverleave.Thebird,wholikedflyingforthe

77

man,camebackthenextday,gotcaughtinthetrapandwas lockedinacage.Everyday,beforehewenthunting,swimming orwentforawalk,hepassedbythecage.Inthebeginninghe stilllookedatthebird,happyinhisacquisition,andhecalled hisfriendstoadmireit.But,intime,withoutknowingwhy,he lostinterestintheanimal.Thebird,notbeingabletofly,which wasitsgraceandthemeaningofitslife,withered,lostthecolor initsplumage,andonedaydied.Onlysometimeafterdidthe man notice that the bird had died, and he remembered him sadly.Buthedidntrememberhiminthecage.Heremembered himsoaringinthesky,likehefirstsawit.Sadden,hetookthe birdinhishands,burieditandcriedbitterly. AndthisiswhatallofyouhavebeendoingtoPassion. Itstrue!Inaway,wearealwayscryingbecauseofalostpassion! Generally,itsyouthatkillit,beforeithasachanceofdyingof naturalcauses,likeyourselves. Ihavemanyquestions!Inthestory,thereisacrucialmomentwheretheman feelsfear.Fearofneverseeingthebird,fearofneverfeelingthatagain, fearsofbeingalone.Sohemistakenlydecidestolockupthebird,andends upkillinghispassion.Whatshouldhehavedonewhenhefeltfear? Recognize it asfear.Carefullyobservewhat hewas feeling. Why was he feeling this, why was he impassioned, so fascinatedbythebird?Neverforgetthis:nothingisperchance. Ifhehadobservedhimselfwithfocusedattention,ifhestudied the Science, he would have discovered that what made him emotionalwastheflight,thefreedom,theenergyofthebirdin movement,itsgraciousness,andnotthebirdsphysicalbody! Whatwasfascinatingwaswhathewantedhimself:tofloat,be free,andunpredictable!!!Whatwasincredibletohimwasthat the bird had developed fully its capacities, the bird was complete,andthatswhyitshonesomuch.Toshineisaquality ofenergy,andwhenabeingexpressesitfully,itacquiresan intrinsic beauty, and it doesnt matter what it looks like physically.Themansawitinthebird,atthatmoment,thetype ofenergythathecravedtoreach.Whathemostcravedwasto becomplete,toshine.So,ifhehadstudiedtheScience,ifhe

78

hadobservedeveryoccurrencethroughaspiritualperspective, hewouldhaveaskedwhytheencounterwiththebirdhadmade himsoemotional,andhewouldhavefoundoutthesethings abouthimself!Ifhedidthat,everytimethebirdflewabove him,hewouldhavefeltanintensegratitude,andhewouldhave admiredandlovedthebirdmuchmore! When heacted unconsciously,whenheactedoutoffear,or rather without conscience, or without the Science, he didnt learnanythingabouthimself,nordidhetakestepstoreachhis own completeness. Besides having robbed the bird of its completeness,bylockingitupandindirectlykillingit,hemade himself unhappy and so the World. This is another good exampletoexplaintheillusionofMaya,orrather,whenthe man becomes a prisoner of physical reality and forgets the spiritualperspective.Whenhecameacrossthebird,theman thoughtthathehadtopossessitphysicallyinsteadofenriching himself spiritually through the encounter. And so, he went against the plansofhissoul,totakethemomentthatithad givenhimtofeelthatemotionandtolearnfromtheanimal,so thathemightevolveinhispersonalgame! That makes things much clearer for me! But there are still so many questions... Askthem! Wow!Idontevenknowwheretobegin.Letsgo.Wearetalkingabout lovebetweenmenandwomen.Ifweunderstandtheencounterbetweenthe manandthebirdasametaphorforaloveencounter,thatmeansthateach encounter,lovingornot,hasadeepermeaningwhichwecanunderstandvia theScience.AmIright? Yes. Butthatisterrible! Why? Because,whenwefallinlove,whatmakeslovesobeautifulisthefactthat wedontcomprehendit;wearelost,confrontedwithanewuniverse!And

79

suddenly,Yousaythatalltheencountersonlyhappensothatweevolvein ourpersonalgame!Thisiscalculated,itsrational,itsdisappointing! Watchthedrama...Herewegoagain,withyouexaggeratingand crying.Listen,Antonella,onethingdoesntexcludetheother! Whenyoutraveltoanewcountry,youdoitbecauseyoufeel calledtothatdirection;youdoittogettoknowanewculture, tolearnanewlanguage,togothroughnewencounters,andto growineveryway.Andaloveencounteristhesamething!Its like a new country that calls out to you; its a trip to an unknownuniverse,itsagenuineemotion,marvelous,difficult and easy at thesametime,anditsalso,oneof thegreatest teachers,whichcanteachyounewthingsaboutyourself! WellSeenitlikethat,itreallybecomesinteresting Nowomannocry,nowomannocry... Couldyoustopplayingaroundwithme? Ah,tellthetruth,youlikeit...Mydarling,myhoneybun,my littlecomplicatedone...Letskeepgoingbeforetheconversation cools. YouknowthatIcanttalktoYouforverylong.Igetsotired! Iknow.ButIllwait;dontIalwayswaitforyou?Iamalways atyourdisposal!Itsyouthatsthelunatic! Me?Alunatic??? Yes,andyouknowthisverywell.Ifyouarefeelingoneofyour chronicneedsfortenderness,andifyouneedtomakeloveand youdonthavethemotivationtolaybackandpleasureyourself, youre just intolerable! So stubborn that there is no God or Goddessthatcanmakeyousitandwrite! Listen, we arent talking about sex yet, all right? You said it yourself: everythinghasitsowntime. Yes,maam.Noneedtogethostile... Thatstoorich!Me,hostile?!

80

Youthinkthatyourejustprecious,dontyou?Butyouknow thatinreality,youhaveaveryaggressivenature.Imtalking about aggressiveness, which is a natural tendency, which sometimescouldleadtoviolenceagainstothersandyourself. Youhaveaverystrongaggressiveenergy,anditsgoodthat youarelearningtomanageit,becauseyouhaveagreatsuicidal tendencyYoulovetotheextreme,andyouareadepttostrong anddangerousemotions,whichis notbad,yougiveyourself over to absolute happiness and pain, screw yourself marvelously,andsometimesyoucantavoidthelossofthedual perspective,orrather,youlosethebalance Youretearingmeapart! No, my love, I love you. I am helping you to better love yourself,whichisessentialinordertoloveothersbetter,andbe abletoprogress.Andtruelove,orrather,Mylove,isawide vision,itstoseeeverything,toseethebeautyandtobecome morebeautiful,understand?IfItellyouaboutyourweaknesses, IdontdoitbecauseIwanttohurtyou,IdoitbecauseIsee whatyoucanbeandwillbe,ifyouwantto,ofcourse.Infact, toseethingsemotionallyisaveryfemininecharacteristicand unfortunatelymanywomendontknowhowtouseit. Whynot? Womenhaveapoweroftransformationthatisaccentuatedby thisemotionalvisionthattheydevelopbetterthenmanbecause of cultural and historical causes. But since they arent set, sincetheydontknowaboutormakeuseoftheScience,they endupusingthisqualityverypoorly.Intherelationshipwith men,forexample,theyendupbecomingreallyannoying!You knowaboutthisbecauseonedayyoubecameawarethatyou were acting like the typical woman, who just wouldnt stop naggingherhusband!Illtellyouthis,women:dontcomplain tomenbecauseitjusthastheoppositeeffect!Ifyouwantbetter men,bebetteryourselves,first,givetheexample,becomemore intelligentandteachwhatyouhavetoteachinamoreeffective manner! Womenteachingmen?

81

Andmenteachingwomen.Everyone,withnoexceptionisa studentandateacher.Thereisntapersonthathasntsomething tolearnorsomethingtoteach.So,developyourteachingskills, andbehumbleenoughtolearnfromthepeoplethatcrossyour path! Shallwereturntothelargertopic?... Letsgo.Weweretalkingaboutloveencounters.Everyloveencounterhasa deepmeaning.WhatistheroleofpassioninschemeoftheScience? Passionistheconductingwire,itsyoursongline,andits your map and your guide in the game of life. Your great passionsareyourmainobjectives,intheSchoolofLifetheyare your favorite subjects, the ones where you will be able to developyourselfandthosethroughwhichyouwillbeableto growandbetterservetheWorld.Rememberthis:thegreatgoal in life is to live impassioned for Life, for the World, for yourself,andforsomeonespecialandsoforth.Thisiswhatthe objectiveofthewalkis,andonlythosethatfollowtheScience willgetthere,ortheConscience.Wecanttalkaboutpassion between men and women without first talking the other passions,sincetheyareallinterconnected. Whatdoyoumean? Seehere,allofyouarecaughtupinaprocessoflearningwhich drivesyoutostudyyourenergiessoyoucanunderstandhowto vibratemore.Youwillenduplearningthatifyoudocertain thingsyouwillvibratemore.Inyourcase,youunderstoodthat youhavetowriteaboutspirituality,butyoudidntuntilnow becauseyouthoughtyouwereincapableofdoingit.Nowthat youhavefoundthecouragetoseparatefromyouhusband,you have found the courage to write this book, to enroll in a capoeiraclass,tolearntodancesalsaThatsalotofenergy! Andofcourse,itsnotbyaccidentthattheenergyforallofthis cameallatonce.Youhavediscoveredthat,inordertowrite something brilliant, to be a good conduit of light, as you wishedtobe,youhadtobe light,youhadtobe shinning,or vibratingalot.Andyoualsounderstoodthateventhoughyour relationshipwasverybeautifulandcomfortable,itdidntmake

82

youvibrate,itdidntfulfillyouanymore.Whenyoulookedatit carefully,youfoundoutthattheconveniencethatyouhadwas good, but it was unnecessary at this time. Its not needed anymore! You noticed that you felt tired a lot, drained, sad beside Sandro, eventhoughyoulikehim verymuch!It was hard,butyouunderstoodthatonethinghasnothingtodowith theother.Eventhoughyoustilllovehim,youknowthatatthis time,heisntyourpathofpassion;heisntthebestthingfor yourpersonalpath.Andthereisnothingtragicaboutit!Even thoughitshard Soyousee,thisandeverythingelsethathappensinthepathto completenessareshapesofLife,orofthesoul,orofMe,to helpyoureachthedeepestobjectivesthatyouhaveinthislife. Insidethiscontext,ofwalkingtowardsfulfillment,whenyou meetsomeonethatyoubecomeimpassionedwith,thatisthe exact scientific response by Life for that exact moment that youraregoingthrough.Inthisencounterthereisasecretkey, whichyoucantakeuptoadvancealittlefurther,tolearnalittle more. This is all very complex! When we meet someone and we become impassionedforeachother,wehaveafeeling,atleastinthefirstmoments, animpressionthatbesidethatpersonwefeelcompleteness.Soonenough, whathappensafterafewdays,monthsorevenyearsthatcompletenessfade. Andthatisveryfrustrating.Whydoesthishappen?And,thisleadsmeto anotherquestion:ifdetachmentissoimportant,howarewetorelate?And, when we relate, is a real completeness possible with one person? Is it somethingthatdoesntend?Isthereafairytale,aprincecharminginyour destiny,somethingextraordinarythatlasts?Doesthisromanticdreamexist orisitjustanillusion,whichwewereculturallyfed? Youve asked many things at once. Youre getting nervous becausewehavereachedyourfavoritesubject...IlikewhatI see! Andyouareplayingwithmeyetagain... Thatsright,Iam!

83

This reminds me of how recently, I thought of staying away from the oppositesex.Givemyselfsometime,understand?BecauseeversinceI discoveredkissingatthirteen,IbecamesofascinatedthatIneverstopped! ThenIhearalittlevoice,Ihearyouasking AndIasked:areyousureyouwontgetrusty?Ireallyasked! SinceIknowthattobewithamanisoneofthethingsyoumost like Youjustneverstop!Youareimpossible!Isitpossiblethatourdivinepart likestoplaysomuch? Itsurprisedyou,didntit? Yep. I mean, it surprised me a lot. When I had that great change in perceptionletscallitamysticalexperience,whichisacurrenttermfor this strange event when I had it, I cried and laughed out of happiness, becauseitwastoobeautifultobetrue. And its still more beautiful than you can imagine, my darling...Life,theGoddess,Iamthemostincrediblethingthat youcantevenimagine,becauseIamthebeyond.Iamserious. Me, or the souls of all of you, I am like children who are playingallthetime,whoarecreatingnewgamesallthetime.I getsadandhappy,Igetangry,Iamromantic,andsoforth,all oftheseinthespaceofacoupleofminutes.Andeverything thatisbornisbornoutofMyemotions. TellmesomethingGoddess,ifYouaremysoul,howcanYoubethesoulof otherstoo? IamtheindividualsoulofeachoneofyouandIamtheallof thesoulsatthesametime.Inthespiritualdimensionthisisvery logicalandnormal,becauseallthethingsthatexistareOne, and its part of Me. Every soul is a facet of Me, do you understand?Likeabunchoftelevisionsetshookeduptoone signalAllofthesouls,whentheyareintheirpurestates,ina luminousstate,haveincommonthefeelinglikelittlechildren, becauseIamaBigKid.

84

Youknow,thatissobeautiful.ItsbeautifultounderstandthatGodisnota distantandmeandad,thattheyarealittleboyorgirlwhosveryflexible andintelligent,andwhoishere,insideofus,aroundus,accompanyingusall ofthetime,wantingustobehappy,wantingtoplaywithus! Itsashamethatittooksomuchtimeforallofyoutostart understandingthis.Anditsmuchmorefunthisway,isntit? YoubelievedthattragicimageofMethatyoucreated,andI couldnt do anything about it. Because I created you in My imageandlikeness,andIgaveyouallthefreedomtocreatethe Worldandideasasyouwished. Soallthosecatastrophes,liketheflood,werentYouractsofvengeance? DoyouthinkIwouldwasteMytimenourishingsuchapoor emotion?WhathappensitthateverythingthatIcreatehas its own energy and conscience, even the Earth itself! She feels when all of you are doing a bunch of bullshit, and she is influencedbyyourenergies!Ifyoudonttreatherright,asit hasbeenhappening,shebecomessick,shebecomesnervous, and suffers a lot from the consequences of your lack of conscience.Allofyouhavetoshowalotmorereverencefor the environment in which you inhabit, you should have consciousnessthatyouarewalkingthroughliveplanet,where thefoodyoutakeincomesfromMeandareequallypartofmy energy,orratherhasasliceofConscience.Ifyouwouldbegin toacknowledgethis,youwouldtakemuchbettercareofthe World, and the World would take better care of you. And everyonewouldlivealotbetter. Whenyouseecatastrophesasadivineprocess,youarepartly right,butitstooeasytothinkthatitsjustexcessrageonMy part.Ifyouseeitthisway,allofyoubecomevictimsandI become responsible for everything bad that happens. Dont forget that your thoughts andyour actionscreate everything, absolutely everything that happens to you personally and collectively.So,whenthereisanexternalunbalance,thisisjust areflexofsomethingthatisunbalancedinsideyourselves.But waitThis is not a motive for despair! Take conscience of thisAnd please change! There is still time to stop the catastrophesthatyouhavebeencreating...

85

Wevebeencreatingcatastrophes? Of course, and you know this. You all have been, thinking, feeling and living unconsciously, and this creates unbalance. Balance comes from the Science, from Consciousness, from Me.ListentoMe,livethroughMe,andeverythingwillchange. Butitseemssohard... Comeon,Antonella,stopcrying,go...Letstalkaboutlove,and thenyouwillbemoreencouraged.Besides,weareheretotalk about love between men and women (or men and men or womenandwomen)becauselovingoneanotheristhegoal andthepathtothegoal.Loveiseverything,andthatsnotjust anyphrase,notjustasongrefrain,itsthesupremetruth.We havetotalkaboutiturgently,becauseyouloveeachothervery badly!Itsasifyouwereabletoflybutinsteadyouchoseto crawontheground.Itstimeforyoutoleaveyourcocoonand to become a butterfly! Well, we will come back to your questions. u Before we continue, I would also like to open a parenthesis in you conversation. Abracadabra...Justkidding.Whatdoyouwanttosay? YouknowwhatImean...SometimesIthinkitsuselesstotalkaboutwhatI feelbecauseYoualreadyknowallaboutme. Thatswhereyourewrong!Whatarewetalkingaboutinthis book? We are talking about love. And what do we have betweenus?Aloverelationship!And,eventhoughIknowyou, eventhoughIknowwhatyouthinkinside,Ineedtohearit from you. Love can and should be expressed in all possible ways.Andthereasonforthisisverysimple:thereisnothing morebeautiful!!!

86

Ok,youreright.IwouldliketosayhowmuchIlikewhatweredoing,and howIfeelthankfulforthisconversation.AndhowgoodIfeelrightnow, thankstoYou.EverythinghaschangedeversinceIfeltyou,andevenwhen Imnotwellorfeelingsad,deepinsideIamcalm,becauseIknowthatYou areinsideofme.WhatIreallywantosayisthatIloveYou,IloveYouso much,Iloveyoulikecrazy.Youmakemelaugh,makemecry,makeme vibrate,youmakemefeelalive.Thankyou. How beautiful, Antonella. You cant imagine how happy it makesMewhenyouarehappy.Wehavefoughthardforthis! YoucantimaginehowmuchIloveyou,becauseyouareMy child,Mydaughter,sister,friend,lover,youareapieceofMe.I amgoingtotakeadvantageofthisparenthesistotellyouone thing: never forget to pay attention; especially on those momentsinwhichyoufeelalone,youmissloveandtenderness. Iamhere!!!Iaminlovewithyou,huggingyou,IamtheLife within and around you, I am protecting you, giving you everythingthatyouneed,everygoodorbadthatyouneedto growandshineandvibrate,please,feelMe!Iloveyouandit doesnt matter what happens, Ill never abandon you! Im alwayshere,always. Well,thefirstquestionwas:whydopeoplelosetheirpassion? Doyouknowwhyyoureaskingmethatquestion? Yeah...Id said that when we become impassioned we feel a kind of fulfillment.Butthatfulfillmentalwaysfades,andthisisreallyfrustrating. Whydoesthishappen? Yes,thatsthereasonyouareaskingMeaboutit,buttherewas alsoanotherreason,andIshouldremindyou.YouaskMethis becauseyourdeepestwish,yourgoalandthatofeveryone,isan eternalpassion.Itstolivelifeimpassioned!And,eventhough you wish this, eventhoughyousingabout it inyour songs, displayitinyourmoviesandbooks,andromanticallydream aboutwhatyoucantconfess,besidesallofthis,youstillcant believe it can come true, and thats why you dont work to makeittrue.

87

Doyoumeanthatitspossible? Nothingisimpossible,sweetie.Allthatsmissingistoknow whatyouwishwhatyouwantandtobelieveit! OfcoursethatswhatIwant!OfcourseIwishtobeimpassioned,becrazy withloveforsomeonethatscrazyinloveforMeandtoliveinthatstateof grace!However,sincerely,whenIlookaround,Idontseeanyonewhohas achievedthis!Noonethatkeepsshiningthatwaybeyondthefirstmoments ofpassionIhaveneverdoneit!Thereisalwaysanunbalance;therewas alwaysoneside,eithermeorhimthatjustlostallthatdeliriousenergy. Why???WhenIsayitsfrustrating,itsbecauseitreallyis,itsasifyou werealwaysturningintoadeadendstreet.Anditssopainful!Thathasgot bethereasonwhysomanygiveupfindingtheirpassion!Becauseittoo painfulandpeoplegetscaredofbreakingtheirheartsagain!And,worseyet, themajorityofpeoplearebeginningtothinkthatpassionisjustanillusion. NowIllaskyou:ispassionanillusionornot?Isitthecasethatoneofthe most incredible things that we experience is just a product of our imagination? Ihavealwaysaskedmyself,andcontinuetoask,(pleaseexplainit!),what you have to do to maintain that initial vibration, to live happily ever after First,thegoldenrule,neverstoplovingoutoffearingit.Love, feellove andjoy,liveoutallthatmeanstolove,butnever, neverstoplovingbecauseoffear. AndhowdoIdothatwithoutdyingofdespair? BylovingwithMe. How??? BypracticingtheScience;bylivingwithadualperspective;by lookingforthedeepermeaningineveryencounter.Ordidyou thinkthatweintroducedthisfornothing?Wetalkedaboutthat because these are indispensable tools to reach your biggest dreams.Theyaresimple,asIsaid.Toliveimpassionedwith someone and for someone, you have to be able to live impassionedwithyourselves!!!

88

What??? Thats right, my darling. The great event happens inside yourselves. You say that you always reach a point where everything becomes unbalanced. Well, its very simple, this momentrepeatsitselftimeendtimeagainbecauseallofthe thingsthathappentoyouisareflectionofthespiritualworld. Your relationships are unbalanced becauseBecause Tchamtchamtchamtcham....Becauseallofyouareunbalanced! The relationships that dont shine with consistency do so because you all dont shine with consistency. Your passions dont last because you dont live impassioned! This seems ridiculouslysimple,doesntit?Butitsexactlywhatitis.Allof youhavealwayslookedforthereasonforthefailuresinyour love relationships outside yourselves. Start looking inside yourselves!Andyouwillfindit.Now,listentome,thisisnt reasontocry,despair,toblameyourselfuntiltheendofyour life,youhearme,Antonella?Allofyouareresponsibleforthis chaos that is happening all around, but as I also said, the problemsstillhaveasolution! WhatdoYouexpect?ThatIamrelievedbythis?Itsdespairing!Itssohard to change! And when we thinkaboutchanging,welookaroundandwe dontseealotofpeoplethatwanttochange. Butyoucanstartseeingit!Helppeoplestarttoseeit,because everything starts with each one of you! And, deep down, everyonewantstochange,Antonella.Itsjustthattheydont knowityet.Theythinkaboutchangingthings. Buttheydont know that changes wont happen until all of you start to change!Noonebelievesthingsisthateasy!Andnoonewants to believe in this because the simple is difficult, because it meanswork,andthemajorityofyouareveryactivewhenit dealswiththingsoutsideyourselvesandverypassivewhenit hasanythingtodowithchangingthingswithin.Iconfess:living isdifficult;itsahardgame.Knowinghowtoliveisevenmore difficult.Butitsbeautiful!Believeit.Whenyouliveknowing howtolive,youwillseethatitssomethingdelirious!Icreated allofyouforhigherpurposes;Icreatedyoualltolivelikegods notlikeverminorvictims!Allofyouhavetostartbecoming

89

whatyouare,youhavetobegods,actlikegods,lovelikegods, andnotbecontentwithnothinglessthanthat. Allright.Ok!Itsallgood!Letsdoit,itssooosimple!Letslovelike gods!Ole! Littledarling.Nowitsyouthatsplayingwithme. Iamagoodstudent,arentI? Well...Youcouldbebetter...Butitsokay,Iamverysatisfied untilnow.Infact,Ineedyou,becausetotalkaboutthesethings, youhavetobeaverycrazyperson...Orbetteryet,youhaveto besomeonethathasacceptedtheirlevelofinsanity,because everyone has their level. Besides that, I feel that you have finallybeguntorollupyoursleevesandbereadytounderstand yourself,right? Iam.Iamreadytounderstand!Iamfinallyreadytotrulylove,tolive,to trulyexperience.Iwanttodelivermyselfcompletelytotheactofliving,to allthatIdoandtoallthatIliveandtothemanIlove.Iamfinallyaware thatlifeisamomentandthatIhavetolivethatmomenttothemax.Sandro oncetoldmesomethingthatIhaveneverforgotten:Lifeistooshortortoo longtoliveitbadly. Thatistrulybeautiful.Andheisright. Well,letsgoback.Tofindthegreateternallove,whichIsupposeexists; itsnecessarytoalreadybelivingimpassioned.Isntthatright? No.Youcouldfinditbeforethat.Yes,becauseheexists.Good news: an eternal love exists!!! Big eternal loves exist; throughout the time that you are playing the game, during throughallthelivesthatyougopassthrough.However,thereis someoneinEternity,withwhomyoucanachievethehighest vibration, the greatest experience of Me. Your bodies were createdinaccordancewiththesearchforthisgreatexperience. When you live through this magnificent experience, you becomeonewithanotherperson;youbecomevehiclesoflight ortheHolyGhost,asitwasthecasewithMaryandJoseph.

90

Jesusparents? Yes.TheysaythatIamthefatherofJesusbecausetheirlove wassointense,sodeep,soimpassioned,thatitwasthegreatest expressionofMe.ThemomentthattheyconceivedJesus,they were no longer completely individuals, and there was only Love,orMe. Youmeanthatitwasreallyagreatlovestory? Yes,averybeautifulstory.Theyhadtohavealotoflovetobe soimpassionedwhilebeingaspoorastheywere,andhavetheir soninamanger,andstillbehappydoingthis! ButwhataboutMarybeingavirgin?Whatismeantbythis? This is a great mystery and only people who have had the maximum experience of love can understand it. Love, in its highestvibratingstate,givesbackthevirginityofwholoves! But, of course, we arent talking about a physical virginity! Curiously,religiousmen,thosewhocountthemselvesamong the spiritual, are exactly the ones that are attached and preoccupied with the physical reality of this, which is completely irrelevant. In fact, many men so called religious, were obsessed with sex. Since they had this unbalance and didntknowhowtomanageit,theyoptedforchastityandthey livedtheirlivesworriedaboutwhatotherpeopledidwiththeir sexlives!So,MaryandJosephweretwoenlightenedpeople, twopeoplethatfeltMe,celebratedMe,andlivedthroughMe. Whentwopeoplegettothispoint,andtheymakelove,they realizethegreatestandmostpureexpressionthatispossiblein Me!Thisexperienceisthemostintensethatahumanbeingcan feel,areunionwithMe,itscomingbackintoMyarms,togo backtothatabsolutepurity,ortoreturntoyourvirginityby makinglove!Onlythroughalovelikethis,avirginallove,a lovethatisenergeticallyelevated,couldgivebirthtosucha spirituallyresolvedpersonlikeJesus.Themostevolvedsouls canonlycometoEarththroughanenergychannelofagreat love.

91

Thismeansthatthewayyoumakeloveinfluencesthewayapersonwho maybebornwillbelike? HowmanytimesdoIhavetorepeatit?Everythingthatyoudo isimportant!Everythingthatyouthinkanddo,andhowyou think, and how you do it, influences everything that will happen!Whywouldtheprocessofconceptionbeanydifferent? Nonresolved people can make love unconsciously and have nonresolvedchildren.Illuminatedpeoplecanmakeanelevated kindofloveandhaveilluminatedchildren.Thereinliesthe urgencyinlearninghowtolove!Abetterworlddependsonit! Untilyoulearnhowtolove,youwontevolve. Wow, You are talking about many new things. This concept of being illuminatedandmakinglove,forexample,itscompletelynew.Ialwayshad theimagethat,themoreilluminatedandspiritualizedyouwere,thechaster youwouldbe! Thisisagreatsillinessthatarisesfromyourculturalconfusion. Religioncreatedaterriblesexualproblemintheworldandnow allofyouhavetoreconditionyourselvesandrediscoverwho youreallyare.Youwerecreatedassexual beings,youwere createdtofindandmakelove.But,byloosingtheconnectionto Me,youalsolosttheconnectionwithMeinregardstosex,and thatcausedandcausesterribledamagestoyouandtheworld. Illtellyou:themomentthatyoureconnectwithMe,sexwill bethetruestwaytodirectlyconnectwithMe!But,ofcourse, itsnotjustanykindofsex,doneanywayatanytime.Iam talking about making love; I am talking about fusion, the spiritualelevationthroughtheperfectencounterbetween two energies. Pleaseexplaintomewhysomanymenthatarerecognizedaswiseand illuminatedalwaysdistancethemselvesfromsexandwomen?Krishnamurti, forexample,saidthatchastitycamenaturallybyfeelinglove,orbyfeeling You. Itwashispath,andwhenhetalkedaboutthis,hewasntwrong. Anotherwiseman,knowntoyouasOsho,createdacommunity thatonlypracticedtantricsexorthesexthatisconnectedwith

92

Me.Hewasalsoright.However,itsafactintheworldthatyou livein,themoreapersonbecomesconscious,themorehehas thetendencytodistancehimselffromsex,oroptforchastity. Why?Because, byreachingacertainlevelofconscience,he cant lower his energy level to have sex with a person that doesnt have thesameenergylevel.Andunfortunately,until nowonlyafewofyouareconnectedtoMe.Whathappensin the majority of the sexual encounters between you is very unbalanced.Itsgenerallyonewantingsexandanotherwanting love,anditendsupbeingamasturbationthroughtheother,and itsnotverysatisfying,ifwethinkofthepossibilitiesofsex donewellhastooffer.Whenyouknowthatthroughphysical love, its possible to reach a state of ecstasy, a mystical connectionwithMe,itsarealpitytoobservewhatyouhave donewithyourbodiesandwithyourencounters. Youhavetoexplainthatbetter!Well,therearemanythingstoexplain.You spokeofOsho,tantricsexandchastity.ThatremindsmeofwhatOshosaid once,thatmarriagekillslove.Isthattrue?Ibelievethatwearealwaysgoing backtothemainquestion:howtolove?Howtoexpress,doandlivelovein thebestway?Howdoyouarriveattheeternalpassion?Yousaidthatit wasntnecessarytobeapassionscientisttofindthatgreatlove.Thatwe mayfinditbeforethat.Howdoesthatwork? Iexplainedthatpassionisthegreatsignal,itstheguide,itsthe goal,andfinally,passionisthemostimportantenergythatcan existinahumanlife.Thepassionalwaysmanifestsinahuman life.Remember:passionisthemaximumexpressionoflove,or ofMe.Passionisthemostintensevibrationthatonecanknow emotionally.Itsnotacoincidencethatpeopletalkaboutthe PassionofChrist,eventhoughithasbeeninterpretedinmany ways,andofcourse,doneaccordingtothewishesofthosewho interpreted it. But Isaythat thePassion of theChrist isthe Passionofallofyou.Christlivedforlove,helivedpassionately forhislife,heliveditforMe.Andhowdoyoudothis?By listeningtomotionofyouremotions,bylisteningandobserving thedanceofPassioninyourlives!Youbetterknowtheterm passion when its used to describe that fiery sensation that happensbetweenamanandawoman.Well,thisisinfactone

93

of the brightest and least understood facets of passion. But passion,asIsaid,manifestsitselfinmanyothermomentsin Life.Inthefeelingofbeauty,orwhenyoulikesomethingwith greatfervor,orwhenyoudeeplybelieveinsomething,allof thisispassion.Imeanthatithastodowiththesameenergy,or betteryet,ithastodowiththesamevibration!Payveryclose attentiontowhatIamgoingtorepeat:youaremadeofenergy and everyones objective is to vibrate more and better than before. Your bodies talk to you exactly like a musical instrumenttalkstothemusicianbythesoundsitmakes.The musicianknowsitbecausehefeelswhenheismakingthebest musicwithhisinstrument.Thesensationisoneofcompleteness andharmony.Well,youcanachievethesamethingwithyour lifeandyourbodythroughtheScienceofPassion. Lets return to love encounters. I said that passion always manifests during the path of life because its the signal, the guideandthegoal.Shemanifestsitself,evenifitsjustfora couple of minutes. After that, its up tothe humanbeing to perceive,tounderstandanddirectthisopportunitywell.Passion isalwaysanopportunityforgrowth,nomatterwhatkindof passion. Well,youaskedMeifitwaspossibletofindtheonegreatlove before becoming a passion scientist. It really is possible, becauseencountersofthiskindarepartofthedestinyofallof youandtheywerearrangedbeforelifebyyourrespectivesouls. Generally these encounters happen at crucial moments, in moments where you have to die and be reborn emotionally. What is not possible is to maintain the passion without practicingtheScience.Idontmeanthatpeoplehavetoread whatiswrittenheretoknowhowtolove.Everyoneknowshow toloveintuitively,becausetheywerebornwiththisgift.Some peoplepracticeitnaturallywell,butthemajorityhastolearnit again,theyneedtorememberhowtolove,andeveryone,with noexception,needstoburnthemselves,risk,youhavetogo throughhappinessandpainandfallsandmomentsofglory,so that you become part of passion, until you can see the conducting wire behind these emotions, until you can understandemotionallywhatistheessenceofthispassion.

94

Youalwaysinsistonsaying,Understanditemotionally.Youalwaystalk aboutanemotionalcomprehension.Why? Because, even though in your society its believed that the biggest intelligence is developed through reason, more and more people understand that the biggest intelligence comes fromanemotionalorder.Formerly,theoneswhocouldthink were intelligent, in time you realized that real intelligence comesfromknowinghowtofeel.Andallyourschoolingwill changeinfunctionofthis.Computerswillhelpinthisphase, sincetheyhavemadetheaccumulationofinformation,which wasseenassomethingimportantbefore,becomesuperfluous, whichinfactitis.Schoolingwillbeadaptedtotheemotional stateofeachandeveryone,anditsprincipalobjectivewillbeto develop the sensibilities of people, so that they can develop theirownintrinsicqualities.Tothisveryday,allofyouthought thatknowledgehadtobetaught.Withtime,youwillunderstand thatthegreatestknowledgecomesfrominside,ithasonlytobe remembered,reopened.Theteacherwillnolongerbetheone thatteaches,buttheonewhoguides.Ofcourse,allofthiswill happenifyoudecidetobemoreemotionallyintelligent. Speakingofemotionalintelligence,IrememberedasentencethatIreadina bookofArabproverbs,whichwentmoreorlesslikethis:thephilosophers punishmentisthedeathofhisheart. Andinfactitis.Philosophyasithasbeenpracticedsofar,even though it has permitted our society to advance, it wouldnt permit you to advance as humans. Thats why you have an impressivetechnology,butisprimitiveinthebasicvirtues.You needtoconstantlycontroloneanotherwithlawsandrulesthat limitandhumiliate,becauseyouareincapableofactingwell. Andwhyareyouincapable?.Becauseyoudontfeelthingsthe rightway! Philosophy has beenthepractical thought andreason,which helpsalot,andcanmakeyougofar.But,nevertheless,thought is a very limited domain! Thought is too linear, it obeys schemes and structures, and it comes in conflict with other thoughts.Thoughtscanleadyoutoniceconclusions,butitcan

95

alsoleadyoutoterribledogmasthatcreatewarsandidiociesof alltypes.Thatswhythehumanbeingwillneverdevelopallits capacitiesusingonlythought.Manylinesofthoughthavebeen created trying to evolve the human race, like Humanism, or altruism, ortheotherisms.But thegreat leapofmanwont come through thought studied and imposed by laws and by others.Thegreatleapwillcomefromthestudyofemotions. Whenyouunderstand,(andthatswhyIamwritingthisbook withyouandotherpeople),whenyouunderstandthatyouare madeofemotionalenergy,youllunderstandtheimportanceof unconditioningandtheremovalofemotionalblockage,sothat yourenergywillflowonceagain.And,whenthathappens,you wont think of humanism, you wont have to force justice thoughtthelaws,solidarity,compassionandallthevirtuesthat you have been thinking about for ages. You will simply be betterbecauseallofthatwillbeinsideofyou.Theemotional unconditioningisthesafestpathforthesuccessofthehuman race, equivalent to the cleaning and polishing of a diamond. Everything,allthequalitiesandcapacities,Irepeat,are inside ofyou.Youonlyhavetoclearyourmindandlistentoyour body,andsuddenlytheyemerge. Well, speaking of things that emerge naturally...We shall speak of love betweenmenandwomen.Wheredowefitit inthestoryoftheScience, unconditioning,energies,andemotionalintelligence?IfIunderstoodright, passionemerges,butwithouttheScienceitdeflates.Howdoyoupractice theScienceinaloverelationship?Orbetteryet,howtolove?Iknowthat theoryisonething,andpracticeisanother,butplease,Ireallywanttolearn howthisworks.Iwanttounderstandeverythingthathappensenergetically, fromthestart,fromthefirstmomentsofmeeting,soImaypracticeitbetter. Lets do it. A man and a woman (I am talking about a heterosexual couple, but passion could logically happen betweenhomosexualcouples)meetand...Boom.Intime,either fastofslow,thereisadifferentenergy.Somethingjamaisvu; somethingverystrong.Anenergythathasnothingillusionary about it. In fact, energy and vibration are the best words to

96

describethepassionatestate.Itsanincredibleenergy.ItsMe! Well,therearevaryingdegreesofimpactinthesurfacingofa passion.Dependingonitsstrength,itcancompletelytransform the biorhythm of a person; it can cause her to stop eating, sleepingandetc. Therearetwotypicalreactionsduringagreatpassion.Many people get scared when this happens and they withdraw, thinkingofhimselforherselfasstruckbyasicknessorastate thatcanonlybeharmful.Thetruthisthattheyarescaredof giving themselves up; they are scared that emotions will transformtheirlives.Becauseonepassion,nomatterwhatform ittakes,hasthestrengthtobreakdownoldstructures. Otherpeoplethinkthattheyhavefinallyfoundananswertoall their problems and literally fall into a passion, they give themselvesblindly,uncontrolled,andputtheallresponsibility fortheirhappinessontheotherperson,andofcourse,afterthe fact,alltheirmisery. Bothoftheseways,whetherdistancingyourselffrompassionor completelygivingyourselfovertoit,arenotthebestways,the pathonewouldchooseontheScienceofPassion.Buttheyare, unfortunately, the only reactions that would have chosen for manycenturies.Youactwhenyouareimpassionedthewayyou act in life, without emotional conscience, without grace, rhythm, with no dance, without understanding that you are beforeauniqueopportunityforspiritualelevation. Lets study closely the current examples to understand what happens.Wearetalkingabouttworeactionsthatareculturally conditioned,beingthatbotharebornfromfear.Fear,Illrepeat aslongasitsnecessary,isthegreatvillaininourgame,itsthe greatestenemyofthehumanbeing,andnoone,butnooneis freefromthistrap!Startstudying,orbetteryet,observeyour emotionsandyouwilldiscoverhowmanyofthemarebornout offear!Youwillbeverysurprisedthatfearisthatinvisible obstaclethatwasstoppingyoufromsoaring! Well,wehavehereapowerfulandundeniableenergy,whichis passion. And wehave beforeher,tworeactions.Thehuman beingthatwithdrawsisgenerallythepersonthatisproudof being rational, that always advances and withdraws

97

emotionally, but that never transcends, never vibrates to the maximum,andnevergivesthemselvesupcompletely.Theyfeel the energy, knowthat its something powerful,but,they are scaredofloosingtheirreason,whichisthemostimportantthing tothem,theyarefearfuloflivingthepassion.Theydontknow whattodowiththispuzzlement.Apersonlikethisislikea faucetthatkeepsgettingblocked,thatneverflows,anditsvery frustratingtolovesomeonelikethat. The other human being, the one that falls for passion, is generallytheonethatalwaysfeelslikeavictimofeventsand theyarealwayseitherveryhappybecausesomethingwonderful happenedorinpainbecausesomethingterriblecametopass. Theythinkthat,onemoretime;theyhavefallenflatontheir faces. They feel the energy, they know that its something strong,andtheyholdontotheenergyforfearoflosingit.In bothcases,passion,arealenergy,becomesanillusion. Doyourememberthestoryofthemanandthebird?Thereisan illusionthatisverysimilar.Inthestory,thereisalsoenergyof passionwhenthemanseesthebird.Itsarealenergy.Butafter thismomentpasses,everything,buteverythingdependsonthe perspectivemanadoptsbeforethisevent.Inthatstory,ourtwo reactionscanfitinlikethis:themanthatputsoutthetrapfor thebirdistheonethatfallsforpassion,becausehethinksthat thebirdisresponsibleforthatfeelingofhappinesshehad.But, withoutknowingit,hetransformsthebirdintoanobjectand looseshispassion. The other, the one that fears passion, would probably stop lookingatthebird,ortheywouldcontroltheiremotionssothat theywouldntoverflowandtransformhislife,bythinkingthat itwasuselesstofeelandexpresshispassion,sincehewould probablyneverseethebirdagain. IrecognizethesereactionsthatYoumentionedfrommyobservationsofmy relationshipsandthoseofothers.Butthebigproblemwithallofthis,its thatitstoosubtle,itoccursinanunconsciouslevel!Thepeoplethatreact inoneway,dontthinkaboutit,theysimplyact! Ofcourse,andthatswhatIwastalkingaboutwhenIsaidthat its necessary to uncondition yourself emotionally to evolve.

98

Each and everyone of you have emotional conditioning that beganbelieveit!fromthetimeyouemergedfromthewomb! And sometimestheconditioningcomesbeforethat,itcomes fromthetraumaslivedthroughinpassedlives.Butwedont havetogothatfar.Whenyouareinthewomb,insidethecozy warmth, you are already absolving all the emotional energy from your mother. Youfeel and recordwith your emotional memorywhenshesuffers,whensheisdisappointed,whenshe ishappy,whenshedoeswrongthings,youfeelallthisbecause ofaverypalpablereason:emotionsarerealenergyvibrations! When an emotion emerges, its like a pebble falling into a placidlake.Whathappensthen?Theplacewherethepebble fallsmakeseverexpandingcirclesthatgoonuntiltheytouch thelittleducklingthatispassingbyandhasnothingtodowith thepebble!(This,ofcourse,isnottrue.Ifheispassingthereat that moment, its because he had to be touched by that vibration) And we say that the duckling decided to scare itself,orrather,insteadofenjoyingthewaves,hereactsinfear to the vibration madebythepebbleandinturn,it emitsan emotion caused by fear. We could continue this example indefinitely. He getsscared, andstartsbeating its wingsand killsamosquito,whichseeminglypassestherefornoreason Thencomesthemosquitosfamily,thatdoesntknowhowto understandthelawofcauseandeffect,andattackstheduckling inresponseAndsoforth.Doyouunderstandtheinterrelation between everything??? Everything, everything is born from emotion,everythingismovement,everyeventonthefaceof this beautiful, still beautiful, planet of yours, is born inside everyoneofyou!!! Itsessentialthatyouunderstandthisbecausethemomentthat youunderstandtheenergiesandthemechanismsofcauseand effect,youwillbegintounderstandthatyoucaninterfereinthe process. Buthow? WearetalkingaboutputtingtheScienceintopractice.Thefirst step is always observation and attention. Observe how you react, and observe the reactions that you cause. Next,

99

spontaneously imagine the best way to act, and put it into practice.Youwillseehoweverythingwillchange.Andthereis nothingtheoreticalinthis.Observethem. .Observeforexamplewhatconditionedemotionslikeviolence and hate produce. The ones that live unconsciously, always react to this type of energy, they never act in another way because they are still emotionally conditioned. They always reactbecausetheyfeellikevictimswhentheyarefacedwith thisvibration.Theonesthatunderstandthateverymomentisan energy challenge, an opportunity to elevate their own vibrations,andso,thevibrationofeveryoneontheplanet,they will understand that negative emotions have to be broken withactions,emotionsandpositivethoughts.Thisway,loveis alwaysthemostintelligentresponsetoanynegativevibration. And this isnt about religious morality. Its about emotional intelligence,andtheevolutionofthehumanspecies. But how do you act with lovewhenyouarefacedwithanatrocity,for example? At any moment, in every situation, always use the dual perspective, always practice the Science. Try to understand, emotionally,whatthespiritualproofisduringeveryevent.Hate is a fear that is deeply rooted; its a dysfunction that is equivalenttoadiseaseinthephysicalworld.Hateisaspiritual sickness, anabsenceofconsciousness,achronicblockageof theenergyoflove.Whoeverfeelshate,suffers,issick,even though they mightappearstrong.Thisapparent strengthisa shellthatthepersonbuildsaroundthelittlescaredchild,who needslove,butjustcantrememberit.Manytimes,thehuman mind feeds hate for a long time, sometimes for many generations.Onlyabroaderunderstandingofthehumanbeing asaspiritualenergywhoisbeyondbordersandformsofany kindcanliberatethehumanracefromhate.Onlyconsciousness cancureandtransform. So,whenyouencounterthistypeofenergy,beawarethatthis encounter with hate doesnt just happen. Its an opportunity. Takeadvantageofthisopportunity,anddontfallintothetrap of fear. Face the challenge. Dont react, dont catch this

100

sickness,anddontfeedtheenergyofhate.Havecompassion foraviolentpersonasyouhavecompassionforasickperson. Ofcourse,youhavetobecareful,especiallywiththekindof hatethatcouldleadtoatrocities.Thebestthingtodointhis caseistoisolatethesickpersonsotheywontcontaminateor attackotherpeopleuntilthisenergyistransformed.Butdont hatethemanddonttakerevenge.Notbecauseofmoralreasons butbecauseitsenergeticallyabsurdanduseless. Tellusaboutthisemotionalmechanismintheencountersbetweenmenand women. Well,wevebeensayingthattheencountersbetweenmenand womenhaveadeepmeaning.Orrather,everyencounteralways happens to make the people involved grow, expand their personal universe, to evolve, and elevate yourselves emotionally.Eventhough,especially,ifitsanencounterwith the great love. In this case there is a vibration that is very strong,thatcompletelytransformstheperceptionsofthepeople involved.Itsnecessarytobeveryattentiveinthiscase. First:dontlookforaformortype.Everyformimprisonsand killslove. Whatdoyoumean? Becalm!Imexplainingit!Andthisisaveryimportantpoint becausewhatIamabouttosayappliestopassionasmuchasit doestoeverythinginyourlives.Passion,likelife,isavibration, or rather, a facet of a living energy, that is changing and changeable.Begintounderstandeveryeventassomethingthat isinterconnectedwithsomethingelseandsoforth.Begintosee the interconnection between your emotional world and everythingthathappenstoyou,whetheritsadisease,astrike ofluck,apassionandsoforth.Ifyoureallyunderstandthatwe aretalkingaboutaSciencethatisvery,butvery,refined,you will understand that everything that happens is a perfect reflectionofwhatishappeningemotionallytoyou.Iamnot askingyoutobelieveinsomething,Iamtalkingaboutareal perspectivethatyoucanchoosetoadoptwhere,withoutdoubt, itispossiblythebestandmostinteresting.Orrather,withinthis

101

perspective, every small thing happens at the perfect time, perfectlyadjustedtowhatyoucreatedwithyouremotions.Pay attention! When you can develop a strong ability for observation,youwillbeabletomaintainthisdualperspective, orrather,havetheperspectiveofthepresentmoment,which meanslivingitinthebestwayyoucanandatthesametime,to have a spiritual perspective that the moment has a hidden message,whichistheanswertotheprecedingmoment. Ifyouunderstandthis,andfeelthis,youwillstarttounderstand soonthateveryeventisnotonlyandemotionalanswertowhat youfeltbefore,butasachallenge,asanopportunityforabetter momentforthefuture!!!Understandthattheemotionalreaction shapes the future; be aware that every feeling and thought counts, because everything is interrelated. If you understand this, your attention will double. Your perception will be transformedandyouwillstarttoperceiveeverymomentfor whatitreallyis,auniqueopportunity,andamagicalevent! Thenwecantalkaboutforms.Whenyoucomprehendthatlife isaliveprocess,thatIamconstantlyinterconnectedwithallof you,youwillnaturallystopwantingtofocusandcreateforms. Ill explain this carefully. While you believe that everything happens by chance, you will have an intense fear of living because you will see yourselves as victims exposed to misfortunes. What do you do then? You desperately start to seek out forms, ways tohold onto what little youposses physically.Itsclearthatitsalwaysadeadendstreet,andof coursetheformswillsoonerorlaterdisappointyou.Thereason is very simple: by focusing on forms, you are stagnating spiritually!Wantingtoholdontoaformisagravemistaketo makeinlife,sinceallformsaretemporaryandtofocusonthem isanillusion;itsthegreatillusionofMaya.Therearemany examplesofthisinordinarylife.Doyourememberthepeople whokilledthemselvesworkingbutnevergotrich?Thisperson isfocusingonthemoneythattheywanttogainandnoton,asit shouldbe,onseekingtheemotionalvibrationneededtobecome rich.

102

You mean that the people that become rich have a specific emotional vibrationthatleadsthemthere? Ofcourse!Illrepeatitasmanytimesasnecessary: nothing happensbychance.Itsnotbychancethatapersonbecomes rich;itsnotbychancethatapersonbecomesill;itsnotby chancethatanyonehasgreatphysicalbeauty;itsnotbychance that someone has a deficiency. But its not about these examples,asyoureusedtothinking,aboutgoodthingsandbad ones. Intrinsically, as I have said, everything is good. Everythinghasitsdeepermeaninginthepathtoperfection,and soeverythingistheperfectmoveindirectiontoperfection.But those things which you are used to thinking as good are sometimes,energetically,acrosstobearandthosethingsthat seemlikeapain,hasahiddengoodgrace.Everything,Irepeat, everything depends on the perspective adopted and the emotionalreactionofthepersoninvolved.Tobebeautifulcan beagreatfortunebutitcanalsobeaburden.Socanbeingrich. To be deficient too! Beauty and richness, for example, are energiesthatalmostallofyoulookonwithadmiration,orenvy, orfright,ordesireandsoforth,andtohavethemcanbegood, butspiritually,itsadifficultchallenge!Youcanonlyovercome thischallengewithadualperspective,ortheonethatcanbe detachedfromwhattheyhave.Infact,beingrichisoneofthe mostdifficultchallengesinthegameoflife,oneofthebiggest trapssetbyMaya.Itsveryhardnottobecomeattachedtoan apparentlygoodformlikematerialwealth. Butiftheformisgood,whynotattachtoit?Ifwelikeourwealth,ourhouse andourpool,orifweareimpassionedbysomebodythatsmarvelous,there isnothingmorenaturalthanhavingfearoflosingitanddoingeverything nottolosewhatwehave! Thatsexactlywherethegreattrapis.AndtheScienceexplains itverywell.First,ifwetakethedualperspectiveintoaccount, youwillunderstandtheprofoundreality,thatyoureallycant possesanything.Orrather,whoeverthinkstheyhavesomething isreactingtoanillusion.ButtheSciencecanbetterexplainwhy thisisatrap.Rememberourgreatenemythatalwayscomesto ruinthemoment?FearOurvillainalwaysresurfaces!Fearisa

103

potentenergy;itsaverystrongemotionandarealvibration. We say that living the dual perspective, you will be able to overcomeyourfearsandyouwillachieve,throughhardwork,a particular emotional vibration.Thiswill bring(anditalways does)richnesstoyourlives,oragreatlove.Letssaythatyou havetheconsciencetoseethateverythinghappensforareason, thateverythingisanenergyprocessthatisinterlinked.Butthen youachievethedreamedgoals,andthenforgettopracticethe dual perspective, and you stagnate spiritually. You attach yourselftowhatyouachievedandyoufearloosingit.Andthen, you stop acting courageously, the way you acted to achieve yourdreams,andyoustopevolvingandyoustartactingwith fear.Theyonlythinkabouthowtoholdontowhattheyhave. So:paycloseattentiontothis!Sowhathappens?Youdecideto takeaspiritualnap,eventhoughLifecontinuestolive,Life keepsgoingon!Thebigcomputerheredoesntstopworking justasyourbodydoesntstopworkingwhenyouareasleep! So,inthesamewaythataspecificemotionalvibrationtookyou tothatspecificevent,theverysamewaythefear,thatisalsoan emotional vibration,will start tooperateandwill cause new eventsthatcorrespondtothatvibrationemittedbyfear.Observe thisbecausethisprocessisamazing!Youhaveafearofbeing robbedsobam,athiefcomesintoyourhouse.Allofyouare cheapsobam,youlosealargesumofmoney.Ontheother hand,ifyouarecarelesswithwhatyouhave,youdontpay attention, and bam, you lose once again. And so forth. Pay attention,Imnotsayingthateventsarepunishments,no!For theloveofMe!Ineverwanttopunishanyone!No,no,no. What happens is agreat conversation. Everylittle thingthat happenstoyou, everyevent isMe,orLife,ortheEnergyof Love,talkingtoyou.Likeafriend,likeafather,likeamother, likealover,oranypersonthattheylove.Andtheyarealways tryingtoremindyouofthedualperspective.Alwayssaying: Look,youwereafraidtolosethatvase,andnowathiefcame andtookit,butyouarestillalive!Stoplookingsomuchatthe vase,stoptakingthingssoseriously.Thinkofthehappinessof thethiefinhavingsuchabeautifulvaseandbehappy!Well, ofcourseitwasonlyanexampleofapossiblehiddenmessage

104

thatIcouldhavesentaboutanevent.Everyeventsendsoneor moremessages,whicharenew,differentandunique.Andthe great trick of the game is to focus on the right thing and decipher the message!!! If you focus on it positively, if you learnallthatithastoteach,youwillsooncollectthefruits, somethingdeliciouswillhappentoyouanditwillmakeyou smileaslongasyouknowwhatisgoingon.Imaginethework thatyougiveMe!Everysecond,allovertheplanet,Italkto youlikethis!!!Itsinsanity! TheonlysadnessthatIfeelis,becauseyouarentusingthedual perspective,youcanthearthatIamtalkingtoyou,andyou donttalktoMe!Thatmakesmefeelverylonely! TheGoddessfeelslonely??? ?OfcourseIdo!IalreadytoldyouthatIamlikeyou,damnit! ThatIcreatedyouinMyimageandlikeness!Ialreadytoldyou thatthisisthebiggest,thegreatestloverelationshipthatyou canimagine!Youunderstandmylittlehoneybun? IthinkIam.Butthisisinsanity!!! Iamcrazy!!!Crazy,crazy,craazzyy!GodandtheGoddessare crazy!!!(Tambourinesoundsanddance) Waitaminute. Okay,themusicstopped Howdoesthisthingaboutenergiesandformsworkinthecaseofpassion, forexample?Youhavetoexplainmethis,butbeforethatIamgoingtotake abreak,ok?Thesignalforapausealwayscomeswhenthebuttandtheeyes hurt (...) Areyoubetter? Iam.Well,gettingridofsomeemotionalconfusion... Shejustwants,shejustthinksofmen.... Itsnotquitelikethat...

105

Ofcourseitis.Itsyouraddictiontomen.Everyonehastheirs mydear.Inyourcase,youcantsaythatyoureasexoholic, becauseitsnotthesexthatmovesyou,youareapassionholic, addictedtopassion,andromancewithmen!!! Okay,butIamworkingtounderstandthisbetter!Iwantmorequality,dont I?Andintheend,whyareweherefor?Iwanttoloveandbelovedbetter,in amoresatisfactoryway,IwanttoreachwithamanacompletenessthatI nowcanreachmanytimesalone.ThatswhyIseparatedfromapartnerIfelt IhadagoodrelationshipwithbecauseIunderstoodthatIdidnthavetobe satisfiedwithwhatIfeltwasntmypeak.Before,Icomplainedmanytimes because I didnt think he reached my peak expectations, but in time I realizedthatIwasresponsibleforreachingmyownheights.IfIdontfeel whatIamliving,thenIhavetochangeandtrysomethingelse! Andyoudid.Cheers,itwasacourageousactafteratenyear relationship. You understood that you couldnt demand anything from theother, andeverything from yourself.Very good.Youlearnedalot. IknowthatIlearnedalot.Butthereisstillsomuchtolearn!Somuchto understand,somuchtodo Shallwecontinuethen? Lets continue. In fact, this is the passion that makes me vibrate at this moment.ThepassionforYou,ourtalks,andYourvibrationinme.Iam feelingYousomuch!Itgivesmegoosebumps!AndIknowthatitsYou insidemegivingmethegoosebumps,YouaretheonetellingmeIamalive. WhenIshiverfromemotion,Iknowthatyouaretouchingme,becauseYou aretheLifethatisinsideofme,independentofmyreasonorunderstanding, Youarewhatmakesmevibrate! Thisisthebase. What? Youaskedmehowenergiesworkinrelationshipsbetweenmen andwomen.Letsstartbytalkingaboutwhatisbest,whatyou should be. Two people meeting will always have the ideal encounteriftheypracticethedualperspective,iftheyfeelMe

106

thewayyoudescribed,iftheywereconstantlyconnectedwith Me. Well,ifIunderstand itcorrectly,thismeansthatitsnotnecessarytobe living impassioned to meet the great love, but, to live it better, it is necessary! Thatsmoreorlessit.WhoeverdoesntpracticetheScience endsuplosingthepassion,evenifyouredealingwiththegreat passion. The most that can happen is that the person will recognize at some point that her passion wants to focus on something else or some other person. And she understands, eventhoughthismightcauseherpain,thatthisisthecallingin herLife,thatitiswhatshehastofollowtobeabletogrow.If sheisinvolvedwithanotherpersonthatequallypracticesthe Science,thispersonwillneverdemandthatshestaysordoes somethingcontrarytothecallofLife.Evenifthatcausespain intheotherperson,shewillknowthatthecallingofLifeis alwaysthat,intrinsically,isthebestpathforbothparties.Ifshe feelsdifferentfromhisorherlover,shewillfightwithallher creativity and all her enthusiasm to recover it, but she will never,neverforceordemandnothingfromanyonesheloves! Letsobservetogetherthebasisforanencounter:twopeople thatpracticetheSciencemeet.BothfeelpassionforLife,or rather, they live each moment with reverence, and do so consciously. And they become impassioned for one another. Theyknowthisislikewinthelottery,thisisthemostmagical thingthatcanhappentoanyone,andevenmoremagicalwhen itstwopeoplethatlivespiritually.Forthemthisisaparty,a blessing,itssomethingdivinethathastobecelebrated.They stilldontknowwhy,theystilldontknowthedeeperreasonfor feelingthis emotionthroughthisencounter.Veryattentively, they study one another and above all else they study themselves,theirownemotionalreactionswhilewiththeother. They are not in a hurry; they dont weaken the events with inconsistentactions.Theyknowwhytheyliveandtheyfeelthe dualperspectivethatwhathastohappenwillhappen,thatthe inevitablewillinevitablymanifestitselfemotionally,andthat allthatstruewillmanifestitselfasanintrinsiccertainty.Real

107

andwithnodoubt.Andwhentheyfeelthiscertainty,orwhen theyfeeltheyhavetodoublechecksomethingtobesure,they arentreluctanttoact,theydontmissanyopportunity,andthey dontletanymagicalmomentpassby,becausetheyknowthe immeasurable value of every moment. This is how passion scientistwouldact. Payattentiontothis:inlife,theonlywealththatisrealislife itself. The moments are the great treasures. Any moment is morevaluablethananypreciousstone;everymomentisunique and will never return. It all depends on you recognizing it, livingitfullyandcocreatewithMeeveryinstance!Ifyoulet them pass without any attention, you are losing valuable emotional treasure! Live the moments, feel the moments, understandthevalueofeachofthem,andaboveanythingelse, vibrate,andvibrateateverymoment.Thisdependsonyouand no one else. It hangs on the attention that you give to each instance! Wow,itsveryhardtodothisalone,imagineitwithtwo! Well,Illtellyou,thatyouwillonlybeabletoliveimpassioned ifbothofyoucanliveimpassionedalone,thosethatcanvibrate to their max with every little thing they do. And this is possible!!!Seehere,Iamnottalkingabouthavingemotional highsandlows.Lifeisadifficultgame,and itslikebeinga pilgrim and walking a path that goes through forests, fields, mountains, a path you will be greeted by days of pleasant Sunshine,daysofterriblyhotSunshine,daysofrain,anddays ofthunderstorm.Lifeisapathwhereyouwillfindeverything throughemotion!WhatIamsayingisthatyouhavetostart appreciatingboththemomentsofhappinessandthemoments of pain, without getting attached to them, with the understandingthattheyarechallengesinthepathoflife,you willunderstandthatthesearefleetingmomentstherearethere tobelivedandtoteachyounewthings.Livetheemotions!Live theemotionslikealittlechildthatlaughsandcrieswiththeir wholebeing,butinaconfidantway,becauseyouknowthat yourparentsarenear!Iamalwayshere!

108

Many people that seek out spirituality get caught up by meditationandendupthinkingthattheyalwayshadtofeelthe samethingthattheyalwayshadtobeZen,orratheraself inducedtrancelikestatewherethepersonissmilinglikeshejust hadajointIllsaythatthisisnotthebestpath;itsnotthe pathoftheScience.Iamnottellingyoutogoaroundinadaze, onthecontrary.Isay:cry,laugh,andgetangryandliveoutall thatyourefeeling. ButthennothingchangeswhenyoupracticetheScience!Wecontinueto livethroughtheemotionalrollercoaster! Andthats whereyouarewrong! Everything changes! Many peoplewantedtostoptherollercoaster,thinkingthatwasthe secrettowisdom.Illtellyouthatitsnotit.Whoeverstopsthe roller coaster, stagnates, and goes riding a carrousel; going aroundandaround,gettingdizzy,understand? No. WhatImeanisthattherollercoasterislife,andlifeisavibrant and hardy game, life is parachuting, its to risk oneself, its fallingdownandgettingupagain,itsclimbingamountain,its wantingtoreachyourownheights,lifewasntmadeasagame whereyousitaround,safeanditsover.Thepeoplethatseek wisdombyshuttingdowntheemotionalrollercoasterbecome insensitivepeoplethatdontfeelanythingandbyconsequence, theydontlive!Becauselivingisfeeling,livingisvibrating. Okay,butIstilldontknowthedifferencebetweenapersonlivingtheroller coaterwithandwithouttheScience. You just said it: the difference is living with the science or betteryet,withconscience!Onedetail,butadetailthatchanges everything!Letssaythatonedayyouwakeupandyoufind yourselfinarollercoasterandyouhaveneverseenonebefore andyoudontknowhowyouendedupthere.Whatdoyoufeel? Well,themajorityofyouwouldsaythatyouwouldfeeltrapped tothethingandwouldbescaredtodeath,andwhenitstartedto pickupspeedandstarttoloopwhatwouldhappen?Itwould

109

beanightmare,wouldntit?Unfortunately,itswhatlifehas beenforalotofyou.Ifyoubelievedinyourselvesandinlife, you would know that everything depends on the perspective thatyouadopt,andyouwouldrelax,anddecidethatthebest waytoseeitwouldbethatyougotontheridebecauseyou wantedtoandyoujustforgotit.Inthiscase,youunderstand thatyoudontknowwhatisgoingtohappenbutyoudecidedto see this as an adventure. The perspective makes it different, right? By seeing things this way, the person would fear the downslopes, buttheywouldenjoythefear,theywouldfeel pleasure going up, but would remain prudent, because they wouldunderstandthattheupsanddownsaretemporarystates! Andthisway,andonlyso,wouldsheliveeverythingbetterand moreintensely,becausetheywouldntfeellikeavictimofthe ride!Understandthedifference? Yes,Ibelieveso. Wespokeofformsbefore.Theonethatunderstandsandlives the Science, lives impassioned because they know that they cantattachthemselvestoanyform,theyknowthatalltheyfeel andeverythingthathappenstothemareonlychallengesand proofssothattheyevolveintheirpersonalgame!Helovesthe moments,andnotthethingsaround,andnottheobjectsinhis life.HelovesLife,ortheEnergy,thatleadshimtolivethrough something,tohavesomethingattherightmoment,tomeetthe rightperson.HelovestheLifeinpeopleandinthings!Irepeat: whenhebecomesimpassioned,helovesandreveresLifethat worksinsideaperson.Thisisthereasonforpeoplewhoreally want to practice the Science and never want to posses or imprisonanyemotion,orthing,orperson.Apersonthatreally wantstoliveimpassionedaloneorwithapersontheychoose andischosenbyatthatmoment,thispersonknowsthebest pathistorevereandcelebrateLifewithallitsliberties,andbe aware,bereallyawareoftheirownintrinsicappeals.Andyou knowthatthepersonthatyoulovehastodothesamethingto beabletoliveimpassioned. Waitaminute!

110

Imwaiting IknowIannoyyoubutsometimesIhavetostopYoubecausethingsstart gettingcomplex. YoudontannoyMe.Weareheretoclarifythings;wearehere to evolve, for you to remember the best way to love one another.Whenmenandwomencanbetterloveeachother,they will be happier people and consequently, the World will be much happier. If we are making this book its because this themeisveryimportant,Antonella.Thelovebetweenmenand women,whenitswellpracticedis,aftertheloveforLife,or rather,aftertherelationshipofallofyouwithMe,thefirstand mostimportantstepforabetterworld.Withoutthis,youwill always feel like something is missing, you will always be frustrated and will make each other suffer because of frustration. Youmeantosaythattherelationsbetweenmenandwomeninfluencethe stateoftheworld? Andhow!Itis,asIsaid,afterthelackofspiritualconscience, itsthethingmostresponsibleforthechaoticandtragicstate wheretheworldfindsitselftoday!Andthereasonisagainvery simple.Ifeverythingisenergyandvibration,ifeverythingis bornfromemotions,thethingthatmostinfluencestheworldis whatyoufeelasthemostintenseemotion.Andinhumanlife, thatwhichcreatesemotionisverysimple:itsthepassions.Be itaprofession,ahobby,amanorawoman.Thereisntmuch morethanthis.Andifoneofthepassionsisnotdoingwell,if itsnotpracticedorifitsunbalanced,alltherestwillsufferfor it.Ahappyandbalancedlifeis,firstofall,alifeinwhicha personhasconscienceandlivesimpassionedbecausetheyfeel andrealizethevalueofexistence.Secondly,itsalifethatthe person does that what he is passionate about and lives with someonewhomtheyfeelpassionfor,orrather,alifewherea personfightstorealizehimself,andrealizestheirdreamsevery day.Anditssosimple! ItmaybeforYou,butforus

111

Thatswhywerehere.Sothatallofyoucanrealizethatits possibletolivehappy,thatbeinghappyisnotautopiaorluck. TobehappyisaSciencethatallofyou,withoutexception,can andshouldpractice. WhenIsaythatyourchaoticrelationshipsareresponsiblefor thechaoticstateoftheWorld,itsbecauseitis.Ifeverythingis energy, all your unhappiness is a potent energy that creates more unhappiness, In order for the World to get better, its urgentthatyoulearnhowtobehappy!!!Andthereisntany timetolose!!!Imgoingtoexplainthiswithasimpleexample. You are happy, dancing with joy, you are smiling. Observe whatyoudo;observewhatthatdoestothepeoplearoundyou! Its the example of thepebble fallingintoaplacidlake and making little waves that touch the duckling and so forth. Observe!!!Youwillseehowpeoplewillstarttonoticeyou; somewillcomenearyou,somepeoplethatwilleventellyou howcontagiousyourjoyis! Now,observewhenyouhaveamovementofsadnessoryoure inarottenmood,takealookandseehowthataffectstheworld around you. Observe this and you will be amazed with the magicthat,unconsciously,youarepracticingateverymoment withyouremotions!!!Asadpersonoronethatstooserious makesotherssad,worried,makespeopledistancethemselves fromher,ortheatmosphereturnsheavy.Andsuddenlypeople getmoresuspicious,theystarttofight,andnooneknowswhy! Agreatplacetostudythisistraffic.Yes,traffic!Gotoabig city and get yourself locked into a traffic jam on purpose! Observe peoples nervousness, andobserve theenergywaste thatthisnervousnesscreates!Thetrafficjamisagreatteacher, andapassionscientistdoesntletanyopportunitytolearnpass themby.AndIsay:observethestrengthofsadnessandofa rottenmoodinjustoneperson,andyouwillunderstandmany thingsabouttheworldaroundyou. Allright,Youareright,Ireallyhavenoticedthatouremotionsarerealand contagious, that they influence the world around us, that they arelike a mutatingvirusthatwegivetooneanotherwithlightningspeed,andso, withoutusreallynoticing,wecreatebothbeautifulandterriblethings.Its

112

true!!!Iseeallofthis,andIrecognizetheinterrelationbetweeneverything. Buthowcanwemakethisprocessaconsciousone?Howcanweoptforthe good emotion, the one thats constructive, the good virus, or rather the contagiousjoy,thehappiness?Because,forthemorewewantit,itsnot possibletoforcehappiness!Happinessisonlybeautifulwhenitsnatural! Of course, and because of this, I repeat, weare writing this book.Foryouthatunderstandthedualperspective,forthose that comprehend that you have to start studying yourself, becauseyouareresponsibleforyourownhappiness!Happiness isanenergyvibration,anditstheenergythatisvibratingthe fastest.Youhavetofigureouthowtoliveyourdaytodaylife andyouhavetodowhatittakestoincreaseyourvibrationand maintainit.Thisincludesstudyingwhatdietyoushouldfollow, whatexercisesyoushoulddo,whatprofessionyourgoingto dedicateyourselfto,andthetypesofrelationshipsyouwantto have with your loved ones, family and friends, and finally, study what makes you vibrate the fastest in all levels at all times. And this is an individual study, its something that everyone has to figure out themselves because its different frompersontoperson,buthappinessissomethingthatall,I repeat, all can figure out in themselves. Thats why we are writing.Sothatyouwillputeffortandworktoachievethis happinessthatweallwish!Youhavetounderstandthatyou havetotakerisks,youhavetofigureoutwhatyouwanttodo andyouhavetodoit,andyoucantbeafraidofbeinghappy! Andyoucantgiveupwhenyoutryandfail!Whenyoufailits becauseyouhavesomethingtolearn,itsbecauseitwasntthe timetosucceed.Butbeawareandyouwill seethatthereisa messageinthemoment,thereisalearningopportunity,thereis achallengethatwillmakeyougrowandwillmakeyoustronger for your next try! Believe it!!! Always try again and do it differently,workoutwhereyoumadetheerror,butdontstop, neverstoptrying!And,littlebylittle,ifyoufight,ifyoubelieve itwithallyourmight,ifyouthrowinallyourenergyintothis search,youwillstarttonoticethemagic.Youwillstartnoticing that,naturally,youwillstartvibratingfasterandbetter.Observe it,becauseitsreallyincredible!Youwillslowlystartnoticing thatthemomentsofjoywillbecomemorefrequent,youwill

113

seethemomentsofsadnessarentthatseriousbecauseyouwill see the opportunityinthem.Youwillseeaboveall elsethe responsibilitythatiswithintheemotionsthatemanatefromyou andyouwillbecarefulofthem. ButdidntYousaythatwehavetoliveoutalltheemotions,includingthe negativeones;thatwehavetoobservethemandenjoythem?Ifwehaveto becarefulwithwhatweshowothers,howdowedothat?Shouldwerepress anemotionthatisthere? No, never repress any emotion. But also dont take it too seriouslyandmakeotherssufferwithwhatyoufeel!Youhave tounderstandthatnoonebutyourselvesisresponsibleforwhat you feel. If you feel anger or nervousness, if you feel any negativeenergy,understandthatthisisachallengethatyouare goingthroughatthatmoment.Withdraw,hityourheadonthe wall,screamreallyloud,cryifnecessary,andtalkwithMe! Recognize and confess to yourselves the fear and pain that residesbehindeverynegativefeeling,ifyoucan,confessit,talk andcryyourpainwithyourfriendorlover,butneverblame anyoneforthepain,neverforgetthatnooneisresponsiblefor whatyourefeeling!Thisiswhatyouhavetounderstandwhen you come across negative feelings: that youre the only one responsibleforthemandthatyouhavetobecarefulbecause theyarerealvibrationsandtheycandoharmtoothersandthe World.Livetheemotions,butdontannoyothers!!! Please, try to understand that what Im explaining this no theory,itssomethingpracticalandreal.Illrepeatbecausethis isdealingwithasomethingveryimportant.If,forexample,you gointoasituationwheresomeoneistoyingwithyouorheor shewantstomakeyouangry,orifsomeonehurtsyou,seethis as an opportunity! Dont react as you always did, dont be unconscious!Itsnotaboutmorals,butIrepeat,itsaquestion oftheenergeticconsciousness.Whenyouactinanewway, whenyoubetontheintelligentemotion,youarebettinginyour own vibration, your own happiness and so, you are helping yourselves and the World! Observe the situation, understand thats not by chance,studywhyyoucausedthatsituationto happentoyou,andtrytounderstandwhatthebestwaytoactis.

114

The Passion Scientist never reacts unconsciously, he always seesinthemoment,whetheritspositiveornegative,andan opportunitytoactinanewway!Byacingthisway,youwillsee thatyouarebecominghappiermorefrequently,andyouwill seethat,whenyourarefeelinggood,youllstarttoattractand helppeoplearoundyou,andyouwillseethat thequalityof everymomentwillincrease,higherandhigher,untiloneday youwillnoticethatyouarelivingimpassioned!Andeveryone willbenefitfromit! Thisisreallyencouraging.Itsgoodtoknowthathappinessispossible. Yes,andparadiseandhellarehere,insideofyou.Itsuptoyou tocreatewhatyouwish. Wow!Thisisincredible,anditsmarvelousandterribleatthesametime. WhatImeanitthat,itsanimmenseresponsibility! ItoldyouthatIcreatedyouinMyimageandlikeness...You aregodsandyoucreatewithyourwillpowerallthatyouwish tocreate,consciouslyandunconsciously.Ionlygivewhatyou create.But,itsclear,thatthegreatthingaboutthisstorywillbe when you start to do it consciously, when you enjoy this process,whenyouunderstandthatyouareallmagiciansand thatyouallcandomagicandthatyouhavetolearntousethose powerswell! Thisistrue...Icantevensay.Thisbookdoesnttopsurprisingme.WhatI meanis,IstartedtowriteknowingthatIalwayswishedtowritesomething likethis,butIneverexpectedthatsomanythingsflowedthroughme! YouaskedtobetheconduitofLight,youfoughtforthis,and believedinthis.Andyouknowthatyoureachedthenecessary energy, and you know the great moment has arrived. Go forwardwithpatienceandcare,butgoforwardwithfaithand courage,independentofwhatothersthink. Thankyouverymuch,littleGoddess. Thankyourself!

115

IamnothingwithoutYou! DoesthatmeanthatyoudependonMe? ThismeansthatIdependonYou,Ineedyou,andbetteryet,IloveYou. Yes,mydarling,thisisthegoodpathanditsthepathoflove. InthelovewithMeandloveingeneral,wedependandneed naturally, without it being a shame or a weight nor an expectationorafear.Itssimplyagreathappiness.Thejoyof lovingandbeingloved,thejoyofservingandbeingserved,and thejoyandthegreatthingthatyeswenaturallyneedthose whoneedus!!! Ok, I think I am starting to see, understand and live this crazy and sensationallovewithYou.ButIwanttoliveitwithpeopletoo!!! Youarewalkingforthis!EnjoythePath.Rememberthelessons fromtheSantiagosJourney! Yes,ofcourseIremember.Explainthistomethen,littleGoddess,howdo youpracticethisintherelationshipbetweenmenandwomen?Youknow thatIonlywantandthinkaboutbeingwithmen!And,ifthisisthebestpath, Ihavetogospreadthegoodnews,Ihavetorecruitmanypassionscientists sothatthewholeworldstartstogettogether,betterthanever! Iadoreyou,youknow?Iloveyourthirstforlovemaking!I createdyousobeautifully,withsuchcharmingorgans,withso manyqualities,Icreatedallofyou,asyouare,forthis:tomake love,alot!!! Ok,butYoujustsaidsomepagesagothatwhoeverpracticestheScience doesnotgetattachedtoforms.Whatdoyoumeanwiththis?Howisthis possiblewithlove?Howcanwemakelove,withouthavingaboyfriend? DoesthismeanthatYouagreewithOsho,andthinksthatmarriagekills love?Youmeanthatallthatromanticstuffisjustagreatabsurdity? Mylove,letsgetseriousabouttheencounterbetweenmenand women,letsstudyittogether,simplybecauseinsidethegame oflifethisisthemostimportant.

116

Therearepeoplewhoyounaturallywanttodistanceyourself from,asiftheirchemistrydidntmixwithyours.Doyouknow whatImean? Yes.InGermanthereisanexpressionthatsays,Icantsmellthisperson... Anditisreallylikethis,asifyourchemistrydidntmix.Onthe otherhand,therearepeoplethatareapleasanttohavearound, thataretheoneswhoyouwanttogetcloserto.Observethese natural processes because, of course, they never happen by chance.Ifyoustarttobelievethateveryeventisnotsimply chance,youwillstopactingasfearfullyasyouhaveactedso far.Boththepeoplethatannoyyouandthepeoplewhobring youjoyhaveahiddenmessageforyou.Transformeverything into questions like why do I feel this? and you will find answers that are very interesting, which will tell you about yourself. WhenIsaythatyouhavedonealotofbullshitinyoursexual encounters,itsbecauseyouaccelerateeverything,itsbecause youdonttakethetimetoobserveandstudytheother.What generallyhappenswhenamanandawomanmeetandbothfeel that undeniablefeelingenergyof attraction,that magnet that makes them want to get closer and study one another more intensely? Unfortunately, what happens is incredibly precise. The man looks at the woman and in accordance with his cultural conditioning, his receptive channel for the feminine energyisinthesexualchakra,heassociatesthissensationwith sexual desire. The woman looks at the man, and since her perceptivechannelforthemasculineenergyisinthechakraof theheart,sheassociatesthisfeelingwithgreatlove.Ofcourse that,inthelastfewyearswiththesexualrevolution,therehas beensometimesachangeinconditioning,butIwanttoclarify thatgenerallytheseemotionsarenotintheirpurestate,theyare theconditionedreactions!Observe!Thedeepestwish,thereal wish,isonlythewishtogetcloser.Followingthat,therearethe conditionedreactions,orratherthecomputerintheheadofthe person translates the information sent by the soul into a physicalformthatwouldbeforexamplemeetthatpersonand heunderstandsas:getthatgirl!!!Whydoesthishappen?It

117

happens because all of you live in such a nervous way and become deeply anxious. You always have the feeling that something is missing, and you have to look for something outsideyourselves,formsthatyoubindyourselfto.Theforms canbe:sexualadventure,romance,marriage,etc. Well,thisiswhathasoccurred.Youwalkaroundlikeabottle missingitscap,feelingasifyouweremissingsomething.And youseeintheotheryourmissingpart,yourbottlecap,whatyou thinkisyouneedtofillthemissingpartinsideofyou!Youmix things up right from the start, then you have confused and unsatisfactorylives,andyouarestillshockedofthis. Yes,thatstillhappenstomesometimes... Iknow.Anditdoesnthappenonlytoyou.Soletsseehowthe scientist acts. A man and a woman practice the Science, or rather,theyknowthattheirhappinessdependsonthemandthey doeverythingtobehappy.Theyllachieve,throughworkand study of themselves, feeling always or most of the time impassioned for life. They vibrate intensely, with a lot of energy.Theyconstantlyusethedualperspective.Theyknow thatnothinghappensbychance.And,suddenly,theymeetand theyfeelattractedtoeachother,thewanttotalktooneanother, orwanttolookateachother,orwhateveritmaybe.Thenthey getcloseandstarttostudyandobservetheother,andaboveall else,theystarttryingtounderstandthefeelingitcausesinside them.Withoutimagininganything,theyexpecttounderstand through this study why the person surfaced, why the other calledtheirattention.Wasitaconditionedreaction?Wasitjust theothersphysicalbeauty?Sothatmeetinggavethefollowing message: better observe the energy that emanates from the person,andnottheirphysicalform. Seehere,Iamnotsayingthatthephysicalsideisntimportant. Itsveryimportant!Thephysicalbodyandthetracestellalot abouttheperson,howshelivesdaytoday,howtheyfeellife, howtheynourishthemselves,howtheythink,howtheylove and how much they love. All of this forms and marks the physicalbody!Butgenerallyyoudonttrytoreadthedetails that you see, generally you only look for in the other a

118

conditionedbeautythatyoucarryaroundinyourminds.This way,ifyouconditionyourselftolikeblondesforexample,ora certaintypeofbody,youwillseeablondeandyouimmediately thinkshecanfilltheholeinsideyou,withoutstudying,without understandingthatthisspecificblondeisauniquepersonthat hascrossedyourpathforaspecificreason! Okay, but once again the Science seems deeply calculated and rational, deeplyserious,whenthebeautifulthingabouttheencounteralsois,andYou saidthisword...agame! Ofcoursethegameismorefun,thatwhichgivesyouthemost pleasure,thatwhichteachesyouthemost.Butfromthestartof thisbookIhavebeensayingthattoliveisagamethatyoucan play consciously or unconsciously, and that makes a big difference!Theunconsciousgamealwaysleadsyoutodeadend streets; it always leads to suffering and anxiousness. The conscious game is a continuing adventure, its to walk in a strangecountry of emotions,andits,byconsequence, much morerewardingandfun! Whenyoumeetandareattracted,itsjustthat,itsbecauseLife or I want you to play together, and that you help the other advanceintheirpersonalgame!Iamonlysayingthatyouhave tostopmakingeverythingintoprepackagedlittleitems!Instead of,whenyoumeetawomanoraman,thinkingwhenarewe going to have sex? orishesingle,doeshemakealotof money?andthingsofthatsort,dontthinkit!Feelit!Tryto observe whatyoufeelandwaitfortherightmoment toact. Whentherightmomentcomes,itsindistinguishable;itcomes because it had to come, because its inevitable, because its necessaryforyourpersonalgame!Andifitdoesntcomeinthe shapeofasexualorromanticencounter,itsbecauseitdidnt havetobeso,itsbecauseitwasntinevitable!Itsverysimple. Butthatrestrictsmanyofourencounters!IfIthinkhardaboutmysexual encounters,ifIhadobservedthem,manywouldnothavehappened! Ofcourse,andyouwouldhaveavoidedthesideeffects... Sideeffects?

119

Thatsright.Seehere,theencountersbetweenmenandwomen areaveryseriousgame,aseriousanddivinedance.Whenyou meet, you are two divine energies meeting, two energy universesinteracting.Ifitsnotaqualityencounter,ifitsnot practicedwithreverence,ifyouareonlytryingtofillaholein yourself by using the other, what happens? Unbalance. One triestosucktheenergyfortheotherandbothgetoutofthe experienceweakened.Itsnotbychancethatthereissucha termaspostcoitusdepression!Whenyoumeetinabadway, whenthegameisinconsistent,youendupfeelingapalpable and real sadness, andyoudont knowwhereit comesfrom! Well,itcomesfromwithinyou,anditsasideeffect.Itsmore orlessthedifferenceintheconsequencesofenjoyingawine slowly andpleasurablyorquicklydrinkingabottleofcheap wine!Oneelevatesyouremotions,givesyougenuinepleasure, warmsyou,givesyouagoodbuzzandleavesyouwithagood memory,andtheotherleavesyouexhaustedandgivesyoua giantheadache!Paycloseattention:ifyouwanttodrinkfrom thegoodwine,youhavetobetonqualityoverquantity.Ifyou wantgoodsex,thekindthatelevates,youhavetobetonquality notquantity.Observe!Payattention!Enjoyeverystep!And,if youthinkthatitsreallyworthit,thinkaboutitandworkouta strategyforconquest! ButhowdoIrecognizewhenwehaveorshouldgoforward,howdoIknow whentheencounterisoneofquality,orinaccordancewiththeScience? EveryencounterisinaccordancewiththeScience.TheScience saysthatalltheencounters,especiallythosethatcauseemotions arenotbychance.Theimportantthingisonlyhowyouchoose toliveouteveryencounter. Okay,butwhatIwanttoknowishowandwhen,inaccordancewiththe Science, an encounter should turn into a sexual one, or become more physical? Itsverysimple,butyoujusthavetocomplicateeverything.An encountershouldonlybecomephysicalwhenbothpartiesare sure that they are feeling the same thing!!! If they are two

120

consciouspeople,waitingforthatmomenttoarriveandwhenit does,they willrecognizethegreatopportunitythatiswithin thatmoment,themiraclethatitistofeelthesamething,atthe sametimeforanotherhumanbeing! What?Doesthatmeanifyouwanttotouchtheotherandtheotherdoesnt feel the same the encounter shouldnt happen? That the one that feels shouldnttrytogetcloser? No,itsnotquitelikethis.Ibelievethatsagoodtimetoinsert theelementofmusicintoourconversation.Letsgostepby step. To start, I have to explain to you something very important:Iammusic. Whatdoyoumean?DidntYousaythatyouwerelove? Thatsright!Iamlove,Iammusicandbyconsequence,loveis music!!!Agoodconclusion,right?Haveyounever wondered whymusicexistedonthefaceoftheEarth?Younevernoticed thatmusicislikelove,beyondlogic?Musicispurecelebration; musicisthesublimemovementofLifetranslatedintosound.I am music, dancing in Eternity. Observe Life, observe the intrinsicmovementsoftheeventsinyourdaytoday,andyou willdiscoverthatthereisarhythminsideyou,arhythmthatall themovements,alltheeventsobey! Thatsverybeautiful...ButI cantreallyseewhereYouwanttogettoby talkingaboutthisnow. Be calm...step by step, Antonella! Like in the Santiagos Journey!Letsgo:ifloveismusic,whathappenswhenitoccurs betweenamanandawoman?Whatdoesitask?Verysimple!I, orlove,wanttodance!Howdoesmusicmanifestitselfinthe physicalworld?Throughdance!Andwhatisthemostsublime love?Itstheonewherethedanceismoredeveloped! But,ofcourse,whoeverbecomesawareofthis,hastopractice theSciencealot,theyhavetoobservemuch;andwhenyou haveobservedalotthemovementsoflife,thatofpassionand love,youwilldiscovertheGoddess,orthefaceofthefeminine God.

121

Wow,Imgettingdizzy!Imnotgettinganything!WhatYoumeannowin discoveringtheGoddess,isntit? Calmdown,youwillsoonunderstand!Youareveryimpatient! Well, Ill tell you something you may not know: when you chosetocallmeGoddessinthisbookthattalksaboutPassion, ofcourse,itwasntbychance. Itreallywasnt,itwasbecauseIwantedtopayhomagetothefeminineside ofCreation...ButYoumeantosaythattherewasadeepermeaning? Yes.Ifwearegoingtotalkaboutloveandsex,wearegoingto talkalotaboutthefeminineenergy.TheCeltsknewthiswhen theyworshipedaGoddess,andtrantricismalsoknewthis.Iam notsayingthatthemasculineenergyisnotimportant.Butto talkaboutlove,passionandsexinthetermsoftheScience,I havetointroducesomenewelementsintoyourperception. First,Italkedaboutthedualperspective,ofthedeepspiritual feelinginallthathappens.Whenyouhaveconscienceofthis, youwillbegintostudyyourencountersinfunctionofthis. Fromthenon,everythingbecomesmoreinteresting.Whenmen andwomenmeetandstudytheencounter,andtheyareaware thatwhatshappeningthereisarealattraction,itssomething thathastobe,atthatmomentenergydoorswillopentowhat weshallcallthedanceoflove.Ifloveismusic,themoment younotice,throughobservationofyourownemotionsandthat ofothers,thatyouarebothfeelingsomethingfortheotherat thesametime,thatmeansthatLife,orMe,isinvitingyouto dancetogether! So? Sothenthereistheunknown.Becausethisisthegreatbeautyin the dance of love! Love is a dance that you cant learn beforehand,thatsalwaysnew,alwaysdifferent!Loveasksof youanewactionateveryinstance,anewreflex,lovecannever stagger,anditcantstandroutine.Iamnotheretoteachlove, becauselovecantbetaught,everyonecarriesitinsidehimself or herself. I am here to make some details, which are the

122

importantbasicsofthedancewellaloneorwhenyoufind lovewithanotherperson.ThefirstpointthatImade,whichI have spoken aboutmanytimes,isattention,because nothing happensbychance.Attentionisessential!Neverforgetthis!!! Afterwards, speaking of love between men and women be consciousthatphysicalloveisamanifestationoftheGoddess, or its Me, or part of Me that is the feminine energy, the femininefacetofLife,callingyoutointeract,invitingyouto dance.Thisconscienceisessential! Why? Becauseitwillcauseyoutodoubleyourattention.Itwillmake younoticethemusicofemotion,whichyouobservethedivine process that is occurring beyond your thoughts! You asked before, when should love turn physical, and this is a very importantpoint.Seehere,inballroomdancingyoulearnthat themanasksthewomantodanceandleads,andthewoman, eventhoughshehastoequallyfeelandfollowtherhythmofthe music,followstherhythmoftheman,andsobothforma singularity,andsothedanceismorebeautiful.Thisisntamale concept,nooneeveraskedanythingaboutitbecauseitalways workedoutwell,andthedancingisbeautifulthisway.So,now IllexplainwhatImeanwhenIsaythatyouhavetoobservethe Goddess.Illtellyouthetruththatisstillnotwellknown:if youwanttodancewelltothemusicofloveyouhavetoletthe womanlead!!! WhatdoYoumean? Attention!Imnottalkingaboutdominatingtheother,because in true love this doesnt exist, and when it exists, its only playing. I am talking about following, guiding, showing the rhythm. Other peoples already knew that the woman should lead in sex, andtheypracticethis.Wearetalkingabout the danceoflove.Sheis,fromthebeginning,fromthefirstlook, something very subtle, a combination of sometimessmall unconsciousmovementsandalmostimperceptibleones,playing agameofcomingcloseranddistancingoneself.Loveorthe Goddess,orMe,conductsyourbodiestogothroughthatexact

123

momentandthroughthatexactplaceandtrytofindyourself. From the beginning there has been a divine element in love encounters,anelementthatisbeyondanyoneswishes.From thestart,beforeyouevennoticedit,theenergiesalreadystarted tostudythemselves,thebodies,whichwereworkedoutthrough the events, thoughts and emotions so to find at that exact momenthowtodeciphereachother.Payattentiontothis!Play withthis!Andwhenthemanandthewomanfinallyreachthe pointwheretheytouchphysically,understandthis:bepatient! Ifbothhavebeenabletodancewelluptothatmoment,ifthey havebeenabletogetthereandtheyarebothfeelingthesame thing,well,hereissomeadviceforthemen:wait!Menhave fasterphysicalreactionsthanthewomandoes,andgenerally theyhaveafasterrhythmofdesire.Ifthephysicaldanceisto beperfect,bothhavetobeinthesamerhythm,exactlylikea ballroomdance.YouarelearningtodancetheSalsa,Antonella, andyou have noticedforawhilethatyoucantakespiritual lessonsfromeverythingthathappensinyourpath.Whathave you learned from the sports you practiced, for example, and whatareyoulearninginrelationtothelearningadance? Well,ithasbeenmanyyearsthatIhaveunderstoodthatitsveryimportant toexercisethebodytofeelwellandtohavemoreemotionalclarity.Over theyearsIhavetriedmanydifferenttypesofexercisesandtheyhavetaught memuchaboutmyself.Ihavemoderatelypracticed,walking,swimming, running,gymnastics,stretching,andeverysportofferedarangeofspiritual teachingsthattalkaboutamongotherthings:theimportanceofhavinga goal,tofindyourownrhythm,tobepersistent,tousetheenergyofthought, tobeawareofthepresentmoment,tounderstandpainasanaturalelement whenyouwanttoevolve,understandhowtoendureitandacceptitandso forth. Right now, besides running and swimming sometimes, I am learning capoeiraandtodancetheSalsa.Theyareverydifferentexercisesfromthe sportsthatIhavepracticeduntilnow,especiallywiththenewelementof beinginrhythmwithanotherperson.Ihavediscoveredinterestingthings. Forexample,Idiscoveredthat,tobeabletodancewellwithanotherperson, we have before anything else to discover a rhythm with ourselves. Afterwards,tobeabletointeractwellwiththeother,eyecontactisessential.

124

Its necessary to have a diffused attention, as You explained before in relationtoLife,becauseitsnecessarytolookintotheeyesoftheotherand feeltheirbodyandatthesametimetounderstandwhatmovementhewill begin.Therhythmisinsidehiseyes. Verywell.Thisisthequalityofattentionthatisdemandedby theScienceofPassion.Everythingthatisonthefaceofthis Earth carries a bundle of messages and practical spiritual lessonsthatyou canuseinyourdaytoday.Payattentionand you will start tounderstand that youcanlearnsomething in everymomentandinallpartsoflife.Wearetalkingaboutthe greatestschoolofall,theSchoolofLife. Letsgobackthentothedanceoflove.Wearetalkingabouta dancethat,atthesametimeisverysimple,anddeeplycomplex, becauseasIexplainedinthebeginningofthisbook,youare beingsmadeofbody,spiritandsoul.Todancewellwiththe other,theseelementshavetobeverywellbalancedinsideyou. Iftheyarebalanced,theenergyoflovewillbeabletoflow freelythroughthebodyandpassontothebodyoftheother. Forthattohappen,allthechakrashavetobeopen.Ibelieve thatyouarefamiliarwiththewordchakra.Ithastodowiththe centersofenergywithwhichyourbodiesreceivethevibrations or cosmic energy. The chakras are energy doors of your organisms,andtheyareatthesametimeantennasthatsendand receiveenergy.Iwontexplainmuchaboutthisheresincethere is a vast literatureabout thisforanyonethat wantstoknow more.Theimportantthinghereisthatyouknowtheexistence of these energy doors and their role in love interactions. Whoever wants to dance well in the physical love, whoever wantstoevolvethoughsex,elevatethemselvesenergetically,to feelMethroughphysicallove,hastoknowthisessentialpoint: themanhastobeabletotouchtheheartchakraofthewoman. WhatdoYoumeanwiththis? Itmeansthatthebestphysicallovehappenswhenthewoman feelsthemanemotionally.Shehastobelovingalotandloving strongly,andtotrustthemaninacertainwaysothatthislove canbetranslatedintophysicalmovements.Becareful!We arewalkingonadelicateterrain.Itoldyouthatyoushouldnt

125

adopt forms and now Im telling you that a good encounter necessitateslove.Thisseemscontradictory,right? Yes,itdoes. Butitisnt.Letstakealook;reallovedoesnthaveanythingto dowithwhatyougenerallycalllove.Whenyoutalkaboutlove, you are generally associating it with the constant search for security and form! And the form is conditioned love; its those things that you think have to be love, be it having a boyfriend, having a commitment or being married. The love thatIamtalkingabout,thetruelove,tolovethatisvibrantand lively,orrather,thepassion,isbeyondallforms!Observethis! This is what has caused all the great confusion in all your encounters.Thewomanlooksforthemostintenseencounters, the one that gives thestrongest emotional energyspecific to passionandlove.Shelooksforthisinstinctively,exactlyasa femaleintheanimalworldlooksforthebestandstrongestmale tocontinuetherace.Thewomanknowsthattheemotionalsex givesonethemostpleasure,anditstheonethatenergetically elevates,andlatertheonethatmakespossiblethebirthofthe bestchildren. Theproblemofthewomanisthatshehasthe culturalconditioningthatconfusesthesearchforthiskindof energywiththesearchforasupposedsecuritythatcannever existinherlife,thatbeingeconomicsecurity,oranyothertype ofsecurity.Man,knowsandfeelsthisaswell,buthehasashis culturalconditioning,notbeingabletodealwithhisemotional world,andtogivemuchimportancetophysicaldesires,which makeshimcontentwithasexthatispurelyphysicalandvery muchbellowhisenergycapacities. Wehavearrivedataveryimportantpoint.Whathindersthe encountersbetweenmenandwomen?Whatcausesthephysical encountertonotbeallthatitcanbe?Thesearchforaform.The idea of possession anditdoesntmatterifitisemotionalor physicalpossession.Allofyouconfuseemotionalsex;confuse the energy of passion with possessing! When you feel sex emotionally, when you get emotion making love, this is so intense,soallencompassing,sodisconcerting,thatyousoonare lookingforsecurity,youusetheotherasacrutchforfearof

126

loosingyourselfinyourownemotions!Man,forexample,for fearoffeeling,manytimestransformstheencounterintoaform ofmasturbationthroughthewoman.Thewomanforfearofthe future and the insecurity of feeling without demand feelings back, many times transforms the encounter into a form of salvation,thatsheattachesherselfindesperation. Well,youdonthavetodoanyofthis.Livethismoment.Find yourself,lovefirstthehumanbeing,andlovefirsttheLifethat youseeintheotherperson.Talkandcommunicatealot,inthe manylevels,andbesincereaboveanythingelse.Youwilldo thisifyouseeinoneanotheramanifestationofLife,orMe, andthiswayyouwillalwayshaverespect,love,andcarewith those that you find.Andfromthenon,dontinvent aform; donttrytoimaginehowtheothershouldbelikeandabove anythingelse:neverdemandanythingfromoneanother!Pay closeattentiontothis:loveneverdemandsorexpectsanything! Whenyouseethis,whenyouunderstandthisemotionally,you willcomprehendtherealessenceofaloveencounter.Thereal encounteristheonewherebothareopentogivethebestof themselves without knowing what it is they are giving, and without knowing what they will get in return. The true encounteriswhenbotharefulloflove,happiness,andlovefor Life,andtheycantwaittosharethiswiththeother.Thetrue encounter is the one where you give without expecting to receive,knowingthatnaturallytheUniversalLawiswhatever yougiveinloveyouwillreceivebackdoubleortripleormore. And this law, once again,doesnt incorporate forms,what it meansis,whenyougivetoaperson,itcouldbethatyouwill neverreceivefromthisperson;itcouldbethatyouwillreceive from many others, but you will receive it. There is the importanceofthedetachment.Andso,whenyouunderstandall ofthis,andonlythisway,willyoucompletelydeliveryourself emotionally. Wow!Youaretalkingaboutmanythings... Yes,wearetalkingaboutloveandsex,andforonetoworkthe other has to work as well and vice versa. But the key to everything,ofabsolutelyeverythingisintheperspective.Ifa

127

womanandamanarefullofenergy,overflowingwithlove, findthemselvesandunderstandthateverymomentandevery secondismagical;theywillmaketheotherrise.Inthiscasethe encounterisamanifestationofMe,itsmusic,itslove,itsthe dancemanifestingitself.Butif,onthecontrary,itsamananda womanthatarentbalanced,thatdontlivewellandaretrying tofillagapintheother,thevibrationcouldevenbehigh,butit willeventuallyleadtofrustration. Attention:whenIinsistthatyoushouldntlookforformsorto attachyourselftothem,Idontmeanthatyoushouldnthave them! Nowthingsareevenmorecomplicated! On the contrary,mydarling,thethingisreallyverysimple. Have money, have things, be with the other, marry, live together,butalwaysmaintainthedualperspective!!!Thisisthe missingingredientinallofyou.Neverthinkapersonorathing asowned,neverthinkthatyouhavegainedapossession, and neverthinktheotherasyourterritory.Understand,feelinevery momentthatnothingbelongstoyou,andsoyouwillbeableto perceivethevalueofeachthingateverynewmoment.Havea boyfriend or girlfriend, marry if thats what you want, yes, celebrateandcheerandbeenthusiasticwithloveinalltheways possible,playwithlove,fightforlove,eat,drink,andlivefor love,butnever,neverforgettogiveattentiontoeverymoment that passes, neverforget thatnoencounterisbychance,not eventheencounterswiththepersonyousleepwitheveryday!!! Understandthattoloveandtopossessarecompletelydifferent things! When Osho said that marriage killed love, he was talkingaboutpossession.Andinfact,Itellyou:possessionkills love. But its not as obvious as it seems. You can have an openrelationship,asyoudidAntonella,anditcanstillhurt love. Whatdoyoumean,Life,whatdoYoumeanbythis? Tolove,mydarlingisaverysubtlemusic,verystrongandvery delicateatthesametime.Sandroandyouhadamuchneeded encounter; you walked the difficult path together that was a

128

greatemotionalunconditioning.Youlearnedtogethertofight oneofthemostcomplicatedemotionalconditioningthatthere is, that jealousy is or the sensation that you can posses and demand the fidelity from someone. But you still didnt maintain the necessary passion vibration; you still couldnt maintainthecompletenessforeachotherthatyouachievedin theemotionalmoments. Yes,thisistrue.Andmanytimes,whenInoticedthis,Isuffered,Itried again,andthevibrationalwaysdecayed,andIwentbacktosuffering,andI couldntunderstandwhywecouldntdoit. First,thereisatruththatisveryimportanttoknowandmakes existence much easier: what doesnt happen naturally is not meanttobe.Itsclearthatwhendealingwithlovethisisnt very obvious, all of you are, consciously or unconsciously, fightingtogethertoovercomemanyconditioningsthathinder the elevation of the energy vibration inside yourselves. Whoever has to decide whether to continue or not in a relationshipdiscoversthatthereisaveryfinelinebetweenwhat isgoodandwhatisbadfortheirpersonalelevation.Theperson might choose to continue in a relationship that doesnt give themthefeelingofcompletenessbecausetheythinkthatthey havesomethingtolivethroughorlearnwiththatperson,andin thiscase,itdoesthemwell.Buttheymightalsostaybecauseof habit,theease,forfearofchange;becausetheythinkthatthey wontfindsomethingbetter.Thepersonthatdecidesthiswayis runningagreatrisk,becausetheyarestagnatingspiritually,by theirowndesigns!Theonethatsuffersfromthisisthesoul, whichhardlyeveracceptsthisforalongperiodoftime.From the spiritual point of view, the person that acts this way is missingoutontheopportunitytolivefullymillionsofinstances that they wont get back. With people like this, many times somethingunfortunatehappens,whichistheonlywaythatsoul findstohelpthemgoforward. In your specificcase,youdidtheright thingbytryingwith Sandroasmanytimesasyoufeltnecessary,becauseyoudidnt loseyourspiritualperspective.

129

Yes,IthinkIdidtherightthing.ThismakesmethinkofthewitchDonJuan from the books of Carlos Castaneda (which I recommend) in which he advisesthatyouonlyfollowthepathsrecommendedbytheHeart,andtotry themmanytimesuntilwearecertainifitstherightpathornot.Sandrowas therightpathuptothetimeIdecidedtostaywithhim,becauseinthose momentsspenttogether,wewonmanythingsandwelearnedalot.I was consciousthatwehad(andstillhave!)averyspeciallove,becauseweboth helpedeachothergrowspiritually,becausewebothneverstoppedlooking forthetruth.IfIwantedtodissolvetheformoftherelationthatwehad,its becauseIdidntfeellikethefeelingcorrespondedtotheformadopted.Istill lovehim,butIdontfeelbeinghisgirlfriendorhiswoman,becauseat thismomentofmylifeIassociateanothervibrationtothistypeofform. ThesedaysIhavedecidedtouseallofmyenergytowardsdreamsthatIam notsurewillcometofruition,butinacertainway,theyarealreadyrealityto me.Thedreamtobeawriter,tolivethis,travelbecauseofthis,beready, andthedreamtoliveanintense,deepandconstantpassionwithaman. WhatdoYouthink,Life,amIgoingtogetthere? Whatdoyouthink? Ithinkso. Sobelievethis,livethis,andwalktowardsthis.Andenjoythe suspenseofthepaththere. Soplease,littleGoddess,continueexplainingaboutLove.Ireallywantto hearYou! Yes. We talk about libertyor detachment,as if theyare the samething.Themoment youunderstandthatyouarespiritual beings, who have bodies and that you are living a physical experience, everything changes. Normally people think that theyareabodythathasasoul.Abetterperspective,onethat widensthehorizons,istorealizethatyouarereallysoulsthat haveabody.Fromthemomentthatyoufeelthisasareality, youwillstopattachingyourselves,andyouwillstartlivingthe essenceofeverymoment,andyouwillstarttoenjoythemagic ineverymoment.Themoreintenseloveisonlypossiblewhen youhavethisliberty,andreallibertyisonlypossiblewhenyou

130

have this love. Whoever loves to the max feels free and whoeverfeelsfree,loves.WhenIsaidthatbetweenamanand womanitsnotenoughtohavelibertytomaintainapassionate vibration,Imeantthat,eventhoughlibertyinarelationshipis animmenseandnecessaryconquest,youcanneverforgetthat passionissomethingalive,itsaflamethathastobefed.Many timesthisflameextinguishesitselfforlackofcare,andamong these,oneofthereasonsforthiscouldbetheattachmenttothe ideaofliberty! Attachmenttoliberty??? Yes, attachment to the idea of liberty, attachment to detachment!Whenyouunderstandthevalueofliberty,many timesyoutransformitintoanideal.Ideasandideologiesare alwaysdeadconcepts;theydontfollowthenewnessofevery instance.ApersonthatunderstandstheSciencewillneveradopt afixposition.Tochangeonesmind,whichinyourworldis oftenseenasabadthing,intheScienceitsseenasagreat liberty, the great flexibility that a person can possess. Every momentisdifferentfromtheother,everymomentasksfora differentanswer!Idontmeanthatyouhavetobechanging your mind every passing second, which would be very stressing. I mean that you should constantly reexamine what youthinkandaboveallelse,thatyoufeelandchangewhen necessary,andthatthisisnocauseforshame.WhatImeanto sayisthatinloveitsimportantthatlibertyandspiritualityare aboveallelse,butsometimesitsgoodtobealittlejealousand tolockyoutotheother! Now,Idontunderstandanything.Alittlejealousycanbegood?DidntYou saythatjealousywasaconditionedreaction? Most ofthetime, itis.Generallypeoplegetjealousbecause theythinkthatthepersonowesthemsomething,andthisisa conditionedreaction.Butthereisanothertypeofjealousy,the naturaljealousy. Naturaljealousy?

131

Yes,itsapureenergymatter.Letssaythatthepersonisliving agreatpassion,whichisagreatmeetingofenergies.Thereisa greatflowofenergybetweenthatpersonandtheother.And suddenlythisflowiscutoffbecausetheotherpersondecidesto directtheirlovingenergytoanotherperson.Inthiscase,the firstsensationthatthepersonwillnaturallyhavewillbeoneof absencethatwillmanifestitselfasstrangeness,sadnessoreven anger! Andwhatshouldbedoneinthiscase? Study the situation,andobserve.Understandthat,first,what youre feeling isnatural,itsanenergyproblem.Understand thatyoushouldnevergivetheresponsibilityforthistotheother person,becausewhatishappeningislikeanenergytestthat thispersonhastogothroughatthismoment.Fromthenon,the personcanfollowmanypaths.Thepersoncantalktotheother personaboutthiswhentheyhavetheopportunity.Dontrepress jealousyasifitweresomethingugly,confessyourfragility! The strongest love is the one whereyou can express all the fragility.Demonstratetoyourselvesandtotheotherthatyou wanttoovercomethis,anddosomethingtoovercomeit. Butdowhat? Unfocustheenergy.Inthebeginningitwillbehard,butwith timeyouwillbeabletomanageyourattentionbetter.Youwill emotionallyunderstandthatyoucreatetheworldyousee,or rather,everythingdependsontheperspectivethatyouadopt,or betteryet,onwhatyoudecidetofocusonateverymoment!If youwerefocusingyourenergyonapersonthat,bytheirown freewill,removedtheirfocusfromyou,respecttheirlibertyand removeyourfocusfromthatperson,thisinstance!Youcould goswimming,dosomethingbeautiful,meetotherpeople,and fill once again this lack of energy with divine energy, by reconnecting with Me. What I am saying is essential. In a passionateencounteritsimportantthatnoneofthetwopeople loosetheircenterfortoolong. Whatisthecenter?

132

ThecenteristheconnectionwithMe,itstheenergybalance. Itstounderstandandemotionallylivetherealitythat,atthe same time that you are interconnected beings connected and dependentonthewhole;youarealsoindependentindividuals that carry everything inside yourselves. Or rather, in the practicalsideoflove,itmeanstolivefullyallthatsurroundsus, without ever forgetting to maintain the balance inside yourselves.Likeamandoingthehighwireact!Thisisthebest imagetoexplainwhatyouwillachievespirituallywhenyou livewiththeScience.ThehighwireistheWorld,theemotions, thepassions,theeventsthathavetobelivedandfelttothemax. Butthestrengthtolivethemwithoutbeingdestroyedbythem insidetheperson,tobeinconnectionwiththedivineprocess! Buthowdoweendurethepainthatwefeelinthosemoments?Yes,because manytimesjealousyisvery,butverypainful! By observing and understanding the pain. As I said, in the beginningitseemsveryhard,almostimpossible,butwithtime andpracticeyoullbegintounderstandthatthepainisanatural process that you have to go through to go further. Whoever practicesasportknowsthis!Anathletethatwantstobehis best,orevenapersonthatwantstostayinshape,knowsthat shehastoendureadailydoseofpain.Inthebeginningthis seemslikeagreatburdenandnotmotivating,withtimethough shecomestounderstandthepainasapartoftheprocessof feelingwell,andevenlearnstoenjoythem! Isntthisjustalittlemasochist? No,masochismistofocusthepain,andgivecontinuationofit through thought. Pain is natural, jealousy is natural, but the importantthingisnottofocusonjealousyandtofocusonlove, or in well being,tohave patienceandpersistence, and keep going. Whoever does this will inevitably discover an unbelievablesensationofliberty,thatwillrewardhimforthe entirestruggle!Thetruesecretofsuccessorhappinessrestsnot

133

intheabsenceofpainbutintheenduringofpainfulstates.To livefully,asIhavesaidistoconstantlyovercome. Ok,IthinkIunderstand.Instretching,forexample,thishashappenedtome many times. There is a pain, which is natural because we are not very flexible.Toendurethispainandhavemoreflexibility,itsnecessarytobe verycalm,breathedeeplyandnotfocusonthepain.Itsreallylikethis! And everything in life obeys this mechanism, which is very simple. Yes.ButIdontunderstand itwhenYoutoldmethatalittlejealousyis good!WhatdoYoumeanwiththis? When a person frees himself from the pain, or rather when youremanagingthismechanismofchangeofperspectiveor changeoffocus,youcanstarttoplaywiththis.Orrathertries todefocustheirattentionandtheotherfeelsthatlittlejealousy, the other person might decide to focus their attention in a provocativeway,provokingalittlejealousyontheother.The gamesthatarepossibleindaytodayloveoftwopeoplethat areatthesametimefreeandcrazyforpassionareinfinite!You canplay,givingandhavingjealousy,youcanplayasifyou wereaccomplicesandtelleachotheraboutyourloversoutside therelationshiporevenofferyourselftotheother,youcan playasifyouwereonanisland,youcanlaughandgetsad, tremblewithfearandcrywithhappinessineachothersarms, andyoucanplaymillionsofgames!Andthereasonthatyou canplaysomuchisthatyouarenolongerafraidofloosing the other person, because you have such great faith and confidenceinlifeandloveandontheotherthatyouonlywant toplayandloveeachotherandactinapassionateway Themostinterestingthingisthatthislibertythatyoucancome tofeelgivesyoubackalittleplayfulness,yougobacktobeing children a little bit. The happy child plays and can make mistakeswithoutfearwhentheyarelearningbecausetheyhave fullconfidenceintheunconditionalloveoftheirparents.Thisis thewaythatyourlovesandyourfriendshipsshouldbe:fulland unconditional.ThatswhyJesustoldpeoplethattheyshouldbe aschildren,andthatswhymanyspiritualmasters,amongthem

134

theDalaiLama,hassomethingverychildlikeaboutthem.This happenswhenyouareconnectedwithMe. Butsometimeschildrenarebad! Theydomischiefinaninnocentwayandtheydontfeellike theyaredoingbadthings.And,whentheyreallydosomebad things,itsbecausetheyreconditionedbytheirfamilyorby what they see. Children are naturally good, and if they are raisedwithalotoflove,theyremainthisway. ButwhenIsay thatyouwillreturntobeinglikechildren,I clearlydonotmeanthatyouwillreturntothesamecondition youhadwhenyouweresmall.Imeanthatyouwillreachanew energyqualitythatislikewhatyouhadwhenyouwereachild! Lets say that you become children through the Science, or consciouschildren.Theenergyofchildrenislighter,itvibrates morerapidlybecausetheyhavelessconditionings.Theadult person that can recondition themselves emotionally, that illuminatesthemselvesbecausetheyunblocktheenergyflow, ortheLight,orMe,insidethemselves,acquiresanenergythat vibratesevenmorethantheenergyofmanychildren!Aperson likethisseemyounger,hastheenergytodomanythings,hasa goodhumor,isconstantlylaughingandplaying,buthealsogets emotionalandcries,orrather,heisaveryemotionalperson,he wakeslightandvibrant,andhasalotofenthusiasm. Wow!Thisisreallypossible? Yes,andyouknowthatitis.Youarewritingthisbookbecause you lived through strong energy changes, strong changes in perceptioninthelastfewyears. Yes,butwhenIaskYouitsbecauseIrememberthatallofthisseemed impossiblebefore,andeventodayitseemssoincredible,somagicalthatit justmakesmewanttolaugh.SometimesIlaughbymyself. YoulaughwithMe,mylove.Youareneveralone.Welaugh togetherandthatisverybeautiful.Iadoreitwhenyoulaugh,I adore it when you cry for love without despairing, and of course,Iadoreitwhenyouletyourselfdream,likeyesterday,I

135

adore it when you dance while listening to your little radio alone,andfinally,Iadoreyou. IalsoadoreYou.Youmean...youmeanthatyouwerentmadbecauseI didntwriteyesterday?Ididntwriteyesterdaybecausesomethinghappened whichreallymademedream,andIcouldntdoanythingelse,Icouldonly thinkofthat! Sheonlythinksofseeingmen... OfcourseIwasntmad.Iwasdreamingwithyou,Antonella,I amthemoreelevatedpartofyou,morevibrant,morebeautiful, understand? What would make Me upset would be if you decidedtoquitwriting,ifyouforgotaboutyourdreambecause offearorlaziness.Buttohaveapausebecauseofaromantic encounterisgoodandevennecessarysothatImayflowbetter insideofyou! Really? Ofcourse!Youareveryromantic,butveryromantic,andyou havetoliveoutthisenergytobehappy.So:livethisenergy! ButIdontunderstandthisverywell.Youhavetotalkmoreaboutlove!If possessionisnotagoodthing,isntromanticismanegativeconditioning? Doesntitencouragetheideaofpossession? Onceagain,everythingdependsonwhatyouwanttofocuson whenitcomestoromanticism.Thethingaboutfocusworksfor everything, absolutely everything that surrounds you, Antonella!Itsagreatthingtobegintounderstandthatyoucan seethesamethingfromdifferentaspects.Theromanticismthat isharmfulistheonethatbecomesanideal,theonethatmakes youwaitforprincecharming,toconferqualitiestohimand become angry when your boyfriend doesnt live up to these expectations. Therewehavethedeadidealkillingtheliving love.Tobecomelockedontoanideallikethiscanbevery frustrating for all the people involved, and you know that, becauseyouwentthroughanidealisticphase. Yes.Iwasterrible.

136

Youwere!Abore!Intheend,youimprovedalittlebit,thanks toMe. Knowitall! Notaknowitall.Butmarvelousnonetheless!(Laugher)Well, we continue. There exists a romantic emotion, that surges naturally, and after that everything depends on the way you focusonthisenergy.Ifyouareconditionedtoberomantic, youwillinevitablyfindyourselfinpositionofavictimoflove and you will despair. If, however, through the Science, you understandthatitsonlyamatterofdirectingyourenergy,if you are not attached to any form, well, in this case the romanticismcouldbeagreattool! Atool? Yes,anenergetictool.Iamnottalkingaboutthoseromantic clichs,thosesweettalesoflovethatarerepeatedoverandover andaresoldforapennyapiece.Iamtalkingaboutromantic craftsthatcanenrichtheromanticencountersthatwillincrease thesensualvibrationbetweenamanandawoman,whenthe romantic emotion is happening for both, of course. Use and abuse of them! Think romantically, give yourselves time to listentotheromanticmusicandthinkofoneanother,livethe romanticism,withoutofcourse,neverforgettingtomaintainthe dualperspective.But,Irepeat,theromanticismisagreattoolof passion. Canyougivemoreexamples? Thereareanumberofexamples.Whentherearetwo,thereare the infallible candle dinners, with the music that will make eitheremotional;orswimmingintheoceanatmidnight;orthat banquetontopoftheother;anycrazythingforlove.Dance together!DancingisoneofthebestwaysofcelebratingLife andlove!CelebrateLife;getenthusiastictogether,abuseofthe tools.Aboveallelse,lookintoeachotherseyes,kissandtouch each other a lot, laugh and cry together, and be together, independently of whether you make love or not. Use you

137

imaginations, for Me! Love asks for inventiveness, newness, craziness, enthusiasm, and it asks above all else that we do everythingforit!Everything,everystepisimportantforthesex to be transcendental, for the act of love to be more than a mechanicalact,forittobearealfusion. My,my,my. Whatisit? Iwanttogettogetherwithsomeone. Becalm,therightmomentwillarrive.Everythinginitstime.In factthisisveryimportant.ListentoyourHearttounderstand the proper moment for each thing.Onethingcouldbegreat whendoneattherightmomentandterriblewhendoneatthe wrongtime.Onceagain,asyousee,theScienceisessential. Ibelievethenthatwecangobacktalkingaboutsex.Afterall,thereisa momentforeverything;thereisatimetomakelove.OtherwiseIwouldnt behere!Canyouexplainwhenwecanrecognizethismoment?Howcanwe livesexandhavesexinthebestway?Howtousesextoelevatetheenergy andnotloseenergy,likethemajorityofpeopledo? Wehavealreadyspokenaboutmanyimportantthingsthathave tocomebeforefortheacttobeoneofquality.Letsgooverthe mainpoints:whenamanandawomanthatarepracticingthe dualperspectivemeetandunderstandwhattheyarefeelingfor theotherisinevitable,andhastobelived,thenthedancecan begin. And the dance begins before the touch! Before you touch,yourunconsciousregisteredeverylittlemovementofthe otherpersonthathasaspecificemotionalmeaning.Manytimes people will only realize this much later, and this generally happens when theydont practice the Science.Theybecome involvedveryhurriedly,withapersonwithwhomtheencounter isnotinevitable,andlatertheysay:Ishouldhaveseenthisor that;IshouldhaveunderstoodthatwedidntmatchButits possibletounderstandthismuchearlier.

138

Waitamoment.IamthinkingabouthowmuchIlikebeingwithanother, andIamthinkingabouthowitwouldbelikeifIhadalwayspracticedthe ScienceandifeveryonepracticedtheScience.Thesearchforqualitywould causepeopletohavemuchlesssex! Thatisso,infact.Orbetteryet,theywouldhavesexwithless peopleoverthecourseoftheirlivesandaboveall,theywould havesexdifferently.Maybe,ifwemeasuredtheenergythatwe couldachieveineverysexualencounter,wecouldsaythatwe wouldhavelesssexandwewouldmakelovemore. Butthatisterrible! Why? Becausetohavesexisgreat! Andsoiseatingacheeseburger. WhatdoYoumeanwiththat? Exactlywhat youread.Acheeseburgerisalsonice,isntit? Cocacola is also a nice addiction, so is drinking liquor and smoking.Iamnotsayingthatthesearebadthings;Iamjust sayingthat,whenyougoinsearchofquality,younaturallyget away from these things. Many people have to make a great efforttogetawayfromcertainthingsthattheystarttofeelas vices.But,whentheyreacharealconsciencethatthosethings arenotthebestthingsfortheirspiritsortheirbodies,itswhen consciencebecomesemotional,andperconsequence,physical. And then they simply stop wishing to do these things and discoverthatmanythingsarebetterthanwhattheyweredoing untilnow.Orrather,theychangetheirbehaviorwithoutforcing themselves. ThatswhyIsay:ifyouwanttochange,startchanginginside. Whenyoustrengthenyourselvesinside,youwillbehappyto livetheadventureofexperimentingbeingdifferentfromwhat youhadbeenuptonow. Andthisappliestosexaswell...

139

Yes.AsIsaidbefore,allofyouliveanervousandunbalanced life,youlivebombardedbyinformationofallkinds.Andas youwouldimagine,thisreflectsonyoursexualencounters.In thewesternculturethereisagreatvalorizationofsexinfilms, musicandpublication,becausesexhasbeenutilizedlikeany otherdrug.Allofyouhavesextoforget,havesextorelax, becauseitstheonlytimethattheystoptothink.Thismakes this practice become excessive, not very healthy, and uncontrolled. And as incredible as it may seem, it doesnt happenonlytothepeopleclaimingassingle,no,ithappensa lotamongmarriedpeople,manytimestheygetmarriedtomake anuncontrolledsexualpracticeofficial! What do You mean uncontrolled? Do You mean that married people shouldnthavesexanytime? Pay close attentiontowhat Iam saying.Wearenot talking aboutmorals,becausenothingisintrinsicallybad.Ifaperson wants to drug themselves, whether it be with sex, with marijuana,tobacco,wineoranyotherdrug,thatisherchoice, andwhatevershewantstodotoreachwhateveritisshewants toachieve,thereisnothingbadinthis.Theconsequencesof heractswillbebetterorworseinaccordancewithwhatshedid toherself.Everyonedoeswhattheywantandthisisthebiggest libertythatIgavetoallofyou.Butifwearetalkingaboutan emotionalvibration,ofadvancingspiritually,oftranscendental pleasure,ofenergeticorgasms,wehavetostartseparatingthe wheatfromthetaresorratherwehavetounderstandwhatis goodygoodandwhatthebestis. Sexshouldntbepracticedatanytime,becausethereisatime foreverything.Thereisanintrinsicclockinsideallofyou,and topracticesex,thehandshavetobepointingtothesamehour atthesametime.Andthis,ofcourse,generallydoesnthappen inallthehoursofthedayandnoteveryday.Forthepeoplethat practicetheScience,thisisntadisaster,andthereasonisvery simple.WhoeverpracticestheSciencedoesntdependonsex anymoretofeelbetter.Twoimpassionedpeoplethatpractice theScienceworkwiththeenergytoconstantlyfixthehands oftheclock,orrather,withpatienceandperseverancetheyare

140

alwaysplayingsensualgamesanditwilleventuallyleadtheir bodiestomeetagain,sensually.Isaysensuallyonpurpose, becausewhoeverdevelopstheconscience,endsuplosingfocus onthegenitalsandunderstandingthattheactofmakingloveis afarmorevastthatthemeremeetingbetweengenitals. Attention!Iamnotsayingthatsexisntsomethingvitaland important,butitisntmoreimportantthananyotherthing!The Scienceteachesthat,everything,butabsolutelyeverythinghas importance; every step is vital and has to be taken with the greatest care and reverence. A person that seeks quality and livesalifethatisfilledwithquality,sheenjoyseverymoment andshedoesntmisssex!Whenshehassex,itsbecauseof abundance, because the glass of wine is so full that it overflowsnaturally,itsbecauseitsabsolutelyinevitable,its becauseshefeelstheundeniablecall oftheGoddessorLife insideofher,andonthatmoment,andonlyatthatmoment,she consciouslyacceptstolosecontrol. Listen,ifpeoplewouldbegintounderstandtheprofoundnessof this message and would start to change their consciousness, soon the sexual diseases would diminish and contraceptives wouldbemadenaturally,withouttheneedoftakingthem! What??? Justwhatyouread.Aworldwithconsciouspeoplewouldnt have the problem of unwanted children or accidental conceptions. But,ofcourse,allofyouarestill farfromthis reality.Letstalkaboutthestepstoeventuallygettothis. Waitaminute;Youhavetoexplainthisbetter!DonttellmethatYouarein accordancewiththerulesoftheChurchinrespectstocontraception! IdonthavetobeinaccordancewithanythingbecauseIam everything.Andreligions,Ialreadysaidthattheyhavesome goodideasbutthattheytransformthem,theideas,intodogmas. WhenItalkaboutnaturalcontraception,Iamnottalkingabout prohibitions,andnotevenofsin,ormoralrules,Antonella!I amtalkingaboutenergies,ofyou,ofyourenergies,andofthe best way to manage them to have a life with the maximum pleasure. Thats it! A life of pleasure! I am only trying to

141

expandtheperceptionandthefocusinallofyoubysayingthat the biggest pleasure is not genital, its a total pleasure, that when well managed, sometimes, and only sometimes will manifestitselfgenitally. Sorry,littleGoddess,IdidntmeantooffendYoubysayingthatyouagreed withtheChurch. You cant offend Me, much less with that. The Church did manygoodandmanybadthings,likeallofyou.Observethis and you will see that all the institutions created by you are reflections of how you are like humanly. The day that you evolve,yourinstitutionswillevolve,andyoumayeven,some day reach the blessed day in which they are no longer necessary.So,youcantoffendMe.ButyoucanirritateMe! Thankyouforsayingyouresorry.Shallwecontinuewithyour favoritesubject? Yes,please. Whenyoustarttolivebypracticingthedualperspective,aswe said,youstarttoenteranewlevelofperception.Everything seemsmoreinteresting,everymomentismorealive,andmany timesyouwillhaveanormalday,wherenothinghappensbut youwillhavethesensationthatyoujustwentthrougharich day.Thisisbecauseyouwillbegintounderstandthatthereal treasureisinthemoments,therealtreasureisemotionsand sensations!Observethisandyouwillpassthedayfeelingall differentkindsofemotions!Whenyoubecomeawareofthis, youwilldiscoveranewuniverse,richness unboundedinside yourselves,andthisisaremarkablejourney. Peoplethatmeeteachotherunderthiskindofconscienceand becomeimpassionedperceiveeachmomentofpassioninside themselvesandtheytakepleasure.AsIsaid,thedancebegins before the touch, and this is a very important truth. Two consciousandfreepersons,thatunderstandthevalueofeach moment,thatrespectlibertyaboveallelse,twopeoplethatmeet likethiswillperceiveanincredibleenergyinoneanother.They know,theyknowbecausetheyfeel,thateverythingemotionally

142

thathappensisnotbychance,andeverythingthatwillhappen dependsonhowtheyfocustheirownattention! This is how the dance starts: sometimes they focus their attentionononeanotherandtheywilllettheflowofenergy happen.Theeyeswillmeetandtheenergywillflowbetween them.Sometimestheywilldefocustheenergytorecuperate theirowncenter.Everyonewillhavetheirownrhythminthis dance,andsotherhythmsstarttointeractfromthebeginning, youshouldrespecttherhythmoftheother.Observecloselythis processofgettingcloserwithapersonandyouwillunderstand that the energies of each person flow like the waves in the ocean.Attention!Sometimestheenergiescanrecedeforweeks ormonths!Butiftheenergyconnectionisrealandinevitable, they will inevitably return. Because, without forcing it, with muchcare and subtlety,onewillfeelfortheother,onewill searchfortheotherandviceversa. People that arent familiar with the Science start to lose themselvesintheinitialmoments,becausetheygettrippedup on the dance. They get out of control, and if we were to compareballroomdancing,wecouldsaythattheystarttogetin each others way, stepping on each others feet, etc. Every action,everygesture,everymovecountsinthedanceoflove. Unfortunately,allofyoupaylittleattentiontothedetails.So, whenyourfeetarecoveredinsoresfromsteppingallovereach otherandyounoticethemandpartbecauseyougetangry,the truthisthatthethingtoblameforyoursoresisyourownlack ofattentionthatis,beverycarefulandattentiveinthedance oflove!Overcomethefearandriskgettingcloser;overcome thelackofcontrolandretreatfromtimetotime.Wearetalking aboutadancethatisverysubtle,butwhenitswellpracticed, andaboveall,wellobserved,itwillbeofabeautyunmatched. Andyouknowthis,becauseyourmostbeautifulsongs,your most incredible movies, your best books and your biggest dreams aregreatlovestories.Knowthis:everyonecanhave them!Itdependsonlyonyou!Itdependsonhowyouliveout yourownenergies!Themoreyouknowhowtodancealone to the music of Life, the more you vibrate, the more your

143

physicalbodieswillvibrate,andthemorepreparedyouwillbe foratranscendentalenergyexperiencewithanotherperson. Youarealwaystalkingabouttheexperienceorsexthatistranscendental. Whatisthis? Its the emotional experience of the activation of the energy insideyouthroughsex.Inthemomentwhentwopeoplecan meetwithalltheir chakrasopenandcanreachasimultaneous orgasm,youelevatethevibrationinaveryconcreteway.The greatmeasurementofgoodsexiswhathappensafterwards.The goodsexistheonethatfillsonewithpassionatelove,itmakes onelaughout,tograbtheotherperson,torubyourselfagainst them, to never comeungluedfrom them,toplaywiththem, dancewithher,docrazythings,goodsexgivesanincredible energy. Transcendental sex can even open the door to extra sensorial perception! The sensibilities change, intuition becomessharper,andunexpectedthingsstarttohappen.The uselesssexisthekindthatdrainsyouenergetically,leavesyou feelingdead,tired,anditsoftensthesensibilities,andmakes you want to get away from the other and go wash yourself afterwards. I am not saying its bad, because sometimes its better to have an encounter such as this instead of isolating oneselfandhavingnoencounteratall.Butwhenyouarewell maintained spiritually, when you no longer feel alone, when youcanvibratenaturallydaytoday,youwillbegintoavoidthe automatic sex, or rather, look for the transcendental sex. Besides, its not possible to avoid doing something automatically.Ifyoucanobservetheautomaticgestures,and whenyoucanstarttonoticethem,onlythenwillyoubeableto doeverythingconsciously,orrather,everythingwillbedone withattention. Whenyouarehungry,forexample,youwilleatwithattention. Orrather,observehowyoueat,howyouholdyourutensils, howyousit,howyouwalk,howyoubreathe,howyoutalk, howyouinteract,andaboveall,howyoufeel.Withtimeyou willstarttonoticewhatyoucandobetterandyouwilldoit naturally.

144

Whenyourelatetootherpeople,takenoticeofhowyoutouch, andtoucheachotherwithattention.Or,ifyoudonttouchor look at each other because of lack of attention, touch one another. I repeat: every gesture counts; every movement determines your destinies. A kiss given without the proper attention can start to kill love little by little, a lack of enthusiasmwillkillthepassion,anemptinessinyourlookswill draintheemotions,poorsexwilldestroytheconnection.And soforth.Ifyounoticethesubtletyandtheimportanceofthe details,everythingchanges. Wow, thats true. If I remember all my love encounters, I can say that attentioninacertainwayconnectedintenselythemomentsbetweenme andthemanIloved.Thelackofattention,whetheritwastheirs,orminecut thelinkthatwascreated.Yousaidthatthedanceoflovebeganbeforethe touch.Whatexactlydoyoumeanbythis? Exactly.Itbeginslongbeforethefirsttouch.Apersonthatcan observe well will start toenjoythepleasure of touchbefore touchingtheotherperson,becauseintheinteractionbetween bodies,words,andglancesistheplacewhereallthesecretsof the dance reside. Whoever observes knows how to feel the sexualvibrationbeforeactualsexhappens.Ifyoucanplaya game of seduction, and be able to make each other vibrate withouttouching,andifyoucanmaintainthevibrationwhile youaregettingcloseranddrawingawaywhennecessary,the physicaldancewillinevitablybeincredible.AndIlltellyou this:thebiggestpleasurebetweenmenandwomenisnotinsex. Thebiggestpleasureisthecourtship!Itstolookateachother, touch,seduce,love,toplay,tolaughandcrytogetherandall thethingsthatmeantocourt.Whenthecourtshipisofhigh quality, sex comes along to consummate the dance, but its neverthemainpoint.Peoplethathavelovedeachotherwitha great intensity know this. The courtship is a great thing, courtshiprenews,courtshipgivespleasureandpainatthesame time and courtship is the most elaborate dance. Observe the passion within yourselves, let it express itself, that it be creative,letitinventitselfwithouttryingtogiveittheformof

145

sexorwhateveritmaybe,andyouwillseethatitwillmake youcourteachotheralot! ButYouaretalkingasifsexhardyeverhastohappen! Onthecontrary,whenyouarewitheachotheralot,itwillbeso intense,thatyouwillfeelasifyouaremakingloveallthetime, evenwhenyouarentdoingit!And,whenyourbodiesmeet, youwillvibratesomuch,youwillhavesomuchenergyand attentiontoeverymomentthatyouwillbeabletostretchout thelovemakingforhoursorevendays! What??? Thatsright,mydarling.Whoeverlivesconsciouslycanstarta sexual act one day and end it the next. Or not end it at all because of so much pleasure! Whoever wants to reach that quickorgasm,doesnotloveattheirmaximumatthatmoment, theyarenotlivingoutthehighestenergiesofthepassion.To liveitout,youonlyhavetostrengthenthecontroloftheflow andebbofenergies.Forexample,bothofyoufeelexcited Enjoyit!Observe!Dontdirecttheexcitement;dontfeellikeit hastoleadtoanorgasm!Substitutetheideaoftheorgasmfor theideaofthenearorgasmThemomentsthatprecedethe orgasm are always more delirious than the orgasm itself. Multiplythesemomentswithyourwillpower!Yes,youhaveto havemoreofthesemoments,toincreasethetension,toexpand the vibration. Play, use your tools of seduction, excite each other,courtoneanother,andfinally,dance!Ifyoulearnhowto courteachotherwell,toexciteeachotherwithouttouching,to touch each other without reaching a conclusion, you can go days and days feeling horny! Just imagine the force of the orgasmthatisstalledinthisway! Wow...Thisalreadychangeseverything.Thisgivesmealotofmotivation topracticetheScience!Butitmustbehardtofindpeoplethatliveoutthis! AndthisisthereasonthatIamsayingallthesethings.The Worldhastoknowthis!Youalwaysassociatespiritualitywith astateofsterilityandabstinenceIamtalkingtoyoutodayso

146

youwillunderstandthatitsnottrue,itwasabadinterpretation ofMymessages. Itstruethat, asIsaid,thatthepersonthat connects with Mestarts livingout the maxim that quality is betterthanquantity.Thatisreal.ButIdontmeanthataperson hastocultivatesadness,sacrifice,andabstinencelikecertain religiouspeoplebelievedtobethebestway,anditdefinitely doesntmeanthatthepersonwillfeelless,loveless,enjoyless andendupeatingwindandturnintoawanttobehippy.On thecontrary,thisisjustthepaththatwillleadyoutofeelmore! More taste, more pleasure, more sexual excitement, more happiness, more enthusiasm and in the end, more vibration! Andeverything,Irepeat,everythingdependsonthelevelof attentionthatyouinvestintheactoflivingeveryinstance. Youtalkaboutitasitwereeasy! Yes,itssimple,butitsnevereasy.TheWorld,Life,andIare complexsimplicity,simplecomplexity.Iftolivewaseasy, whatfunwouldthatbe?Whenyouarechildrenandyoulearn something,younaturallyseekoutsomethingnewtolearn.You arenotafraidofthedifficultyoflearningtowalk,rideabike, andmakeendlessmischief.Toliveistofullyunderstandthat every moment hides a new challenge to be overcome. Only when you becomeadultsdoyoubegintopracticetheawful habit,awfulnotbecauseitsbadbutbecauseitleadsyouto stagnate,tobecomeoldinside,andworstofall,toturnyouinto bores,whothinkthateverythinghastobeeasyandsecure, thatareinfacttwoperspectivesthatarecompletelyillusionary andthatdontcorrespondtotherealityoflifeandtowhatyou unconsciouslywishfor! Speakingofthis,Youremindedmewestillhaventelaboratedmuchonthe subjectofformsinhumanrelationships.Ifonelooksforeaseandsecurity, itsnotthebest thingforourdevelopment,whatcanbesaidthenabout marriage?Yousaidthatformsareillusionary,thatwecanevenadoptthem butwecantgetattachedtothem.Howdoyoudothisinmarriage? Isaidthatyoucangetmarried,orlivetogether,andyoushould doitatleastonceduringyourlife,because,ifyouliveoutthis experience fully, its one of the biggest schools, its a great

147

challengewherenothingcomeseasy,eventhoughitsbeautiful. Youweretheonethatsaidthatitwasthemanthatyoulearned themostfrominyourlife. Yes,itwasinfact.Oneboyfriendremindedofsimplicity,anotherofliberty, anotherofmagic,anotherofsensibility,andfromeachalittleofeverything. Everyencounterinvolvedstrongpainsandpleasures.Thedeeperormore intensetherelationshiporencounterwas,themoreIlearned. Verywell,youunderstoodthegreatvalueinloveencounters forthespiritualdevelopment.Neverforgetthisdeeperreason forfindingyourselves!Youfindyourselvestohelponeanother advanceinthepathofLife.Ifyoumaintainthedualperspective always,youcanadopttheformthatismostappropriateforthe moment.Thisformcouldbemarriage,concubinage,friendship with benefits or having a boyfriend, and the manner chosen couldbe,inturn,libertyorsexualfidelity,orwhateveritmay be, but never get locked up in forms! Understand that true fidelity,theonlyonethatisbeyondtimeandanyform,isthe fidelitytooneself,thefidelitytowhatyoufeelanddream.If bothpracticethiskindoffidelity,youwillbenaturallyloyalto one another, without meaning that you will maintain theso calledsexualloyalty. Thebestthing,whentwopeoplegettogether,orgetmarried,is tounderstandthatwiththisacttheyarecelebratingthemagicof thatandeverymoment,thatyouareunitedtohelpeachotherbe happier,andyouhavetocomebackandstudythisdecisionand celebrateit,everydaythatpasses!And,Irepeat,ifyouchange yourmindoryoufeeldifferentlyaboutanything,talkaboutit and dont feel guilty! Even though sometimes it might be painful,changeistheintrinsicmovementoflife.Andattention! Besincere!Notbecauseofmorality,butbecauseitsamatterof energy.Whoeverliestotheotherislyingtothemselvesand theyareblockingtheflowtheiremotions. Butsincerityissohard!Itsveryhard,whenyouhaveapactofloyalty,to confessthatsomethingchangedinside,because,forexample,ifweseean interesting person that arouses some kind of desire in us! Its difficult

148

because,generally,whenthishappens,westilllovethepersonthatwelive withandwedontwanttolosethemorhurtthem. IntheSciencenoonecanhurtanyonebecauseeverybodyis responsibleforwhattheyfeelandeverythingthathappensto themandnooneelsecanberesponsibleforit.IntheScienceno onelosesanyonebecausenoonepossessesanyoneelse. Readtheaboveparagraphwithattention,howevermanytimes itsnecessary.Whenyouincorporatethesetruthsemotionally, youwillfeelagreatlibertybecauseyouwillnevergiveanyone the responsibility for your happiness or unhappiness. And regardingsincerity,ofcourseitshardtobesincere!Andabove allitshardtobesincerewithoneself!So?Rememberwhenwe justtalkedabouthardship?Toavoidthedifficultthingthe majority of you live in a cowardly way and you get into cowardlyrelationships!That,ofcourse,consequentlybecomes moreandmoreunsatisfyingastimegoesby,andyoupretend thatyoudontknowwhy.Becauseyouarelazyandfoolishin love! Illsaythis:dosomeemotionalexercises!Confesseachdays secrets,overcomepainandthedifficulties,increasethestrength of the heart muscles, and work on the flexibility of your perspectives, live different relationships! Live out all the momentsfully,andwithallthefreedomyoucan!Ifyoudecide topracticefidelity,actinaccordancetothat,butifLifecallsin anotherdirection,respectandacceptthecallofLifeinyouand intheother!Observe!Dontjudge!Dontbeinahurrytogo back, dont act on pride! Love the other as you would love yourself!Notmoreorless.Understandthatthiskindofthing canhappentoonesideortheotherandthereisntanythingevil inthat!Ifsomeonedecidestoloveonlyonepersonandthey suddenlyfindthemselveslovingtwo,whatstheproblem?Why areyouallsopoorheartedthatyoucantconceivetheideaof lovingtwopeople?Whenyoubecomeawarethateachoneof youareaWorlduntoyourselves,youwillunderstandthatits almostnaturaltolovetwopeopleItslikelovingtwocities, two countries, two completely different dishes! Its perfectly natural,insteadofwantingtoeatbeanseveryday,tohavethe

149

desiretodiversifysometimes,eventhoughyoulikebeans!In lovethingsarentmuchdifferent Understandalsothatallofyou,atthesametimethatyouare uniqueandspecialbeings,youarepartofabiggerWholeand thatyouareinterconnectedtothisWhole.Youstillhavetoact inaccordancewithyourconscience;youalsohavetofollowthe designsoftheWholewithwhichyoufaceyourself.Ifallofyou andLifeworkforanencounterwitharightperson,itsbecause thisencounterisnecessary,independentlyofthewayinwhich youarelivingyourlifeatthismomentinyourLife! Wow!AreYousayingthatYouareinfavorofadulteryandpolygamy? IamnotinfavororagainstanythingbecauseIameverything.I dontwanttokeeprepeatingmaximshere,darling.Polygamy, bigamy,monogamy,heterosexuality,homosexuality,etcwhat difference does it make? The important thing is the deeper meaningthatleadstooneofthese,theimportantthingisthat you meet one another, that you love each other, and that it makesyouvibrateandgrow.Themoreyouloveoneanother, thebetter.Payattention,Iamnottalkingaboutsex,Iamtalking aboutlove.Dontrationoutlove!Now,becarefulwithsex.The majorityofyoudontevenknowhowtoloveyourselvesand youarentcapableoflovingthepersonnexttoyou!Inthiscase, sometimesitsbettertoresolvethisfirstbeforeyoustartonany newromanticadventures. Sometimes?Doesthatmeanthatsometimesitsgoodtocheat? Not good. Sometimes it can be excellent. Energetically speaking,ofcourse. WhatdoYoumean???Wow,Youareputtingallthevaluesinwhichwe wereeducatedwithdown... Yousaidthatwell,withthevaluesthatyouwereeducatedwith. And,becauseofmentalandaboveallemotionallaziness,you neverthoughtofquestioningthem!ThereareAfricantribesthat werealsoeducatedtocuttheclitorisofawomanandyou thinkthatsabsurd.AndifIsaidthatmanyofthethingsthat

150

youwereeducatedonaresimilarkindsofmutilation?Well, observeyourrelationships,observewhatyouaredoingtoone another,andadoptthedualperspective!Youwillunderstand thateachmomentasksforanewvisionandthatyouhaveto starttounderstandthatyouhavetobemoreflexible.Youasked if cheating is good, in the terms that you used you demonstrated the cultural conditioning of possession of the other and the invasion of propertyLets change the term. Letscallitlovingmore.Andmyanswerisyes,thatitcan begoodtolovemore,eventhoughitmightbedifficult.Yes, ifitswelldone,yes,ifitsdonewithsinceritytoallthepeople involved,yes,iftheencounterisinevitable,meetingsofHearts, anencounterthatwillmakeyougrow. Observe! Observe a marriage in which, because of lack of attention,thehusbandandthewifedonthavemuchtastefor oneanother, theynolongerhavedesiresforeachother,and suddenlythereisathirdpersoninthestory.Oneortheother finds a lover. Observe how the vibration of this person increases,howshebecomeshappierandmorebeautiful!Ifyou aregoodobservers,andyoulivethroughthisenergychange, youwillunderstandmuchaboutit. First,ifyouaretheonethatislovingmore,startwondering whyyoudonthavethisemotionwiththepersonthatyouare with.Observetheenthusiasmthatyouhave,thecreativitythat youputintoeveryencounterwithyourloverandstarttoapply thistypeofenergyinrelationtoyourhusbandorwife.Andyou willsee!Inthiscase,anextraconjugalencountercouldbea greatspicetoarelationshipthatwasdormant! And,ifthereissincerity,itcouldbeagreatopportunityforthe onethatissupposedlybeingbetrayed,whichisalsoaterrible term;letssaytheonethatislovingless.Hecancometosee hiscompanionwithneweyes,hecandiscoverincrediblethings abouthimself,hecanstudyhimselfwhatishappening,andhe canevenopenhimselftotheworld,andwanttolovemore himself! The third person or the lover has also to learn from the encounter and figure out if it was a true love encounter... Withouttheformofmarriage,helivesoutalovecompletely

151

basedontheintensityandmeaningfulnessofthemoments,in truthhelivestheessenceofloveandpassion,whichisakindof energybeyondallformsandthisenergytransformsitselfwhen weopenourselvestoit.Ifthisperson,afterthefact,wantsto adoptaforminarelationship,hewillbeabletorememberand practice what was done with the encounter with his lover whateverwasdonetoincreasethevibrationofhispassion. WhydoYoucalltheextraconjugalrelationships,lovingmore?Whatdo Youmeanwithwhoeverisloyalsexuallynecessarilylovesless? No, I mean that in this specific example, this is the case. Husbandandwifearemakingthemselvesvibratelittleandthey needanewenergytowakethemfromtheirenergyslumber.All ofyouneedurgentlytolovemore,anditdoesntmatterwhich way!Rememberthattoloveisenergy,itsavibration,andthe more youlove, themoreyouvibrate.Andthisisallofyou intrinsicallywishfor:tovibrate.Youcanvibratebylovingone person,ormorethanone,youcanandshouldvibratealone,and this is something you have to look for every moment that passes! Sotheideaofconjugalfidelityissomethingcompletelyabsurd? No.Oryes.Orboth.Theimpositionofsexualfidelity,fidelity asaruleisabsurd,itsamutilation.Butthereisanothertypeof fidelity that can exist, and its perfectly healthy, which is a naturalfidelity,theonethathappenswhenyoufeelcompletely besidesomeone,andyoudontfeeltheneedtopracticesensual lovewithothers. Weshallsaythenthatitsastatethatmanyconsidertobeideal. This is, on one side, a romantic conditioning, because sometimesitiswhatyouthinkyouwantbutyoudontwishor feelthisaboutwhoyouarewith.Manyofyouwouldbemuch happier if you accepted that, naturally, you could love more thanonepersonatthetime!Therecouldbemanyreasonsfor this,amongthem,forexample,becausetherearemanypeople intheworldthatdeservetobeloved!Forothersitcouldbethat

152

theydiscover,throughastudyofthemselvesthatsexualfidelity is the natural state, and its what you naturally feel for the personthatyourelivingwithatthemoment.Therecouldbe manyreasonsforit.Forexample,itcouldbethatbothfeelso emotionallyandsensuallyfulfillednexttoonepersonthatyou dont have any other sexual desires. Truthfully, its only possibletolovefully,tolovewithbodyandsoulonepersonat eachmoment.So,thesensuallovethatisthemostvibrating,the one that reaches the highest levels of vibrations, isnaturally loyal.Attendtothis,itsloyaltothemoment,beitshortor long,totherealencounter,itsloyaltothemomentinwhich youarefocusingyourenergiesononeanother.Inthismoment itsloyal!WhoeverpracticestheSciencelives inthepresent momentandunderstandsfullythemomentsandthechoicesthat aremadeineverynewmoment.Onlywiththisunderstanding willyoubeabletoreachastateofbalanceandperfection. DoesthatmeanthatwhoeverpracticestheSciencewillrarelymarryormake anyplansforthefuture? I didnt say that.The person that practices the Science does anything that anyone would do, anything that strikes their fancy,andtheywilldoitbetter.Sheunderstandsthatitsnouse thinkingtoomuchaboutthefuture,thatthefuturedependson eachstepwetake,onhowwefeelateverystep!Ifyouwantto achievesomething,youknowthatthethingwillfullydepend on how its going now, how you act, how you focus your energy, how you think, and how you feel. Act now as you wouldliketobeinthefuture,adoptrightnowthequalityof energythatyouwanttohavewhenyouachieveyourgoals!If youdothis,thedreamswillnaturallyberealized.Awiseman thatyoucallKrishnamurtisaidaveryintelligentthing:The future is now. And thats very close to what it is. Another phrasesays:Whateverhappensisawebspunbyus. Observe!Andyouwillunderstandthateverymomentthatyou live is material for the next step that you are taking at this moment you are making material for the steps that you are going to take! So, whoever who wants a relationship with sensualfidelity,theycantbelazy,youhavetohaveconstant

153

conscienceofwhatyouwantandbereadytoinvestdailyona veryhighlevelofattention,romanticismandcreativitytowards therelationshipthatyouarelivingthroughtoachievethat. Wow!Youaretalkingaboutsuchcrazyandinterestingthings! Thankyou.ItalkaboutwhatIam. Yes, You are crazy, interesting, marvelous, and finally a Goddess...How cool! Itsreallyverycool. Andso...modern! Verymodern. Itsapitythatparentsdonttalktotheirchildrenlikethis,inawaythatisso openandclear,andaboveall,flexible. They dont talk like that because they cant talk like this to themselves, because they are still badly resolved. We are workingheresothateverythingwillchange,sothattheWorld willchangenow.Because,weknowthatthisisurgentandthat this transformation will only happen when people start to change internally. The Worldis a reflection of howyou are inside.ChangeyourselvesandtheWorldwillchange.Itseems incredible,butitslikethis. So,wereturntothemotoroftheworld,wereturntothechannelinwhich lifeisborn,returntosex,please. Ofcourse.Wereturntosex. Ifsexcangeneratelives,ifeverythingthatwedoandhowwedoitforms theWorld,thequestionthatcomesupis:howdoesonehavesex?Because, intheend,itsagreatresponsibility! Toliveisagreatresponsibility,agreatpresent,agreatgift.Ask yourselves:whatisamiracle?AndIwilltellyou:ToLive.To liveisthemiracle.Andwhatisart?Artistoknowhowtolive. Itsuptoyoutobeconsciousofthisateverypassingmoment. Ifyouhavethisconscience,lifebecomesagreatjourney,the

154

greatestofthegreat,anexcitement,abeautifulinsanity.Ifyou donthaveit,manytimesyouconformyourselftocarryinglife likeacross.WhydidJesusdieonthecross?Observethestory andyouwillbeginthesymbolicvalueinalltheevents!Ithas alwaysbeensaidthatJesusdiesonthecrosstofreehumanity fromtheirsins.Whatdoesthismeanenergetically?Thecrossis thesymboloftheweightweallcarryinternally,yoursins,or rather,youattachments,yourconditionings,yourguilt,andso forth.Jesus,apoormanthatwalkedthestreets,becameknown because helivedanddiedtalkingabout love.Theenergyof lovefreedhimfromthepainofthecross,theenergyoflove madeitsohismessagesurvivedformillennia,andonlylove canfreehumanity,orrathereachandeveryoneofyou.Every one of you is humanity. Free yourself from your cross, free yourselffromthekarmiccycle!Themomentthatyouhavebeen waitingforhasarrived!Gobacktoparadise! Exists?Soparadiseexists? Hereandnow.Paradiseisinsideeachandeveryoneofyouand soishelltoo. But,Imean,thereisaplacethatisnotthepathtoperfection,orasYousaid, aplacethatisalreadyperfect? Of course, otherwise the game wouldnt be any fun. By practicingtheScienceallofyouaregoingbacktherebecause youcomefromthere.Itsnotaboutaspecificphysicalplace, althoughthereareotherplanetsandothercivilizationswhere suchaplaceisconstructed.Paradiseisavibration,aspiritual energy, an eternal energy that exists in all of you and in everythingyoucreate.Sotogobackthereyouhavetofeelit insideyourselves.Untilyoureachthatstateinyourphysical existence,youwillbelockedinthegame,oryoucouldseeitas followingtheUniversalLawthatuntilyoufreeyourselvesor reachtheConscience,youwillhavetobebornanddieandbe reborn as physical bodies as many times as its necessary. Throughthexnumberoflives,youwillstepbysteprediscover theplaceyouareheadedorrathertheplacewhereyouare

155

from.Butdontworry.Soonerorlatereverythingwillreturnto the place. In the case of hell, its nothing more than an illusionofMaya,whomIvealreadyspokenabout.Whileyou areimprisonedbyher,untilyoucometounderstandthedouble perspective,youwillalwaysliveinahell.Oryoucouldseeit asvibratinginakindofenergythatisheavyanddense,which willinvariablycausesuffering.Increasethevibratinglevelin yourselvesandyouwilldiscoverparadise!Itsverysimple! Itsverysimple.Letsswitchtopicsforachange. Everythingisconnectedmydarling.Andifwespeakofgood sex,weareinevitablyspeakingofparadise. Whatdoyoumean? When love is manifested in all its reaches, physically, spirituallyandemotionallyorasthePassion,itsadirectpathto the kind of high vibration that we have been discussing all along.Thatisexactlywhatyouaresearchingfor!IfIamLove, ifIamMusic,livetheLove,dancethoughLove,beLove,and youwillfeelGod,andyouwillfeelinparadise. Ok,manymysticssaythat.AndasasongIknowgoesEverythingisgood, everythingisalright,butIreallyratherhaveyou...naked! Knowitmyturntoask:whatdoyoumeanbythat? NowitstheGoddessaskingmesomething!Finally!IthinkIamgetting goodatthisSciencething...IamevenplayingwiththeGoddess!WhatI meantosayis easy,eventhoughitsdifficult...(laughs)Everythingseems good, all of these things sound very beautiful, love is the best, love is everything,butnooneknowswhatitmeans!Otherwise,dontYouthink that everybody would be living like that? Really, dont You think that everyonewouldbedelightedtowalkaroundfeelingontopoftheworld, almost cumming, dripping with excitement for Life? I think so! But the problemisthatthewisemensay;LoveoneanotherorLoveisbeautiful! Thisisallveryemotive,butitdoesnotsayanything!HowcanweLIVE thesethings???How?LittleGoddess,IfeelasifIspeakforallthepeople outtherepullingtheirhairsout.Wearetired.Peopledontjustwantto

156

eat,asanothersonggoes!Wewanttovibrate!!!Pleasebemoreclear,talk tousaboutpracticalthings,talkaboutsexandloveandthedevilonfours!!! Oronallfours... Youarereallysomething,arentYou?Youaremakingfunofme. Ilikeseeingyougetallworkedup,itstrue.Anddoyouknow whyIlikeit?Becausetimehascomeforyoutorevolt!Letgo oftherevolutions.Itwasallveryfun,ithelpedmuch,butitalso created much confusion. You all almost blew it all up! My darling,mylove,calmyourself.Whathavewebeendoingsince thestartofthisbook?IamhereteachingtheABCsofloveto youallandyoustillcomplain?Iamnotinthemoodtotalk abouttheories,youruniversitiesarefilledwithpeoplethatjust talk and never act, I am talking about the exercise of love, practically,hereandnow.TheonlythingIcantdoandnot becauseitsnotpossiblebutbecauseallwouldntlikeitisto learnthingsforyouandtoloveforyou.Youallhavetoreach thatstateonyourstrengths.Iamtheonewhoguides,Iamthe onethatleadstheorchestra,buteachoneofyoumustplayyour instrument with perfection, understand? And to play with perfection,ittakesalotofwork;thekindofworkwithouteffort thatanartistknows.Iamtalkingabouteffortbecausetomake anyheadway takesmuchwork,lotsofenthusiasm andfaith, and I speak of effort without effort because as soon as you realizethatyouaremakingheadwayyourealizethatyouare getting closer to what you really are. You all are made to vibrate,youaremadetobehappy,andwhenyouarehappyyou becomemusiciansofLife,whenyouarehappyyoufeelpartof theorchestra.Youareasachildwhocrawlsontheground,but werecreatedtowalkandrun. Well,letstalkaboutsexandpassion... Yes!Yes!Yes!Rememberthatlittlejoke?Sex?Iamout!Iamin,Iamout, Iamin... Youareveryanimated...

157

Ofcourse,Iwanttoflirtandkiss!ButdontYouworry,Iamtryingtolook forquality,Iamobservingmyselfandobservingthosethatcrossmypath,I amtryingtounderstandthatthetimewillcome,ifYouwantit,ifYoudont screwmeover... Me?! You dont think I notice that sometimes You make things happen in a certainwayjusttoplaywithme? DontforgetAntonella:Iamyou.Everythingthathappensto you, it was of our own making.Inregards towhat yousay aboutlookingforquality,well...SometimesIhavetogiveyou a little hand and move you away from certain things, otherwise... Yousometimesinterfereinevents?Doguardianangelsexist? Ofcoursetheyexist!Andtherearemanymoremanifestations thanyouimagine!TheUniverseismuchbiggerandcomplex than you comprehend. If your dimension includes so many kinds of visible energy, imagine the number of invisible energiesthatareoperatingaroundyouatthismoment!Butthis kindofinterferencecanonlyhappenwhensomeoneisopen toit,whentheydesireit,evenifitsunconsciously,somehelp, andwhenyoudontneedacertainexperiencetoadvance. ThankYouforthehelp,eventhoughsometimesIdonteventnotice. Younoticedandhavebeennoticingthem.YouseewhenIdraw you away from something that could harm you. You have becomeveryobservant,andyouarepracticingtheSciencewell, youareveryattentive.Congratulations.Just dontgetfullof yourself! Fullofmyself?Thatwouldbeashame... Youarenotfreefrommakingmistakes,remember?Youcan sin,Icallitasinbecauseitstopsyoufromadvancing, and yousinasmuchwhenyouthinkyouaregreataswhenyou underestimate yourselves. These are great lapses in

158

concentration. Thats why its important to be very attentive everymomentthatpassesbyanditsnotgoodtocreateideas aboutyourselfsinceyouarechangingallthetime.Mostofyou talktoomuchandacttoolittle,manyofyoudontevenbelieve thatyoucandoanythingwheniffactyoucandoandbeso muchmore.Isaytoyou:dontbemoreorlessthanwhatyou are.Dontbedissatisfiedwiththelittleyouhaveachievednor be completely satisfied before reaching whatever you are capableof! Butstopchangingthesubject.Imtheonethatwantstotalk aboutsex... Intheend... Letsrecap.Manandwomanmeet,impassionedbyLife,and they feel as the encounter is not by chance, and they are impassionedbytheother.BothpracticetheScience,andboth knowaboutthedoubleperspective.Theyunderstandthatthe passion is a strong and magical energy, the strongest of all energies. Passion could be compared with atomic energy! Depending on how you use the energy you could create marvelousthingsorcausegreatdisasters.Passioncancauselife ortakeitaway.SoIsaytoyou:openyourenergyfieldsto passion,butwithmuchcareandattention.Movestepbystep. Understand thattheenergyvibrationyouare experiencing is happeningtoshowyoutheinfinitepossibilitiesthatyoucarry insideyourselves.Youcouldalwaysbelikethis!Youcouldnot onlyhavepassionforlifebutforeachotheraswell,andifthis happensdependsonhowattentiveandtheamountofvalueyou investineachmoment,eachgesture,eachthought.Thepassion isalivingenergy,anditneedsforyoutobeconsciousofitand feedit.Thinkofitaslightingafire.Thinkabouthowyoumust attendandfeedthefiresoitdoesnotgoout,becausepassion worksinthesameway. Themostimportantthinginalovingencounteristhatthefireis real,orratherthatthevibrationisequallystrongonbothsides. Thisenergyequilibriumisthebasisforagoodencounter,and youcanonlyknowthisifyouobservetheslightestmovements ofthemomentsandthenaturalandspontaneousmovementof each.

159

Letssaythatyouobserveanddiscovertheenergyequilibrium ishappening,letssaythatyoupracticethediversestepsofthe lovedancetoincreasethevibrationsbeforethetouch.Letssay, aboveall,thatyoucanmaintainaconstantenthusiasm,each andeverymoment.Inthiscase,naturally,ifnothingisforcedor pressed,onedaythebodiesdecidetoprolongthetouch.Pay attention! I am not talking about the kind of touch that you generallypractice!Generallyitonlytakesthethoughtthatyou are beside someone of the opposite sex whom you like to extend your hand and touch automatically. And when you marry,itsworstyet!Youstarttotoucheachotherinanyway, becauseyouthinkastheotherasyourterritory.AndIsaythatit doesnthavetobethisway,thatthisisnotthemostbeautiful way.Themostbeautifulway,andthismightsurpriseyou,isthe moreromanticway. Romantic??? Yes. I am not talking about romanticism inwhich you have beenconditionedwith,whereyouhavetoactorthinklikethis or that. I am talking about a certain quality of emotional passion;Iamtalkingaboutaspecificvibration.Ifyouhavefelt itbefore,youknowwhatIamtalkingabout.Whentwopeople arereallypassionate,youdontevenneedtolookattheothers bodytofeelexcited.No.Whenyoureallyfeelpassionforthe otheritonlytakesareadoftheothersfaceandyoudfeelmore excitement than looking at any part of the body. Taste it. Assumeapostureofreverence.Yes!Ishallrepeattheword: REVERENCE.Thisisveryimportant!!!Ifyouarepracticing the Science and you understand that you are experiencing a magicalencounter,youwontdoanythingautomatically;you wontmakeanygestureswithoutbelief.Toucheachother,but touch consciously! Be awareof the unbelievable energythat restsinthesimpletouchofthehands!Teenagers,whenthey discoverlove,havethiskindofawareness,becausetothemits still the unknown. I say this: the great challenge of passion betweenmenandwomenisthiskindorawareness,thisintrinsic certainty,thattolookatthatperson,beingbesidethem,totouch their body is something magical and special. If you cant maintainthis,sometimesitsbetternottomeetatall!

160

ButGoddess!Youaretalkingaboutsomethingthatseemsimpossible!Have youeverseenacouplethatcanactlikethat? Iftheycantachievethat,theydontlivetogether.Iftheyare reallyfeelingpassionforLifeandforeachother,theywillfeel capableofdoingthisandmuchmore!!!Loveisabovefear,love giveswings,lovegivesstrength,lovecreateseverything.Only thelackofloveissterileandcowardly.So:bedemanding!With yourselvesaboveall!Dontacceptbeingbesidesomeonewhom youdontfeelrealdesiretobenear.Everyminutecounts!If youwanttolivetogether,understandthatyouareundertakinga challengetoalwaysrecognize,feelreverenceandfillthelifeof theotherwithenergyeachmomenttogether!Ifyoudontfeel capableofthis,thenyouarenotsufficientlypassionateforLife andforeachother. Whatshouldbedoneinthiscase? You have to understand how you can increase your own vibration. Understand that this is an immense responsibility! Youhavetobehappyinordertoloveeachotherwell;youhave tobehappytobeabletoloveeachother,andtomakeeach otherhappyaswellastheWorld. Thismakesmethinkofyesterday.Iwasalittlesadbecauseofsomedifficult encounters I had and I sawthepeopleat myjobatanightclubfelt my unhappiness and were worried. I took a deep breath, emptied my mind, prayed,talkedtoYou,Iobservedtheprofoundmeaningofthestory,and toldmyselfthatthiswasonlyanobstacleinmypath.SuddenlyIbeganto feelbetter.And,attheendofmyshift,IwasfeelingsomuchbetterthatI begantodance!Ipushedtheothersonthedancefloor,theonesthatwere sittingandmoping,andsuddenlywewerealldancingwithgusto! YouunderstandhowyouareresponsiblefortheWorld? Yes,Ibelieveso. So, if you understand this, if you feel it, you will stop yourselvesfromrelatinginaroboticway.Youwillunderstand thatthefirstcommitmentthatyouhaveistheonewithLife. Seek to be well. If its necessary, step back from others to

161

searchforthis.Andmeeteachotherwhenyouareinastateto dothegood!Meetwhenyouhaveplentyofenergy,whenyou areinastatetosee,hug,kiss,causelaughterandcelebratewith otherpeople. Yes,butsometimessadnesssweepsoverandinthesemomentsitcanbe goodtolaymyheadonsomeoneschestandcryortalkorjustfeelthe warmthofanothernear. Ofcourse!Dothis,butdoitwithloveandreverence.Seeand feelthatyouareinthepresenceofthe otherandrealizethe valueinthat.Neverdoitwithoutawareness,neverdumpyour problemsonanother.Neverdraintheenergyofanother.Letthe other naturally give you strength. Do you perceive the subtletyinthedanceoflove? Yes. Well, you will reach the moment in which you will be practicingthisandyouwillbesofulfilledthatyourbodieswill feel an undeniable desire to fuse together. This kind of undeniable desireonlyoccurswhenbothofyouaredancing verywellemotionally,andthisisthebestkindofenergythat leadstothebestsex.Someotherkindsofsexmaybegood,but it wont reach the energy levels attained by sex done under theseconditions.Thisisconscioussex,orbetteryet,itsthe trueactofmakinglove.Beforeyoucanmakeloveyouhave tobelove. Verywell.Botharevibrating,bothareimpassionedforLifeand foroneanother,botharecrazyinlove.Atthismomenttheman observes.Hestirsup,dancesasamaleoftheanimalworld, dancesthedanceoftheseduction. Whatdoesthismean? See,Iamnottalkingaboutsomecheapgameinwhichyoujust fuckoneanother.Iamtalkingaboutthedance,conscioussex, about making love.Whenbothpeoplerealizethat theytruly desireeachother,themancanconsciouslybeginthedanceof seduction that consists of studying the woman and doing everythingsothatshefreesherenergy.Orrather,usedevicesto

162

warmher,surpriseheranddrivehercrazy.Inorderforhimto achievethis,inordertogethertotherightspot,ortheright vibration, he has to study her carefully and with a lot of patience. We aretalkingabout control oftheuncontrollable. Its a very important step in the dance. Both sides are completely involved bythe music of love, bothfeel in their beingarhythmflowingthroughtheirwholebodies;theyfeel theexcitementvibratingamongtheirbodies.Thecontrolofthe uncontrollableistheawarenessofthisprocess.Itsmaintaining theawareness untilthetimetheuncontrollableiscompletely inevitable.Ifthisisexercisedandpracticedwell,bothwillbe abletomaintainthisprephaseoftheuncontrollablemoreevery time and you will enter a real delirium, a voyage, a high vibrationthatisverymuchelevated. Wecontinueon.Themanstartstomanagetheenergyofthe womansothatshegetsnearerthepointoftheuncontrollable. This isvery important! Thewomanhastolosecontrol first. Thisisessential inorderforhertoconduct thedance.Iam comingbacktothatpreviouspointwhenIsaidthatthemanhas totouchthewomansheartchakrasothatthesexreleasesfully. Thereasonforthisisverysimple:thecycleofLifebeginsand endsinthewomansbody!Themanisliketheseedthatfalls intothesoilandthewomanisthesoilwheretheseedwillgrow. In the woman the energy of love is born, it turns to life, it transformsanditspringsforthintotheWorld,anditreachesthe manwhointurncomesbackandsoforth.Thisiswhymen haveanimmenseresponsibilityinlovetostudythewoman,to revere her, observe and awaken and reaffirm Life or the Goddessthatiswithin,tofeelthecyclicalmovementofLife thathappenswithinhersoheunderstandswhenandhowtolay hisseedonhersoil,therightmomenttogetclose,therighttime to sow. The woman, for her part, has to be aware and be attentive to what the man provokes in her, she has to have reverenceforhimandlovehimlikeaGodinordertoopenher energiesoutcompletely. Observe these movements well! Because this is a dance and eachonehasadifferentmovetoperform.Themanhastoput into practice an art and movements of the conquest of a

163

territory,heastogoin,penetrate,walkintoanunknownland. Histaskistocarefullyandminutelystudythewomaninorder to know what thebest wayis.He hastotrytoperform his movementswithexactingprecision. Forthewomanspart,hertaskistoreceive,openherself,offer herself,andoverflow.Shehastobeawareofthetimeinwhich sheisatthepeakofherabilitytoreceive,orratherwhensheis completely open, when she is overflowing with love and sensuality. I repeat: the physical dance among the two must onlystartwhenthewomanstartstolosecontrol,whenshe feelstheexcitement growinginsideherbody,whensheis finallyopenemotionallyandphysically.Themancouldalready bephysicallyexcited,butshehastostarttolosecontrolbefore him,itisinherthattherealactoflovestarts.Itsverycommon thatmenandwomenhaveconflictbecausehewantsamore physicalkindofsexandshewantsmoreromanceandpassion. Mendonotrealizethatthefusionmuststartthere:themore romanticandpassionatetheyare,themoreshewillletherself goandthemorephysicalshellbecome!ThisiswhyIsaythis: enjoy the immense possibilities that your bodies offer you! Moveslowlyandfeelpleasureeverystepoftheway!Notice thevibration!Ifyouperceivethingswell,youwillnoticethat dependingonthemovements,thevibrationwillincreaseorfall. Getcloserandwithdrawaccordingtothevibration! Whenthemomentcomesinwhichthewomanlosescontrolthe lovedancecanbegin,becausethevibrationishigher,because theGoddessmanifestsherself.TheGoddessorLifeorIwill takethereinsofthesituation.Fromthispointonthemanhasto givehimselfandlethimselfbeguidedbyheruntilhe,inturn, reaches the beginnings of losing control, until his vibration reachesthesamevibrationfrequencyashers. Beobservant!Whentheenergyofloveisletloseitmovesin cycles. Theenergystartsinthewomansheartorrather,the womanfeelscrazyinlove,shefeelsaverystrongemotionthat burnsinsideandstartstoenvelopthewholebody.Thewoman becomesawareofthisincredibleemotionthatsheisfeeling, which means that the energy climbed from her heart to her head. This conscience reaches her brain and creates a

164

connectionbetweentheemotionalandthephysicalenergy,its what drives her to act, that gets her to talk and moan in a differentandunexpectedway.Themannoticethedifferencein thequalityofhermovements,orrathertheenergyentershis headandaffectshisbrain.Hebecomesawarethatsomething newishappening,andtheenergycontinuesonitswaytothe mansheartchakra.Hebeginstofeelstrange,overwhelmed,it seemsliketheloveincreasesthetemperatureofhisbody,he suddenlyfeelspain.Theloveisverystrong,sostrongthatit hurts and its pleasurableat the sametime.At this moment, when love reaches the chakra of his heart, this is the only momentwherehecanreallystarttolosecontrol.TheGoddess takesoverhim,andhegiveshimselfup,heleaveshimselfto Her.Fromthatpointon,theenergytravelstothepenis,andhe beginsstepbysteptoloosen,hestartstomove,moan,andtalk in a new and surprising way. Attention! The physical excitementcouldhavebeengoingonforawhile,butthereisa bigdifferencebetweentheenergythatinvolvesonlythesexual chakra and the energy that involves all the chakras. I am describinghereanemotionalexcitement,whichistheonlyone thatleadstothereallossofcontrol,anditstheonlykindthat heightensthevibrations.Itisonlyatthismomentandjustthis momentthatbothpeoplebegintolosecontrol,itsthenthatthe penisshouldseekaphysicalfusion,becausetheenergieshave alreadybeenfused! FromthatmomentforwardthecircleofLifebeginstoclose, likeanelectriccircuit.Manandwoman,whichareusuallytwo universes,twocircleswithtwodistinctnuclei,atthismoment become perfectly complementary, or rather they become a single vibrating circle in which a single nucleus exists. The energy,thatstartedintheheartofthewomanandmadeitsway throughtheman,comesbacktothewoman.Thepenetration occursandtheLargerDancehasstarted,thedanceinwhichtwo individualsunite,theycomplementthemselvesanddissolveina unity.InthebeginningoftheLargerDancebotharestillaware ofwhatishappening,theystillcontroltherhythmoftheirown movements.Butatimewillcomewhencontrollingbreathing, gettingcloser,pullingaway,pullingcloser,andobservingwith

165

allyourattention,bothwillnoticethattheirrhythmsarenot separate!Therecomesatimewhenbothwillmovewiththe samerhythms!Themovementofoneistheexactresponseto themovementoftheotherandviceversa.Atthismomentand onlyatthismomentwilltheyletgoofthereinsandgivethem untoLife,theGoddessorMe. It is inthe wombthatthefusionhappens,itstherethatthe energiesfuse,becomessingularanditstherethattheLightof Lifeiscreatedandexpanded.WhenLifeconductstheactof love, the intensity of the vibration increases, expands and finallyexplodesinamutualorgasm,inundatingeverythingwith energy.Wearedealingwithrealenergiesthatsurroundboth bodies,bothsouls,andthatexpandbeyondthem.Whenloveis welldone,thevibrationofthewomanandofthemanlikeall energyfieldswillbetransformed. Wow!Ineverheardoftheactoflovebeingdescribedlikethat!Thankyou! Itwasbeautiful. Itisverybeautiful.Anditswhatismostreal,itsparadise. Unfortunately, all of you live with very little physical and emotionalawareness andthesexthat youhavedoesnt have anythingtodowiththis. Yes,Iknow. Yes,youdoknow. Howmanytimesdidsexhappenwhichwaspurelyphysical,oralittlemore thanphysical!Sometimesitwassoso;sometimesitwasgood,sometimes verygood.Sometimesitwasinsignificant,otherssurprising.ButIalways hadtheimpressionthatasexualencountercouldhavehadmorestrength,I alwaysfeltthatIwasntlivingoutthetrulyamazingsex,andthiswasnota question of how each person moved physically... What should be done? Shouldwestophavingsexandbeabletostartmakinglove? Calmyourself.Everythinghastobedonestepbystep.Yousaid thatyouhadsexthatwasok,goodandgreat.Andstill,even whenreachingorgasm,youfeltlikeyoudidntreachthepeak ofyourvibration.Isthatit?

166

Yes. IfIamnotmistaken,sometimesyoudidntfeelmuchatalland youhadsexpurelybyinertia,becauseyouandtheguywere thereandyouhadtodosomething.Becausesometimestheman hasanerectionandheassociatesthiswithaneedtodischarge hisenergiesonthewoman.Orthewomanisboredandfeels she has to masturbate through the man. And this not only happens in casual encounters but between people in relationshipsandmarriages.AmIright? Well...Yes. Verywell.Payattentiontothis!Observethepovertyinthese moments,observeandtrytounderstandwhatyoucoulddoto make them richer, more magical, more intense, and deeper, withmoreemotion,withmorevibration.Youallassociatethe simple sexual act as an adventure; you think if you find yourselvesandhavesexthatyouareachievingthemax.Butit doesntworkthisway.Thereissexandthereissex,thereisan orgasm and there is an orgasm. There are several levels of sexualvibration,andtherearedifferentintensitiesoforgasm! So,ifyouwanttovibratemoreinyourlives,ifyouwanttoget themostoutofit,thesublime,paradise,constantpassion,if youwanttranscendentalorgasms,dontjusttakewhatcomes along! Ok,Iunderstandthat. Understand???Youkeepfallingbackonyourvice,Antonella! Recently,nottosaytoorecently,youwerehavingsexjustfor itssake! Yes,itstrue.Butitsjustnoteasytochangemyhabits! Whoistalkingabouteasy? The worst of it is that I had sex and I was conscious that it was only somethingphysicalandwouldnottranscendmatter.Thatleftme,inaway sooutofreachthatIwasntevenespeciallyexcited,Ididntevenreach orgasm!

167

Thereistheproblemofhabit,andthereisalsotheproblemoffear.Ihave beenpracticingtheScienceandIhavebeenvibratingvery,verymuch.I have been able to live out the moments, for the most part, with much awarenessandintensity.And,curiously,thisleadstoakindofchastity!And that makes me scared! I feel like a virgin again, I feel like a teenager, overflowingwithsensualitybutwithnosexuality!SoIgenerallyreacha point whereIhavea sexualencounter,moretofeelthatIamaliveand becauseofsensualneed...Andunfortunately,forthemostpartIobservethat theencounteronlyservestodrainmyenergy.Ifthereissometensionit dissipates,butontheotherhanditdoesntgobeyondthatandtheencounter doesnotpassfromthephysical. Whenyouarenthavingsex,doyoufeelgoodorbad? Ihavebeenfeelingverymuchalive,fullofenergyandveryyoung!Butall ofthisisveryscaryatthesametime.Afterall,Iamatwentynineyearold womanandtherealityaroundmeiscompletelydifferentfromwhatIlive for!Ineverysongtheytalkaboutsexandthefunoforgasms...Imyself spentalotoftimefixatingonthat! Duringmyfirstyearsofsexualactivity,from16to18yearsold,Ihada greatdifficultyreachingorgasmwithaman,andIhadthedreamtodoso. WithtimeIcouldopenmyselfupmoreandhadorgasmswhentheman stimulated my clitoris. Then my dream was to have vaginal orgasms, throughpenetration.Ittookawhile,butIfinallyopenedupandwhenIwas around26Istartedhavingthemwithmorefrequency,untilIreachedapoint whenIhadthemeverytimeImadelove.Thiswasagreatdiscovery!Ihad tounlockmyselfandonlypassionandpassionateencounterscausedmeto achievethis.Later,mydreamwastoachieveorgasmatthesametimeasthe man.Imagine,ifyouwill,thatallthesedreamsseemedimpossibleatthe time,impossiblebecause,afterall,thesewerethingsIcouldntfeelandlive! Therewereonlythepossibilitiesoftheseinsideofme.Iendedupachieving thisbeautifulexperienceofsimultaneousorgasmswiththerightpartnersat therighttime.IhadverystrongorgasmsandIspentmy27/28yearsinan intensephaseofsexualawakening.Ilivedthroughabeautifulstoryoflove inwhichwebothdelightedourselvesinmanysexualgames. Well, before experiencing the simultaneous orgasm, I thought once experienced,itwouldbetheultimatesexualexperience.ButIunderstood thatitwasnt.Ormaybeitwas,forsex,buttodayIknowitisnttheultimate

168

experience of making love. I believe that, discovering and practicing all thesefacets,Ihavebeendiscoveringbeautifulstoriesoflove,andIreached a point where my sexual dreams took a quantum leap. Even though sometimesIfallbackinthehabit,Iunderstandthatmerelysexwontsatisfy me,becauseIunderstandthepossibilitiesthatlaywithin.No.NowIwantto fuse,Iwantelevation;Iwantemotionalvibrationeverymoment,atevery encounter,witheachtouch!Thismakesmethinkofasongwhereawoman screamsoutbeautifully:Iwantfeelinginmysoul.ThisiswhatIwant, andIcametounderstandthatonlysexwillnotgetyouthere!Thequestion is:howdoyougetthere? Youareonthepathtothis,Antonella.Unfortunately,mostof youarestilllikethis.Youhavetodrugyourselves;youhaveto understand the vices and its collateral effects in order to understandthattherearebetterthings.Onlyafewofyouhave avoided the unpleasant experience of drinking too much to understandthattodrinkinmoderationornottodrinkatallcan bemuchmoreemotional!Whydoyouhavevices?Haveyou asked yourselves that? Its very simple: all of you want to vibrate more, but you are very lazy! When you have an experiencethatmakesyouvibrate,youthinkthatspecificform willbringyoubacktothatsamevibration.Somegetaddictedto people,othersgetaddictedtosexitself,othersinsport,others ondrugs,andsoforth.Thegreatleapistounderstandthrough experiencethatthevibrationtakesplacenotoutsidebutinside ofyou.Soifyouhavethedesireforpassionandvibrationwith the opposite sex, first search for these vibrations within yourself, work on this and afterwards observe with much attentionifyouseeasimilarvibrationonanotherperson...You wantemotion?Observehowyouliveeachandeverymoment, beobservantofwhatthepersonthatyoudesireprovokeswithin you,anddonotbecontentwithnothingmorethanwhatyou knowyoucanfeel. You for example are on the right path because you have experiencedallthatyoufeelisnecessarytoexperienceasmany timesthatwerenecessary,andthisisbetterthanbeclosedup and afraid of taking chances. But be careful! You could experiencevicesbutifyoubecomeslavestothem,theycould killyou!Thelinebetweenthevicethatteachesandthevice

169

thatkillsisverythin.Atthesametime,ifyoudontgothrough certainexperiencesbecauseoffear,youendupdyinginside anyways.So,takerisksbutwithcautionandwhenyoufalland breakyourface,getupandtryagainuntilyouunderstandhow toadvance.Itsimportanttoneverloseperspectivethatyouare dealingwithalearningexperience,achallengeandasearch. Yes,itstruethatIhavefallenonmyfacemanytimesinmysearchfor emotion with theopposite sex.Ihave several timeslost all myenergies throughunsatisfactorysexualexperiences.OnceImetamanandwhenwe were in the bedroom, I felt that for him it was something automatic, something purely physical, without any beauty. This was a very strange experience!Itsasifcertainmendidntactanydifferentwhilehavingsex withanewwoman,anditsasiftheyhadsexthesamewaywithoutnoticing thatinthatmomentsomethingnewandmagicalwashappening!Thenext day,Igotverysick. Youfeltthatforhimitwassomethingpurelyphysical,andthat he could not make you vibrate, and you delivered yourself anyways and afterwards you blamed him for seeking his pleasure!Whathesoughtwaspurelyphysicalanditdidnot mattertohimtouseyouforthatpurpose.You,ontheother hand, for pure sexual curiosity, left your path for seeking emotionalelevationandendedupgettingsick!Youmadetwo errors,youdidnotholdyoursexualcuriosityandyoudidnot takeintoaccountthatyouwerenotpreparedtolivethrougha purelyphysicalencounter.Itendedup,likeothertimes,being something more automatic for you than for him, since you didntevenfeelanypleasure. Pay attention! Do not act until you are clearly conscious of what you are doing, do not act until you can act with your wholeself!Ifyoudecidetojustjumpintobedwithsomeone, youcanexpectwithagreatdealofprobabilitythatyourenergy balance will be thrown off and that could result in a bad encounter.Andifyoufeeltheunbalance,eitheryouonlyenjoy asmuchasyoucanordonthesitatetostopsomethingthat cantsatisfyyou.Iftheperson,whomyouhavemet,isfocusing onlove,hewillhavepatienceandwillknowhowtowaitfor

170

therightmoment.Ifheisnotwillingtowait,itcouldbethathe getsirritated.Inthiscasetheencountercouldnotsurpassthe physicalanyways. Therearentanypeoplethatdontknowhowtomakelove, there is only people that dont have enough patience and consciencetounblockthemselvesandmaketheirenergiesof loveflowinsidetheirbodies. Yes.Youreright.AndIhaventmadethatmistakeonlyonce.Ihaveacted many times without full consciousness, having sex on pure inertia, for curiosity,becauseof laziness!Andnothowitssupposedtobe,becauseI wascrazywithdesire... Yes,becauseyouareafraidofhavinglesswhenyoudecideto havequalitysex.Iamsorrytosaybutthisishowthingsare.If youwanttoelevateyourself:havelessandwhenyoudoit,do itwell.Ifbothfeellikedoingitalot,doit,butmakelovetruly, thatintenseandprofoundlovethatmakesbothvibrateatthe sametimeandthatisworthwhile! By the way, in the Tantric tradition it suggests a sensual encounterdailyasamannerofmeditation.Thisisverygood! But of course you just dont do it any which way. We are talking about doing it with conscience that both energy universes are meeting each other to elevate each others energies.Inordertoachievethisyouhavetostudytheotherat every encounter! If you are willing to do this, incorporate sensualityinyourconsciousroutine!Theidealwouldbetogive heraplacethatisequivalenttotheothertasksdonedailyfor wellbeing. Give yourselves half an hour every day for this practice of conscious sensuality with your chosen partner (since in this case,itsbesttohaveoneorfewfixedpartners).Inthishalf hour,rediscoverthepersonthatyouarewith,becauseevery newdayandmomentyouaredealingwithanewperson.Look atoneanother,touch,massageeachother,smell,taste,andseek to feel one anotherwithoutpurposeorgoal.Sometimes you willstartmakingloveandreachingorgasm,sometimesyouwill makelovewithoutfinishing;sometimesyouwillonlycaress one another. Understand this: sensuality will only help you achieveelevationifyoulosefocusonthegenitals.Exactlyhow

171

itisinlife,thepathtothegoalismoreimportantthanthegoal itself.Thepathconsistsofincreasingselfperceptionthrough the other, to developattentiontothepresent andintheend releasetheemotionalvibrationorratherthephysicalfeelingof the energy of love. Read about tantric teachings to better understandhowmuchyoucanunderstandandlivethrougha sensualitythatispracticedconsciously.Makingthisemotional kind of love not only increases your vibration but it will considerablyincreaseyourqualityoflive. Wow!YouneedalotofenergytolivetheScience! Thefirstkindofenergytoinvest,andthemostimportant,isthe energy of want. From the moment that you in fact want to changeyourlivesandyourvibrationsandyoudoeverythingto achievethis,thequalityoftheeventswilltransformandyour energylevelswillnaturallyrise.So,whenyouarepracticing theScience,youwillstarttonoticethatyouhavemoreenergy tomakethingsevenbetter! Yousaidthatthequalityoftheeventswillstarttochange.Thisremindsme ofsomethingthathappenedmonthsago,inwhichlisteningtotheHeartand body,IfeltforafewdaysthatIhadtostopdrinkingalcoholandchangemy diet.Curiously,duringthesedaysavery intenseencounterhappedwitha man,whereIdidntunderstandwhetheritwassomethingjustphysicalor not.Buttherewasasurprisingintensity.Itwassuchastrongencounterthat IlostallreasonandcontrolandIgavemyselfunprotected.Itwasbeautiful butalsoscary. Youlostallreasonandcontrol...Whatdidyouthinkofthis? Well,whenithappenedIwasbothenchantedandspooked.Ihadalways dreamtofanencounterlikethat,butthetruthwasthatIhaddifficultyin acceptingthatitwasfinallyhappeningtomeaftersomanyencounterswith theoppositesex!Itwasaverystrongvibration!IthoughtIwasfooling myself;furthermore,thepersonwasverydifferentfromme,butmybody actedindependentofme.Whentheperson,whowaspassingthroughmy townleft,IbecameawarethatIhadgivenmyselfupinaverycrazymanner. Ifeltthenfear,remorseandIwassweptbyawhirlwindofemotions.Itwas astruggletoremainsilentandreconnectmyselfagain.Ionlygotmyself togetherbecauseIgotsickandmademyselfrest.

172

Inthiscasewhathappenedwasnotpurelyphysical,andyou knewthat.Youwantedtolosecontrolofyouremotionsand you couldnt take it when it happened...You kept telling yourselfthatyouactedoutofhabit,itwasanencounterlikeany other,andyoublamedyourselfbecauseyoudidnotwantto believeinthemagicthatwashappening!Andhealsoranfrom you,orfromhimself,butbothendedupgettingbackintouch after a while because you understood that the emotional intensitywasnotjustmerechance... Yes.Iblamedmyselfbecause,eventhoughIamemotional,Iamdeeply rational.Myreasondidnottoleratebeingleftbythewayside!Istartedtobe bombarded by terrible thoughts that judged my emotional and physical deliverytosomeoneIdidntknow. I say: when you feel, deliver yourselves without fear and withoutworryingaboutthefuture. ButthiskindofgivingyourselfupcanbeverydangerousGoddess!Itcan, asYousaid,evenkill!EspeciallythesedayswithdiseaseslikeAids,notto mentionalltheothers. Andso? Whatdoyoumean:So???Youmeanweshouldntprotectyourselves? Ididntsaythat.Isaidthatyoushouldntletfearstopyouand sometimes it means risking and dealing with the possible consequencesofyouracts.Ifyoucanprotectyourself,better yet!Bytheway,themorethatyouelevateyourconsciencethe more you understand that the sexual encounter can be somethingthatisenergeticallyfabulousaswellasterribleand soyouactinamorecautious,patientandslowmannerwithit. In the moment that you mix yourselves sexually, you are mixingyourhistories,yourerrorsandmerits,allthecausesand effectsofthepastandthefuture!So,thebestwouldbetogetto knoweachotherwellbeforeyouplaywiththis.Butifyoumeet andyoufeelthatyouaredealingwithsomethingstrong,real andinevitable,thatyoucantevenprotectyourselves,dontfeel guilty!Inthiscaseallyoucandois:relaxandenjoy. Doyoumeanthatwecanputourlivesatriskbecauseofacrazypassionand thatwouldbeinaccordancewiththeScience?

173

Everything that you do for love is in accordance with the Science.AsIsaid,protectyourselvesifpossible,butdontget crazy if you cant. When you are able to apply the double perspectivetothepointoffeelingitconstantly,youwillcome tounderstandthatitdoesntmatterwhathappens,whatmatters isthatyoulived!Imaginehowsadthelifeofsomeoneiswho takesnorisks,thatneverdidanythingbecauseoffear! When theFormula1driverAyrtonSennadied,peoplecried uponhispassing.Butinreality,althoughitwasthedeathofan incredibleperson,itwasnotasaddeath!Therewasapersonof notableenergythatlivedanddiedfortheirpassion.Hisdesire tosurpasshimselfwasstrongerthanhisfearofdeathandsohe diedinadignifiedway.Amanorawomanthatlivesforlove shouldnotfeardyingforit.Askamountainclimberifhewill quitclimbingbecauseoffear.Hewouldsayno,becausethe morefearhefeelstheclosertothetopheisandmorecourage hehasandthemoreenergyandthemorelove,nomatterhow hardanddangerousitis.AndIsaythistoeverybody:practice climbing in your daily lives! Scale your emotions! Raise yourselves up! Take risks and dont cry if things go wrong. Maintainthedoubleperspectiveandunderstandthateveryfall ispartofthepathtovictory,beinginthisoranotherlife.Now: Whateveritisthatyoudo,doitforlove!Doitfully!Ifyouare notintrinsicallysurethatthisiswhatyouarepassionateabout, dontdoit,protectyourself.Dyingbecauseoflackofattention istrulywhatisfrustrating... WellatleasttheunsatisfactorysexualencountersthatIvehadwillhelpme understandwhatIdontwant... We can only hope that next time you will understand much earliermydarling.Itstimetoplaybetter. ButIdontwanttobecomechaste. Whoistalkingaboutchastity?Stopthinkingaboutthesethings andlearntolive!Ifyoufeeldrawntoaman,makelove.Ifyou dont feel it, dont do it and at that moment try and find somethingelsetobeexcitedaboutbecausealifewithnothing tobeexcitedaboutisnotworthliving.

174

ListenlittleGoddess,thisthingaboutemotionalenergyandtheScienceis something extraterrestrial. No one has this kind of consciousness. To be more normal sometimes I fall back on sex. Besides that, besides the feelingofpracticingtheScienceIbecometoodifferentfromotherpeople andthereisalsothefactthatIlovetobewithanother.Anditsveryeasyto findpeopletohavesexwith,anditsveryhardtofindpeoplethatdont have voracity, a fixed idea in their heads and bodies that they have to consumemeatallcosts,asquicklyaspossible!Andwhathappens?Iendup thinkingitsnormalandsometimesIendupconsumingthemaswell...It canbegoodsometimes,butitssopredictable... Amongotherthings,thisisoneofthereasonsthatIthinkyou killlove.Youliterallyconsumeyourselves;draintheenergy from one another, instead of giving of yourselves. You get contented in being predictable when love is anything but predictable!Ifyoustartactinginthisconditionedway,ifyou alwaysactthesame,thebodyfeelsthatroutineandbecomes heavyanditgetslazyandannoyinglikeaspoiledchild!This happensinlifeaswellassexandlove.Breaktheroutine,rise above your habits; stretch out emotionally, physically and sensually! Try and expand your perceptions! If you find yourselves amongmenandwomen,actdifferentlythanhow youactnow!Ignoresuperficialpleasuretoachieveadeeper pleasure.Noticethesilenceandactinanewway. This is also very important, and almost as important, inside your marriages. That man that is always crazy to unburden himselfsexuallyissomethingpatheticanditendsupmaking thewomantiredandthewomanthatisalwayscomplainingand waiting for the man to change without her changing is too terribly pathetic. Men and women: change and transform yourselves. If you want to get married, assume a new perspective to marriage. The best way to be married is to understandthateverydayyouareinvitingthatpersontolive and play with you! Play, interact, invent, date and dont be repetitive! But its nice to have some rituals for two,likefor example,puttingout candlesduringdinner,havealittlewineandcheeroneanotherwhilelooking intoeachotherseyesandthingslikethat.

175

Rituals, especially romantic rituals between two people are great ways to keep the fire of passion going, but this only happens if you practice the ritual in a conscious manner, or rather you have to practice them more or less at the same intensityandprofoundness. Doyouwanttoprayeveryday? Praywithconsciousnessandattentionotherwise,energetically, itsbasicallyuseless.Doyouwanttogetmarried?Marryeach day, with attention and consciousness; otherwise it will be uselesstolivetogether.Thatsit!Andwhynot?Celebratewith eachdayaceremonybetweenthetwoofyou!Doyouwantto eatandsleepandhavesextogether?Doiteverydaywitha renewedreverenceandseeintheseactstheconstantchallenge tomakethingsbetterandmorefulfilling.Irepeat:itdoesnt matter what you do, as long as its done with attention and conscience,orratherwithlove. Well, maybe things will change if people knew of the transcendental pleasuresthattheyaremissingoutonbecauseoflaziness... Wehopeso. Iamgoingtochangethesubjectforabit,butYoumentionedpraying.Does this serve any end? Well, I know it does, but could You explain things better? Of course,andintruthyouarentchangingthesubject.Ijust finished sayingthatitdoesntmatterwhatyoudobutrather howyoudoit.Youcouldbewalkingaroundthehouse;you couldbeprayingormakinglove.AndtheScienceisveryclear whenitsaysthateverygesturecounts,everywordsaidcounts, everything is important and has its energy value. If you do somethinginanunbalancedway,becauseoflackofconscience andlackofattention,thiswillhavebearingenergeticallyinthe future, provoking unbalance, unconsciousness and lack of attention.Toactwithoutattentiondoesnotpushyoutowards progressandcouldevenhinderyoudependingonthekindof energyvibrationthatyouarehandling.Thedenserthevibration is,theheaviertheemotionalenergythatyouarefeedingin the present, the more difficult and catastrophic the consequencesforthefuturewillbe.Everythinghasenergyand energythatisbadlydirectedcandoalotofharmtoyouandthe

176

World.Ontheotherhand,ifyoudowhateveritmaybe,with conscience, reverence and attention, this will have fabulous consequences on your destinies. All of a sudden, everything beginstoflowandyoureceiveunexpectedpresentsfromLife, magicalthingsjustwontstophappening...Andeverythinghas to do with something that you wished or didnt wish for yourselves... Letsseewhattheactofprayingconsistsof.Toprayisthe verbalizationofareligiousfeeling,ofadesiretocommunicate withGod,withLifeorwithMe.Verywell,thinkofthebest waysthatyoucommunicatewithoneanotherandyouwillsee thattheactofcommunicatingismuchmorecomplexthanjust talking.Itdealswiththeexpressionofwhatyoufeelusingthe bestwords,thekindthathastheemotionalimpactforyouand foryourlisteneranditsalsoaboutactingacertainwaythat reinforces the energy in the words. So, you want to communicate with someone in a manner that the other will understandwhatyouaresaying,butbeforethatyouhavetobe preparedinwhatyouwanttotransmit. When you pray the process is identical. If you have consciousnessandyoupronouncethewordswithattentionand actinaccordancewithwhatyouwanttocommunicatetoMe, thewordswillactinaccordancewiththeirenergies. Foraverysimpleexample,thinkofapersonsayingIlove youtoanother.Thesewordscanbesaidinanautomaticway, andbeaccompaniedbycoldanddisinterestedgesturesandso would mean nothing to the person hearing them. But if the personsaysitwithforce,enthusiasm,attentionanddoescrazy things for love, and confers warmth and emotion to their gestures, if they act in accordance with what they say, the personwillbeabletoreachthevibrationalfieldoftheother person, and will be able to communicate what I love you means! ThisremindsmeofamarveloussceneinacrazyencounterthatIhad... Tellus! Butithasnothingtodowiththeobjectiveoftheseconversations!

177

Howso?Youwanttorecountapassionatescene,aromantic scene,somethingthat surprisedyouinalovingencounterand thishasnothingtodowithwhatwearetalkingabout???Weare talkingaboutthemagnificentenergyofloveandpassion;we aretalking abouttheimportanceofunlockingthisenergyso that it may flow abundantly through your lives! And you, Antonella,haveattestedinyourlifeandyourencountersthat thisdoeshappen,thatitisaScience,thatLifeandloveorIam infinitely generous with those that are emotionally generous withthemselvesandwithothers,eventhoughsometimesIam rigorous in how I remind you on the better path. So stop delaying,andtellusaboutthisromanticsceneplease. Well...WefirstmetatagatheringatourfriendshouseandIsawhimfrom afarandhesawmeaswell.Hewasntmytypeofguybutitwasasifhehad alightaroundhim,somethinginhimfascinatedmeandlaterhesaidhe wasthinkingthesameofme.Whenhegotclose,westartedtotalk.We talkedforhours.Therewassomething,therewasanenergybetweenus thatwecouldntunderstand.Wetookawalk,laughedtogether,wekissed, but we werent very concerned about expressing our physical side. We decidedtomeetthenextdayatmidnightatthebeach. Ournextmeetingwasduringabeautifulandhotnight.Acoolbreezeblew whichmadetheleavesofthecoconuttreesdance.Wesatembracedand continuedtotalk,andtheintensityseemedtorise.Itwasasiftherewasan energyhaloaroundus,andoureyesmetasiftheyweremagnets,anewand strongemotionthatisdifficulttoexplain.Wedecidedtowalkbytheedgeof the water. We talked a lot and very intensely, and I had the strange impression that,atthesametimehetoldmenewthingsIalreadyknew them,theywerealreadypartofmesomehow.Webothfeltastrongenergy intheair,betweenus,andsuddenlyhetoldmethatIhadnoideahowstrong whathewasfeelingwas.Iaskedhimtotryanddescribeit.Sohe,without worryingabouthisclothes,ranandjumpedintothesea!Inallofhisclothes! Iwasleftwithmyjawhanging,completelystill,absolutelysurprised!There wassomuchstrengthintheenergybetweenusthatIfeltthatIwasdrunk eventhoughIhadonlydrunkwater! Wow. Yes... Wow. It was a great moment, a great present. Thank you, little Goddess.

178

Thankyourself. YouknowthatwithoutYou... Iknow,Iknow...Itsbetweenthetwoofus,Antonella;youare alotofwork!Itshardtopleasesomeonesoromantic!Butyou knowthatIamnotscaredofachallenge... Howcouldyoube?IntheendYouarethechallenge... Finallyyouhaveunderstood! Yes, finally. Thanks to the Science I have been able to increase my vibrationallevelandIhavestartedto feelthingsIdidntfeelbeforeandI begantounderstandtheUniversalLawthatsaysthateverythingisenergy andthateverygesturecounts... ThismademethinkagainhowYoudescribedsexasdoneinconscience.To tellthetruth,IdontknowwhatYoudescribed,Istillhaventgottenthere, but I plan on doing it soon,ifYouandIwant it...Aretheresomethat practiceit? There exists, suchhaveexistedandotherswillexist.People likethathaveaverydifferentvibration,muchmoreelevated. Anditstruethatinyourdimensionitshardtofind.Butthere are other dimensions and other civilizations where it is unthinkabletomakeloveinanyotherway. Youspokeofthemomentoffusioninthewomanswombwhenthecircleof lifecloses.YouspokeoftheLightofLife.Wereyoureferringtochildren? Yesandno.IntheSciencethecontroloftheuncontrollablecan besovastthatbothcouldlearntomanagetheirbodiesinsucha waythatfertilizationonlyhappenswhentheywishitso. How??? Itsexactlywhatyouread.ButIadviseagainsttryinguntilboth are emotionally certain that you have it under control. WhomeverpracticestheScienceandknowstheHeartwillbe abletoproduceachildofpassion,aninevitablechild,achild askedbyLife.AchildmadeinsuchawayisoutoftheKarmic cycleanditdoesntcometoresolveconflictandconditioning, he/shecomestobringLight.Untilyouarecertainthatyouare

179

tohavesuchachildnaturallyyouwillcontrolyourbodiesso thatyoudontgenerateanewlife. ThewomanthatpracticestheSciencewillfeelandknowwhen sheisfertile.ShewillunderstandthecycleofLifeinherbody andwillunderstandthemessagesherbodyissendingtoher. Messages? Yes,yourbodiesareconstantlycommunicatingwithyou.But youhavetodevelopthecapacitytohearthesensationsandthe emotions in order to decipher these messages. Women for exampleareveryfortunatetoholdwiththemselvesthecycleof Life, to know in only a month birth and death through the processofmenstruationandovulation. Fortunate?!IbetthatalotofthewomenwouldnotagreewithYou! Becausetheystilldontknowthemselvesverywell,because they still dont enjoy fully what they are. The famous pre menstrualtensionistalkedaboutasakindofabhorrencebut its energetically a lucky thing for women to have. At that momentthebodyisrenewingandexpellingeverythingthatis notnecessaryemotionally.Thewomenthatfeelverysensitive atthesetimeshavetostudytheiremotionswell,becausethey usually clearly showwhat isgoingwell andwhatisnt.The onlyproblem,ofcourse,isthatalotofpeopledontliketosee thetruth,andthiscasePMSbecomesarealhell. Yes, and this makes me thinkofafriendthatisusuallyverysweet but duringthedaysofPMSshebecomesveryagitated.Sheisaveryromantic personandifIthinkaboutit,maybeithastodowiththefactthatshemakes herselfcontentbylivingwithamanthatshelovesbuthasntfeltpassionate foralongtime. Itclearlycouldbethat!Thelackofemotionisakindofslow death,andeverymonthherbodyrenewsitselfanditcomplains aboutit!Thebodyfeelseverything,thebodyisalive,itneeds loveandcare,itvibrateswithpassionandwithemotionandit sufferswhenitdoesntvibrate!Dontforgetthis:thebodyis thetempleofthespiritandeverythingitshowsyouhasadeeper meaning.

180

Orrather,ifwegobacktotalkingaboutanticonception,thewomancanfeel andknowherfertiledays? Yes. But as I said, a very elevated level of attention and conscience is necessary to be able to rely on this kind of perception. Andtheman?Howcanheavoidchildrennaturally? The man that practices and is very advanced in the Science doesntneedtoejaculatetohaveanorgasmanddoesnteven lookforanorgasminasensualencounter. Isthispossible?Tohaveanorgasmwithoutejaculating? Yes and by practicing this kindof control themanachieves energylevelsthatarestillunknowntoyourworld. Doyoumeanthatinaworldthatismoreenergeticallyelevatedyoudont havetheproblemofavoidingorabortingchildren? Exactly.Thatiswhytheideasofsomereligiouspeoplehavea littlemeaning,butthewaythattheyexplainitandhopetopush them forward through rules, morality and prohibitions is not veryintelligent. Thesamethingthathappenswithdrugs.Prohibitsomethingto yourchildandinstantlyshewillwanttohaveataste.Onthe otherhand, tryandunderstandyourchild,worktoreachhis inner side, give him the emotional understanding of why somethingisnotgoodandyouwillnaturallyseehimstepaway fromsuchthings.Aworldofwellbalancedpeople,aworldof peoplefilledwiththeenergyoflove,wouldnthaveanyofthe problemsthatyoufacetoday.SoIsaytoyou:stopmakingwar against the bad things you create and start to work on the preventionofbadthings.Developthespiritualityinyourselves andyourchildren,andlivetheScience!Aspiritualizedworldis aworldwherepeoplearenaturallyhealthyandeveryonehas enough because everyone loves and shares what they have, withoutrulesorimposing! UnderstandthatthisiswhatIamsaying:thebiggestprevention islove.Filluponthisenergy,thinkabouthowtounlockit, study yourselves, always remember what it is like to be

181

passionate and practice this manner of being! Love is the strongestamulet,themostefficientremedy,thebestpassport, andthehighestsalarythatyoucouldhave.Feellove,livelove, giveloveandyouwillhaveeverything. YouremindedmeofaletterPaulwrotetotheCorinthians... Yes,itisverybeautiful. Itsays:IfIspeakwiththelanguagesofmenandofangels,butdon'thave love,Ihavebecomesoundingbrass,oraclangingcymbal.IfIhavethegift ofprophecy,andknowallmysteriesandallknowledge;andifIhaveall faith,soastoremovemountains,butdon'thavelove,Iamnothing. Andthesentenceafteritisalsoverybeautiful.Itsays:IfIdole outallmygoodstofeedthepoor,andifIgivemybodytobe burned,butdon'thavelove,itprofitsmenothing.Thissays thatitdoesntmatterifyouhaveimpeccablemoralandperform gooddeeds,iftheenergyofloveisntflowingwithinyou. StarttoseetheSciencebehindthings,cometounderstandthat everything is energy, understand the importance in the difference of doing something with the energy or love and withoutit,anddonotacceptdoingthingswithoutthisenergy. Studyyourselves,searchthepathsoftheheart,andonlythen willyoutrulydiscoverthetreasuresthatyoucarryinside,and only then will you unblock the magnificent energy in your bodies.Ifyoustillhavetodosomethingthatyoudontlikevery much, do it anyway with true love and dedication until you donthavetodoitanymoreandsoforth.Youwillstarttosee howyourliveswillbegintochangewhenyouunderstandthe energy responsibility that you have to yourself and to the World. IthinkaboutthewaymymothereducatedmysisterandI.Ofcourseshe mademistakes, asallparentsdo,butIcansaythatinonethingshewasa geniusabout:thewaysshegaveusherenergyoflovewithabundance.And, whenshespoketousaboutdrugs,shealwayssaidthattohaveaconscience wassomethingverygoodandtoloseitwasverysad.Thiscausedmysister and I simply never had much curiosity about drugs. With time I did experimentwithsome,butIcametounderstandthatitfeltbettertovibrate consciously,eventhoughitshardertoachieve,ofcourse.

182

Talktousaboutyourexperienceswithdrugs. Well,Ididntexperimentwithmanythings.Iamwellfamiliarwithallkinds ofalcoholicdrinks,whichiswhatIliked,butthesedaysIdontreallyhavea desiretoabusethem.Theonlyonethatstillseducesmeforitstasteiswine, andIdontthinkIwilleverstoplovingit,becausetomeitsarealpassion withitsgoodandbadsides.Tomedrinkingwineisanartandadelicacyof gods...Ihaveexperimentedwithhashish,marijuanaandsharaz,whichis from India. With hashish and sharaz I had pleasant experiences which causedmetothinkinadifferentwaybutatthesametimeitslowedmea littlephysically.Ididnthavethedesiretorepeatthesethingsveryoften. Withmarijuana,IhavesmokedverylittleovertheyearsandgenerallyI didntfeelverymuch,butIhadoneexperiencethatwasverybadandone thatwasmarvelous.Thatwasall. Andhowdidyouinterprettheseexperiences? I arrived at the conclusion that drugs could be something positive and somethingnegative,likeeverything,dependingonthewayandtimeyouuse it.Buttheyareinfactverydangerousbecausetheyaffecttheunconscious partsofus.Soapersonthatisnotwellbalancedwillhaveabadexperience orwillhaveatendencytobeworseoffthroughtheuseofdrugs,evenifthey are not conscious of this. On the other hand, a person that is very well energeticallycouldtakesomegoodwithanexperiencewithdrugs.Thefact isthoughthebetterthepersonisthelesssheislikelytoresorttosomething tochangetheirperception. And the reason is very simple: conscience gives you all the highsthatyouneed... Yes,itstrue...ThatmaybewhymanypeoplelookatmeandthinkthatI smokemarijuana,whenIalmostneverdo.BecauseIamnaturallyhigh! Andinfactitspossibletobehighwithoutartificialmeans, becausedrugsonlyawakenperceptionsthatarealreadyinside ofyou.Workonyourenergiesandyouwillfrequentlyachieve highsthatareverysimilarandevensuperiortotheonesyou achievewithdrugs! Yes,thatswhathappenedduringtheencounterthatIhadwiththemanI describedearlier!Thatsurprisedmeverymuch!Iwasntdrinkingalcohol,I waseatingwelland Isawmyselfinastatethatwasamixtureofsudden clarityandblissfordays!IsleptlittleandIvibratedtoanincredibledegree!

183

Whendoyourememberlasthavingachangeofperceptionof thiskind? Well,IhadwhatIcalledamysticalexperiencewhenImetDanielagain. Canyoutellwhathappenedthere? Yes, it was after a year of not seeing him,I had walked theSantiagos JourneyandIsufferedthroughtheeyeproblemandIwenttovisitDaniel. Whenwemetagain,Istillfeltastrongloveforhim,butIalsofeltthatthe passionateenergywasnolongervibratinginsideofhim.Eventhoughitwas clear that there was a strong bond between us, something beyond explanation. My body always reacts strongly when I see him, all my perceptionoftheworldchanges. Well,eversincethetimethatwemet,wehadthehabitofritualizingour encounters,doinglotsofsymbolicthings.Welitcandles,hadlongdinners, we drank wine, listened to music, bathed in the ocean together and we continued to do this during this encounter. One day he had the idea of having a ritual with a joint. During our entirerelationship, we hadonly smokedonlyoncetogether,andatthattimewehadakindofmagicritual. Atthattimeithadbeenawhilesinceeitherofushadsmokedmarijuana,so weonlytookthreedragseach.Duringeachdragwesaid:forlove,for magic,forvibration.Andsuddenlytheworldwastrulytransformed!That hadnothingtodowithanythingthatIhadfeltinmylife,eventheother timesthatIsmokedmarijuana.Itwasasifanenergyinsideofushadbeen unblocked, and diverse kinds of information about the World and the Universesprangupandwespokeofthis.Itwasadizzyingvibrationoflove! BeforethatmomentDanielhadbeenprettyindifferenttomypresence,but duringthosemomentshiseyesreturnedtheirshine,thesameaswhenImet himandheonceagainrecognizedme. Onthefollowingday,Danielsvibrationfellagainbecauseitwasnotwhat hewaslivingthroughatthatmoment.I,ontheotherhand,spentthenext weekhavingenormousphysicalenergy.IdidthingsthatIneverhaddone!I wokeupatsixinthemorningandwentrunningonthebeach,dancedallday outofhappiness,andIhadaconstantreligiouskindoffeeling.Duringthose momentsInoticedmyenergywouldfall,butjustabit,andmyobjective wastobeandlivethatway,withthatkindofenergy.

184

IalsounderstoodthatwhatIwasexperiencinghadnothingtodowithonly thedrug.Themarijuanahadsimplyopenedadoorthatwasreadytobe opened;thedrugonlyfinishedtheworkthatIhadbeenatforyears.That wasthegreatestgiftthatIhadreceivedinallofmylife,becausethenIfelt withfullstrengththatYouexisted.Eversincethenmylifehaschanged,ever sinceIliveeverythingmoreintensely.Ialsounderstoodthateachoneofus carries this divinity within us, that each one of us has this magic being hidden under the layers of preconceived notions and conditioning. To observethishasbeenagrandvoyage!IseetheHigherSelfalternating withtheLowerSelfinothersandmyselfanditsfascinating! So I say to you: everything done with love, with care, with reverence and following an explicit order from the Heart, is doneinMyname. Itssobeautifultodiscoverthis!Well,wespokeofdrugs,ofloveandsex andIbelievethatwehavetotalksomeaboutabortion.Inamoreelevated worlditwouldnotexist,butinourworlditsareality. In a world of more evolved people, the energy of love is equivalenttotheenergyoflife.Lifeislove,loveislifeand whenyoubetonlife,andwhenyouloveitsunthinkabletohurt anymanifestationoflife. Andso,thisisonlytruewhenthe energyvibrationiselevated,becausefromthatmomentforward everythingthatyoudoisconscious.Inyourdimensionthisis not the case. Much of what you do is still completely unconscious.Thiscausesyoutocreateallkindsofunconscious events,manyofwhichyoucannotconfront.Thatiswhyyou createchildrenthatyouhavetoabort.Energetically,abortionis somethingterrible,butevensosometimesitsbettertoabort insteadofcarryingthroughyourlifesomethingthatyoufeelis a cross to bear resulting from an unconscious act. The best wouldbe,ofcourse,nottoactinanunconsciouswayandnot havingtodoanyharmtolife. Explain me one thing. If we are energies of eternal souls incarnated in physicalbodies,atthemomentthatawomanispregnantsheisservingas thechannelforoneofthesesoulstocometothephysicalworld.Isthatit? Yes.

185

Well, this makes me think of the spiritual people who say the karmic consequence of an abortion is very serious since we are preventing the arrivalofsomeone,whowantedtoreachtheworldthroughus. Everythinghastodoon how youact, how youthinkand how youfeelwhenyouact.Ifyouhaveanabortionandatthesame timeyoutakeadvantageofthatexperiencetolearnandbecome conscious,consequenceswillfollowbuttheywillnotweighon you, because you would have learned from them. What you havetolearnaboutabortionisthatyouaredealingwithanact thatdoesnotreflectlove.Thisisnotbad,becausenothingis intrinsicallybad,butitsnotsomethingofyouwhichisthebest. Ifyoufeelyouhavetodoit,doit,butreflectonwhytheenergy ofloveisnotflowinginyourlives,thinkaboutwhyyoudid somethingwhoseconsequencesarenotpleasingtoyouandnow youhavetoremedythesituationbydoingviolencetoyourown body. Reflect on this, learn from this, but do not blame yourselves! Everyonemakesmistakes; theimportantthingto understandisthatmistakesareacrytobetteroneself. Be careful because karma is inside every one! Regrets, feelingsofguilt,selfpunishment,allofthisiskarma,orrather, itstobeenergeticallycaughtinthekarmiccycle,becauseof somethingthathappenedinthepast.Whateveryouhavedone, try to understand it,and go forward,live in the present and leavethepastbehind.Manywomenarefilledwithafeelingof guiltaftertheabortionandguiltisadangerousemotionalblock thatleadstonewunbalancedattitudes.Manytimesthesesame women want to have children at any cost, without first recognizing the problem that lead to that first situation of conflict.Andso,ofcourse,thereareallkindsofproblems:they canthavechildrenortheyhaveproblemchildren.Theformula tonevergetcaughtinthistypeofconfusionissimple: only create children when you are filled with energy of love for yourselvesandfortheotherperson.Andwhenyouhavesex withouthavingthisintrinsiccertaintythatyouareoverflowing with this energy of love, protect yourselves and dont have children.

186

Why? Because, otherwise,youarehavingchildrentoseal ahole energetically, and you are not helping yourselves or your childrenbydoingthis. In regards to your question about karmic consequences in anotherlevel,itsfoolishness.Theonlythingthathappensisan energyreflectionofyouremotionalact.Inregardstothesoul thatwasrejected,justlikeyou,itdidntlivethatexperience bychance.Ithadtoliveoutthatpainjustasyoudid;ithadto go through that in its specific experience to evolve in its personalgame. Yes,butsomepeoplebelievethatthesespiritswhichwehavekarmicdebts couldmakeourlivesdifficult,thesamewaythattheybelievethatdifficult relationshipsarekarmicdebtsthattheyareresolving. Thisisrightandwrongatthesametime.Ofcourseitcouldbe that some of your problematic relationships could be the continuationofencountersthatwerentresolvedinanotherlife. Asitspossibletoothatwhenyouliveagreatlove,thatisthe continuation of something that already exists in another dimension,beyondspaceandtime.Butitsimportantthatyou understand something: a karmic debt doesnt exist. There isnt anything that you have to pay for or something for whichyoumustbepunished!Noonehasakarmicdebt withanyoneorwithnothing,becauseeveryoneiscompletely responsiblefortheirdestiny.Theworldisforeachandevery oneofyouanindividualchallengethateachoneofyouhasto overcomeemotionally. Ihopethatyouunderstandthis,becauseitsveryimportant:the universalprincipleofcauseandeffectisnotonethatreflects thespiritualpostureofvengeance.No!Causeandeffectispart oftheartisticprincipleoflife,thedivineactofcreation!You createeverythingthatyouknowjustasanartistcreatesapiece ofartthatcouldbebeautifulorugly.And,ofcourse,thebeauty oruglinessoftheartpiecewilldependonlyontheperspective whichtheartistdecidedtoobservethatwhichhecreated. If you meet a person, its not because they owe you something or you owe them. You have met because you

187

desiredso,evenifunconsciously,becauseyouhadtomeet,you had to develop, because this specific encounter opened up a newopportunitytolearn! Illtellyouanotherthing:dontbeafraidofanyoneoranything, notofspirits,notofpeople,notofthefuture,notofdisease.Or, ifyouareafraid,breathedeeplyandrecognizeinthisfearthe challengeoflove.BeforeIsaidthattheenergyofloveisthe bestprevention.Itisalsothebestprotection!Fillyourselves withthisenergy,becomedrunkonit,enrapturewithitand,in fact,youwillperceivethatnothingcantouchyou.Thingscould physicallytouchyou,butnothingcantakeawaythestrength thatyoucarryinside.Onlylovecandothatinyourlives!And theSciencehelpsyouunderstandhowyoucanfillyourlives withthisenergy... Butdoesthismeanthatitdoesntmatterwhatwedo,thereisntadivine punishment? No,andwealreadytalkedaboutthat!Youpunishyourselves. And you can forgive yourselves at every instant for all the foolishness that you have done and start from scratch. Everythingdependsontheperspectivethatyoutake,andthe energyinwhichyouvibrate.Whomeverisfilledwithlovedoes notsufferthepastanddoesntfearthefuture,eventhoughthey mightfeelfearandpainsometimes.Butthesefeelingsdont movethisperson,becausesheseekstoliveinthepresentinthe bestwayshecanlive.Practicethisandyouwillseethatits true.Painandfearareenergyvibrations,theyareemotionsthat ariseandcometoexplaintoyou somethingaboutyourselves. Receivethemessage,understandwhatitsaysandgoforward. Dontfeedthesekindsofemotionsbythinkingtoomuchabout them!Painwhichisfedbecomessuffering,itsheavyandvery annoying;fearwhichisfedbecomescowardiceandthatiswhat paralyzesusmost.Orrather,becarefulwithwhichyoufeed withthestrengthofthought,becausethisforcewillcreateyour future. Wow,wearetalkingaboutsomanythings!Wespokeofemotions,love, drugs,sex...IfIthinkaboutit,all ofitinvolvespleasure.Whatisthereal

188

rolethatpleasureshouldplayinourlives?Howtohavethemostpleasure withoutallthesideeffects? Havepleasure,butdontbeattachedtothemormissthem.Live eachmomentwithpleasurebutdontseektohavepleasurewith eachmoment. Whatdoyoumeanbythat? Payattention!Iamnotsayingthatyoushouldnthavepleasure whenyoucan.Onthecontrary,ifyoucancreatepleasureby making beautifuldinners,ordrinkingabeerwithfriends,or goingtoseetheSunriseonthebeachorbylookingatthestars whilehuggingyousignificantotherclose,thisismarvelous. What I am saying here is that its important to differentiate between superficial pleasure and a profound pleasure. Superficial pleasureisaconditioningandavice,aprofound pleasureistheessenceandtheobjectiveofexistence.Totruly loveistofeelaprofoundandintensepleasureanditstolive doingeverythingpossibletocreateineverymomentavibration ofbeautyandofrealpleasure.Inthebiggestpleasuresthatyou create you mix pain and happiness because therein lives fulfillment. Orrather,ifyoulivewithpleasure,youknowhowtoenjoy every new instant, and you will know how to create other moments of pleasure, and its because you pay attention to everythingthathappenstoyou.Inthiscase,inevitably,your attentionwillcauseyoutodiscovernewprofoundpleasuresin everylittleevent.Eveninpainandindiseaseyouwillbeable toseethehandofLifeandthiswillfillyouwithgratitudeand thisgratitudewillbeaprofoundpleasure. Ifyoureceivethegiftoflivingagreatpleasure,andbecome attached to it and start living in function of it, seeking it desperately,thinkingonlyofitandyouforgettobeattentive andliveeverymomentwithpleasure;Inthiscasethepleasure becomes a superficial searchthat fillsus withthefeelingof lacking and anxiousness, and is no longer a pleasure. Real pleasure is beyond form. Please understand this. From the momentthatyougetattachedtosomeoneorsomething,real pleasure ceases. The freer and more flexible you are

189

emotionallymoreyouwillvibrateinlifeandinsex,andthe moreyouwillhavethekindofpleasurablequalitythatIcall transcendentalpleasure,ortheonlytruepleasure. Wow!Andwhatarewewaitingfortolivethisway?Whatarewewaitingto liveouttranscendentalpleasuresbyourselvesandwithothers? Conscience.Itsimpossibletohaveanecstaticlifeorsexuallife forthatmatterifyouareunconscious,itsimpossibletoliveout realandgoldenpassionsifyouliveinanunconsciousmanner. Start step by step, develop your attention, and develop the Science at every new instance in your life. When you have incorporatedallthatwehavetalkedabout,youwillnaturally starttodevelopyourquotidian andyourloveencounters.But beforethatyouhavetoseektobefulfilledalone.Whomeveris notfulfilledalonewillfindthemselvesmissingsomething,and willstealtheenergyoftheonetheyarewithandwillberobbed themselvesandsoforth. But,eventhoughIpracticetheScience,Istillmisslove,Imisspeople,Ifeel pain,andIfeelallthesethings!Isntthisattachment? Noonesaidanythingaboutnotfeelingthesethings!Infact, when you practice the Science, you feel everything more intensely! We are talking about two different qualities of feeling. There is the lack of love which blocks you energetically, which weighs down, which makes moving difficult.Itsthatsensationthatthepersonisthevictimoflife, thatheisalonelyperson,whodesperatelyneedssomeonetobe happy. Its the search for a superficial pleasure that I was talking about; or rather, the person concentrates all their expectationsofhappinessinafictitiousentity,inanenchanted prince or princess and in a far away future. In the present moment, meanwhile, we are dealing with a person that is unhappy,thatvibrateslittle,thatspreadsthiskindofvibration aroundthemandobviouslygeneratesthiskindofvibrationin theirownlives.Thereisthereasonwhymanypeopleneverfind theirenchantedprinceorprincess,whichhavealwaysexisted, orworseyet,whomtheyfindandtheycantlivewiththem! Becausethesepeopledontunderstandthatbeforeeverything

190

they are responsible for their own happiness. This lack of conscienceisverydestructiveandleadstoemotionalterrorism betweenfriends,parentsorbetweencouples,becausetheytryto fill each others holes, and both dont notice that this is a bottomlesshole... Howso? I repeat: when you feel this sort of lack, you seek another person to make happy. You search for it because you are unhappy and unsatisfied.What happens thenwhenyoumeet another person? In the first instances you feel the energy of passionthatshowsyouthevibrationalcapabilitythatyoucarry insideyourselfandthatisveryhighinallhumanbeings,and whichyoucouldreachifyoulivedinanimpassionateway.But sinceyoudonthaveconsciousnessofthis,sinceyouliveinan unconscious form, in a short time this vibrational level falls again.Andsoonyoureturntoyourstateofnormalcy,youstart to become together that which you were alone or rather, unhappy,boredorunsatisfied!Youstartthentotakefromthe otherlostenergy;youstarttodraintheenergyfromtheother throughsexoremotionalchargingorotherforms! WhenyoupracticetheSciencethough,youliveinafulfilled manner, you live every instant fully. Even though you have momentsofsadnessorpain,oryoumisssomeone,yourather understandthesemomentsasemotionallynecessary.Youare happytohavethem,playwiththem,happytofeeleverything andbealive!Intheend,youarehappyandsatisfiedandyou vibratemuch.Inthiscase,youcanfeelthelackoflove,butnot because you are unhappy but because you are happy, so enchantedbyLife,soimpassioned,thatyoufeellikeyouare overflowing, that you feel that you have to share this with someone.Andplaywiththis,sulk,cryabittogetakissand soon laugh, you are light, free and loose and you play by yourself and with others, and you play simply because you understandthatlifeisabeautifulplay!Onlyinthisinstantyou willcomprehendthefactthatIcreatedyoutoloveoneanother, Icreatedyouforlove.Whenitwassaidloveoneanother,or

191

loveyournextonesasyouloveyourselves,thismeant,be andmakeothershappy!!! Goddess, You leave me without words, without questions or answers. I meanthatYougivemeabeautifulsensationoffulfillment.Itsasifallthat YouhavesaidisallthatIhavebeensearchingfor,itsasifIhavefounda greatlove. Andthatsthewayitismydarling.Thisisaloveencounter betweenMeandyouandwithalltheoneswhoreadthebook. Thisisnotachanceencounterforyouthatwritesitandnotfor theonesthatarereadingtheselines.Thisistheresultofagreat battle,ofagreatsearchfromallofyou;itstheendpointofa journeyandthebeginningofanother,likeallthegreatlovethat risesup.Youare,asyouasked,beingthevehicleofLight;you aregivingbirth,Antonella!Thankstoyourgreatfaithandyour immenselove,Icanmanifestmyselfthroughyou!Thankyou. I...Dontevenknowwhattosay.Iknowthatabeautifulday,afterIresolved allthatIhadtoresolveemotionallyuntilthatmoment,Isatandstartedto writetheselinesthatIhadlongedtowritelongago.Ithasbeenawhilethat Inoticedthatthelovebetweenmenandwomenisincrisis,thatthesituation ischaotic.Whomeverismarriedwantedtobesingleandwhomeverwas single wanted to get married. The fact is that deep inside everyone is dissatisfiedandtheirrelationshipsreflectthat.Iseeeverywherecomplicated relationships,relationshipsbreakingapartoronesleadingtoterriblefights andterribleconflicts... Yes,yourrelationshipsreflectyouremotionalworldandreflect yourselves as well. The hearts are sad and revolted because almostnoonelistenstothem. YesandsoafterIcompletedallthenecessarystagesofmypersonalpath,I startedtowritethis.Andhowitstartedtoflow!Thewordsflowedoutofme asiftheywerepartofgivingbirth!Itwasaninevitableprocess.Itspure LifegrowingfrommyhandsandIhavelittlecontrolofwhatishappening... So, observe this process attentively! See in this the inherent mechanismintherealizationofdreamsandpleasetransmitthis. Shallwestudythis?

192

Letsdoit. Firstofall,youarriveatthemoment,andthemomentarrives foreveryone,wherethepersonreachesacrossroad.Itsakind of check mateoftheheart.Thishappens sometimesduring eachoneofyourlives.Thesooneryourecognizethismoment, theeasieritwillbetoreachyourdreamsandthelessyoushall suffer.But,evenifyoutakeawhiletobecomeconsciousof this,youhavetorealizethatitsnevertoolate.Youalwayscan, even if you are old, and youshould, risk everything for the callingsoftheheart! Well,whenyoureachthiscrossroad,beawarethatyourheart hasbeencomplainingforawhile.Someofyouliveestranged ofthemselvesthatyoudontevenknowthatthebadfeelings youvehadaredesperateappealsofyourheart!Thesepeople even forget the dreams they had; they even forget how to dream.Ok,thesepeoplewillhavetogostepbystepandwill havetoseektorediscoverwhattheirdreamsare,understand howtodreamandfinallylearntofightforwhattheydream about. Ithinkthatswhathappenedtome... Explain. Before,whenIdidntknowthatIwasresponsibleformyhappiness,Ionly followed the apparently good things that came before me and that were presentedtome.Itcouldhavebeenaclass,oratriporaboyfriend,andI didntreflectonhowtochooseandIdidntaskmyselfhowtoact.Ididnt understandanythingofmyheart!Anditscaredmetodiscoverthatamong the good things many timesterribledifficulties wouldariseand difficult painstoovercomewouldsurface.ThenIcomplainedofhowlifecouldbeso unjustwithme... Yes. Every rose at the same time can present you with the beautyandodorofitsfloweraswellasitcouldhurtyouwith itsthorns...Ifyoucantunderstandthatthebeautyoftherose liesnotonlyintheflowerbutalsoinitsthorns,andthatoneis partoftheother,youwillspendyourlifetryingtocutthorns

193

and as a consequence, kill the flower. Or rather, enjoy the beautyandthepleasurebutunderstandthatpainanddifficulties areanecessaryandinevitablefaceofthiscoin.Livebothfaces withenjoymentandcourageandunderstandthatonlyinthis wayyouarelivingfully. Yes, thats the first thing that I learned! Pleasure never came without bringingsomepain,andthatpainalwaysannouncedapleasureandsoforth. Everythingisinterconnectedanditsveryinterestingtostartseeingthese interconnections. When I started to observe and see these processes, I stoppedconsideringmyselfavictimoflife.Istartedtounderstandthat,I couldobservepainsandpleasuresandthatIcouldbe,inadeeperlevel, responsibleforthem! Yes,thatwasagoodconclusion. Wow,ittookmeawhiletounderstandthat!Ihopethatthepeoplethatread thisarefasterthanIwas...ManythingsthatIreadhelpedmealot,and manyencounters,andmanythingsthathappenedtome.Butitwasonly fromthemomentthatIrealizedthatIcouldcommunicatewithLife,thatI andeveryoneelsecouldfaceapersonalandpracticalrelationshipwithGod andadirectinfluenceintheevents,thatIunderstoodthatIhadtoputthat intopractice!Ihadtounderstandhowtolivethatout!AtthatmomentI beganagaintobelievethatmylifehadmeaning,andIhadtofindoutwhat thedeepermeaningwas,IhadtounderstandwhatLifewantedoutofme,so IcouldreachallthatIknewandallIdidntknowthatIwantedoutoflife! ThatiswhyIwenttotheSantiagosJourney,followingforthefirsttimea crazydream. IntheJourneyIlearnedtocommunicatewithYou,toknowYourpresence intheevents,intheemotionsandinthelittledreams.Andonlyafterthe SantiagosJourney,Iunderstoodtherealimportanceofdreamsinourlives. OnlyaftertheSantiagosJourneythatIrememberedthatIalsohadgreat dreamsandonlythendidIhavethecouragetoadmitthemtomyselfandact infunctionofthosedreams Infact,sincewearetalkingaboutthisIhavetotalkabouttwolittlebooks thatIreadandthatareverybeautifulbecausetheytalkabouttheimportance ofdreams.OneiscalledJonathanLivingstonSegulfromRichardBach andtheotherisbyanAustraliancalledSergioF.Bambarenanditscalled

194

The Dolphin. Story of a Dreamer. Among others, these books help to awakenustothisrealitythatiswithinuswhichwecalldreams. Asyousaid,wearetalkingaaboutareality,anditisinfactthe onlyrealthinginyourlives.Youarefleetingbeingsthatpass throughaninfiniteamountoffleetingmoments.Therearebad momentsandgoodmoments,thesamewaythatinnaturethere aresunnyandrainydays.Youmustunderstandthatboththe Sun and the rain are necessary. And you must search the essencebehindfleetingthings.WhyaretheSunandtherain necessary?Becausetheyfeedlife.Andyouneedtodothesame thingthatnaturedoes,youneedtolearntolivethroughbadand goodmomentsandthatthemostimportantthingisbeyondthe moments,themostimportantisintheessence,anditsinlife. Livethemomentsfully,dontconfuseyourselfwiththemand dontloseyourselfinthem.Pullaninvisiblelinethroughthe upsanddownsyoulivethrough.Thislinewillatthesametime betheheadingandthepath;thislinewillbemadeupofyour dreams.Yourdreamsdefinewhoyouareandwhereyouare headed,dreamsgiveyouadesiretolive,dreamsreconnectyou withMe.Liveforyourdreamsandmakeeverydaypartofa dreamyouwanttoliveMakelifeadream!Itisuptoyouand onlyyoutodoso! Andso,oneday,whenyouleastexpectit,youstarttolisten,likeIdid,as manyarelistening,asmanyheardbeforemeandmanywillhearafterme.A voice,awhisper,a...So,howcanIexplainthisconversationwithYou? Whatisreallyhappeninghere? IamtheMusicthateachoneofyouwantstolearntoplaywith perfection,Iamavibration,themostsubtleofvibrations,Iam yoursoulandthesoulofeachoneofyou.Iampureemotion.I dont speak to you,Ivibratewithinyoulikethesoundof a string of an instrument. The better tuned the instrument, the betterthesoundvibrates,thepureritresonates,themorerealit isandthemoreofMeitexpresses.ThisishowIam,Iamthe essenceofsound,Iamanemotionalvibrationandwhenyou cleanyourselvesoryoudeconditionyourselves,whenyouare polishedandshinylikeadiamondthatwascarefullypolished,

195

atthismomentyoustarttoreflectMe,atthismomentyoustart tofeelMe.AndIstarttooverflowoutofyou,intheformof words,ofsounds,ofgestures,ofcaresses,ofhumanwarmth,of laughter,oftearsandfinallyintheformofLightandLove.I am the essence of enthusiasm, of ravishment, of dither, of inspiration;IamthehighestandmostsublimePassioninside yourselves. So I say to you: dont be satisfied with just anything,lookforthesublime,feelthesublime,thinkofthe sublime,bethesublime,liveoutthesublimeineachmoment, becauseIamthesublime. Yousaythingsinareallyincredibleway.Andascrazyasitsounds,itis profound, sometimes I have the impression that I am talking to a child. BecausesometimesIthinkthatYouaremakingfunofme,areYouplaying with me? The other day I was scared because twice something strange happenedtomeandIdidntknowwhattothink.AlittlelaterIhadthe impression that You were playing with me! They were two aggressive eventsinwhichIalmostbrokemyglasses,andIunderstoodthefirsttobea warning.Iwaspressingveryhardfortwobigdreamswhichwereonthe cuspofbecomingreality.This,ofcoursemademeveryenthusiastic,made medream,Iwaskindofsilly,sillierthanIusuallyam!ButIknewIhadto becareful,thatIshouldntoverreachonmydreamingsoIwouldntlosemy headbeforeIreachedmygoal.Iunderstoodittobeawarning.Atthesame timeIwasreallyafraidofdreamingsoloftily,andIknewYouknewmy fear, and that You never got tired of my dreaming. I suddenly had the impression that You simply wanted to accentuate the suspense in the situation,andgivemealittlemoretofear!IfeltasifYouweretellingme: All right my darling, dont get too worked up, ok? Is it possible that sometimesyouarejustplayingwithme? Ofcourseitis!IdothisbecauseIadoreyou,becauseIloveto play, because I know that you are going to notice and get annoyedandyouaregoingtobehappythatIamplayingwith you...You canbeadultsbecauseyouarepassingthroughthe fleetingmomentsofbeinganadult,justasyoupassedthrough thetimesofbeingachildandjustasyouwillbeoldoneday, thistoowillcometopass,andnoneofthisreflectsanabsolute reality.Theonlyabsoluterealityisthatinsideyourselvesthere isaHeartthatdoesnotknowage,animmortalHeartthatloves

196

andvibratesbeyondtimeandspace.AHearthasthevitalityof achildandtheknowledgeofapersonthathaslivedeternally andknowsmuch.StudythisHeart,giveitattention,tryandget itblossomandsingandvibrate,andonlythiswaywillyoulive withalltherichnessthatlifehastooffer ButitsveryhardtounderstandtheHeart...Iknowthatwealreadytalked aboutthis,butIhavetorepeatit.ThereisaphrasebyPascalthatsays:The hearthasreasonsthatreasondoesntknow.Verywell,itstrue,theHeartis beyondreason.SometimesitevenseemsthatHeissayingwhitewhenin realityitmeansblack,andsometimesitsayssomethingandasecondlaterit saystheopposite! Its because the Heart doesnt know forms, its because it doesntworkinalinearformlikethemathematicsyouhave beentaughttothinklike.TheHeartismultidimensional,itsa vibrationinsideandaroundyou,anditsanenergythatflowsin your body and in your lives. We give this energy the name Heartbecauseintheheart,inthisspecificorganthatyouhave, isthegreatestflowofbloodconcentrated,itsinthisorganthat lifegetsitsrhythm.Theheartorganis,physically,whereyou findthechakrathattakestheenergyoftheHeart,orofLife,to yourbodies.Thisorgantalkstoyouconstantlyoftherhythmor rather that every thing has its time, this organ contracts and expands,itbeatsfastorslowlyaccordingtowhatyoufeel.And theenergyoftheHeartcanflowwelloritcanflowbadly,and thisdependsonlyontheinteractionofyourperceptioninthis process,everythingdependsonthelevelofconsciencethatyou havedeveloped.Understandthatnotalltheloosephrasesthat arisewithinyoureflecttheHeart.TheHeartisbeyondwords, beyond the thoughts that arise, so dont become attached to thosethoughts!Themostimportantthingisnottothinkwhat youhavetodo,themostimportantthingistobeveryattentive andverystillontheinsidesoyoumayfeelwhatyouhaveto do.Thegreatsecretisinthisfeeling.Butwearenottalking aboutanyemotion;Iamtalkingabouttheessenceofemotion. Soforexample,onedayyousitdowntowriteapoemandyou write with all your conviction, all your passion andall your strength.Butaftersometimeafteryouvewrittenit,youfeel

197

thatyoucanmakeitbettersothatitcantrulybeperfect,and youstartworkingagainonituntilyoureachadayinwhichyou knowthatthatwaswhatyouwerelookingfor.Orrather,inthe beginningoftheemotionyoustillhadntreachedthefinalgoal, butyoubelievedinit,tookyouandstepbystepinthedirection ofaperfectpoem. Yes,itscurious,andIlivethroughthatwithmuchofwhatIwrite.WhenI feelthatnaturalimpulsetowrite,Igivemyselfupcompletelytothetaskand Ifeelanexaltationandenthusiasm thatmakesmefeel asifIamdoing somethingtoitsmaximumbecause,infact,itsthemaximumthatIcan achieveatthatmoment.Thentimepassesandthatnolongerrepresentsthe maximumtome. MeanwhileIalwaysdreamedthatthereexistedapurematter.Intheend,I alwaysdreamedthatintheactofwritingandinloveamomentwouldcome whenitwouldbepure,undoubtedlyandabsolute.Iknowthatitispossible becausethereare,forexample,booksthatcausethatsensationwithinme. TherearebooksthatIhaverereadovertheyearsandtheyalwaystouchme, asiftheyhadthecapacityofchangingasIdid!Theyarebookswhichare aliveandthathelpmethroughallthephasesofmylifethatIpassthrough. AndinregardstoloveIknowthatitispossibletolivepassionatelyfor someone, eventhough thereisntmuchofthataround,eventhoughthat apparentlyonlyexistsinmovies,booksandfairytales.Butiftheyexist there,itmustmeanthatmanypeopledreamofit,andiftherearesomany peoplethatdreamofit,itmustmeanthatitspossible.Mybigquestionthen became:howdoIreachthatpurematterthatexistsinsideeachoneofus? Howdowelivepassionatelyforwhatwedo,forthepeoplethatwelive with,forthepeoplethatwemeet,andforeachandeveryday?AndYoutold me... Itoldyou:toliveforlove,tofeellove,youhavetobelove.To beabletolivepassionatelyforwhatyoudo,orforsomeone else,orforwhateveritis,youhavetolivepassionatelyforLife. Andforthistobeso,youhavetolistentoyourHeart.Jesus said it two thousand years ago: Where you find your heart therewillbeyourtreasure.Andwhathemeansbythatisall thatIhavebeenexplaininginthesemanylines;hereferredto thepurematterthatyouhavebeenlookingforwithsuchfervor, asyoucorrectlysaid,allofyoucarrywithinyourselves.The

198

Heartisbeyondwords,theHeartistheimpulse,anditsthe searchfortheperfectpoetrythroughimperfectones. Sometimes,forexample,youfeelpassionforsomeone,butthe heartsdesireisthatyoudontremainnearthatperson,because theheartknowsthatthereissomeone,somewherethatwould beabetterfit.Thatloveisonlyastepinthejourney;itsonlya stepinthestaircase,itsamomentoflearning.So:dontpull yourhairsoutwhenloveendsbecauserealloveneverends, anditstruelovethatgetsusnearormovesusawayfromwhat corresponds to real love or not. That is why: dont be thoughtlessforanykindoflove.Atthesametime,whenyou trulyfeelthat this loveisbeyondtime,spaceanddoubt,that pureemotion,whichispureandallinclusivethatallsearchfor, dont hesitate to leave everything for it! And if you leave everything,andthatisntthatlove,ifyoufailagain,learn,cry andlaugh,becauseatleastyoulivedagreatlove,andyoucan go on, because thereiscertainlyanother lovewhichis even morerealandintensethanthenoneyoulivedthrough. Imayseemimpossible,butaslongasyouarealive,youcan alwaysgetfartherwithyouremotions.Andwhenyougetto somethingthatreallycorrespondstowhatyouwant,something thatcantbetopped,thegreatactionwillbetomaintainthat level,tobeabletosoaratthehighestheightsofyouremotions. Wow.Thankyou,Life.IdontevenknowwhattotellYouanymore.Thank you,thankyou,thankyou,Life!!!ItssonicetohearYou! AndIamhere.Inthesilence.Inthevoiceofthechildgoingby. Inthebreezethatrefreshesyouinthesummertime.Iamhere, inalltheplacesandinside,insideyou.Iloveyou.Iloveallof you. AndIloveyoutoo. Amen. u Itlookslikewearereachingtheendofthisbook...Iamhappyandsadatthe sametime,asintheendofeverythingthatIwrite.Iknowthatitisntan

199

ending, I know that the end of an adventure is the beginning of a new adventureandtherereallyisntanendforanything.ButevensoIalready missitbecausethisbookreallymademevibratetothelastpage,andthis hasnthappenedbefore. Thisisbeautifulisntit? Yes,likeagreatpassion!Andsostrong!Andthisishappeningatamoment inmylifeinwhichIfeelprofoundlyrichinemotions!Iworkinatanight clubwithpeoplethatIlikeverymuch,anditsaveryfunjobeventhoughI knowIdontwanttodoitfortherestofmylife.Idomanythingsthat pleaseme,Igoswimmingintheoceanandrunningalone,Itakecapoeira andsalsalessons,Imeetpeopleallthetimeandtalkmuchwiththem,I spend a lot of time alone as well, and I enjoy each moment. Its really incredible.Butevenso,Iwontlie,sometimesIamscaredtodeath! Whatareyouscaredof,mylove? I am afraid of almost everything.Afraidof thefuture,afraidof disease, afraidoflovingandscaredofgettinghurt,afraidofnotrealizingmydreams, afraidthatpeoplethinkthatIamridiculous,afraidof thisandthat.Itsso muchfearthatitexhaustsme! At least you know that you are afraid and you dont let it paralyzeyou... Yes,atleastIgotthat.Imean,Ihavebeenpushingmyselfsothatitdoesnt paralyzeme...Butitsnoteasy! Wealreadyspokeofthis,Antonella.Youwantsomethingeasy? Gopickseashells!DoyouthinkthatIinventedthisstupendous, marvelous thing that is life so that it would be easy?? ?Imsorrybutitwouldhavebeenstupid,andifthereisone thingthatIamnotisstupid... Areyousure? Becareful,dontprovokeMe...YouknowthatIamwicked goodatplayingwithyou... Yes,yes,yes,IamsorrylittleGoddess.Now,justbetweenthetwoofus, dontYouthinkthatImrighttobeafraidsometimes?Because...lookatthe

200

currentsituation. ItsverygoodthatIam livinginaveryrichmoment, richerthananyother,reallyspecialandthatthisbookisagreatjourney. EverythingisfineandIreallythankyou!!!ButthetruthisthattheEuropean summerisendingandIhaventtheslightestideawhereIamgoingorwhatI amgoingtodo!AndIdonthavealotofmoney!ItsnotthefirsttimethatI havebeenthroughasituationlikethis,butitsthefirsttimethatIamalone onthisboat... Youareneveralone... Alright,Iknow,Iknowthatfriendsalwaysshowup,thereisanew love; somethingalwayscomesup...But... Youareneveralone.Noneofyouareeveralone.Understand this.Itsmorethansomethingcomesupandsomeoneshows up.Itsvasterandmoreprofoundthanthis.Feelthis.Believe inthis.Relyonthis.Listentothis.Andrelaxwhenyouhaveto relax. And act when you have to act. And above all, dont despair.Dontfeedthefearwiththoughts.Dontbelievethat youarealone,becauseifyoubelieveit,youwillendupfeeling andlivingthis!Feedfaith,feedcourage,andfeedlove. Yes,Goddess,yes,Love.YouknowthatIhavebeentryingto dothisall theseyears.AndIgetbetterastimepasses!Iunderstandtheimportanceof affirmation,thinkingpositive,inthedailyconfirmationofaxe,ofpositive vibrationoftheyeahyeahyeah,andintheenditdoesntmatterwhatwe callit.Butletsgotothepracticalside.Theoryisgoodbutwhatreally mattersispractice.Andthequestionisverysimple:whatnow?Whatshould I do? I am in one of those moments, where nothing comes to mind, whiteness. Thatisnottrue.Nowyouknowyourdreamsandyouknowthe mostimportantthingis toactinawaytoreachthem.You knowtheScience,andyouaremuchfartheraheadthatalotof peopleintheirPathtotheirgoals! Goddesses,isitjustmeorareYouirritatedwithme? My patience is eternal, just not infinite...Kidding. Do you rememberthepoembyViniciusdeMoraes?Thatlovebenot

201

infinitebeyondwhatitis,butbeeternalwhileitlasts.Itwasa geniusthoughtthatIinvented,isntit? You?! Andwhoelse?Iinventedeverything,everythingbeautiful.How ithurtstobesomarvelous... Andtheuglinessthatexistsaround? Thatisyourwork;Idonthaveanythingtodowiththat! Nothing? Well,alright,justalittlebit,ok...Itspartofthegame...Andif Iamthegame...Well...Okay,youwin.ThatiswhyIamhereto helpmakethingsbetter,isntit? Itsabouttime!!! Alright,dontpushMypatience.Infact,sayalittleprayerfor MethenexttimethatIcantendureyou.Ineedtofeelthatyou noticeMyefforts! Illtrytoremember. ThatswhatannoysMe.Youallremembereverything,toputon deodorant,toputonlipstick,tosmiletothefellowonthestreet, butwhenIaskforsomething... Mygoodness!TheGoddessisjealous! Justalittlebit,ok...ItsthatIneedtheattention... Iknow,Iamlikethataswell.Iamalwaysgoingtotrymybest,Iamgoing totrytoalwayshearyou,andalwaysseethebeautythatYougivemeevery day,andalwaysfeelyourpresence...AndalwaystalktoYou. And Iwill always beherefeelingthe strengthofyourlove, beingtheforceofyourlove,guidingtheforceofyourlove. TrustMe,becauseIloveyou,darling. IloveYoutoo.But...Whatdoyouthinkabouttalkingaboutthepractical sideanyways?

202

Wecantalkaboutwhateveryouwant.Ihaveallthetimeinthe Universe,whodoesnthaveitisyou. Yes,itstrue.Ivealwayssaidthatlifeisshort,notbecauseIwantedittobe short!BeforeIevenwantedthatittobebecauseIdidntbelieveinlife,I didntdream.Butnow...ThesedaysIthinkthat,ifIamwithsomeone,I wanttoliveaslongaspossible,untilIamveryold,andaverysmartold lady,verysexyandcrazy.Buteventhough,ifIthinkthatthislifeends,it doesntmatterhowmuchitlasts,itsstilltooshorttodoallthethingsthatI wanttodo. You will do muchmorethanyoucanimagine,as youhave donemuchmorethanyouhaveimagined... Alright,Illbetonthat.LetsgolittleGoddess.ExplainthethingsthatI wanttounderstand.SoIrepeatthequestion:whatnow? Nowwhat? WhatshouldIdo,huff! Whateveryouwant.So,whatisitthatyouwant? Well,tobehonest,Idontknowverywell. Liar. Okay,itsalie.IknowwhatIwant,butitseemssodifficultthatitscares me. Nothingisimpossiblewhenyoubelieveit,remember? Yes.ThetruthisthatIneverreallybelievedsufficientlyinanything. Thatsalieaswell!Stopwiththat,Antonella.Lookatthisbook thatyoujustfinishedwritinginrecordtimeanddoingmany otherthingsatthesametime!Dontyouthinkthatyouneeda lotofstrengthandfaithtoachievethis?Illtellyousomething, andrememberthis:noneofyouareperfect,andthisisafact. All of you make mistakes and that is a fact. But the worst mistakethatyoucanmakeisnottoloveyourselves!Itsthe worstmistake,notbecauseismorallywrong,notbecauseits something forbidden, no, its only a mistake because its an

203

energydelay;itsabreakthatyouputonyourselves!Whoever doesnt love themselves cannot love others, whoever doesnt lovethemselvesstagnatesinthepathtotheirdreams,whoever doesntlovethemselvesclosesthemselvestoMe. Wow,thatmakesmethinkofyesterday.Iletmyfearstakeoverme,fearof thefuture,fearofanencountertocome,fearbecauseofsadnessforalove thatIknowIcannotcontinue...AndsuddenlyIlostallmyenergy!Itwas impressive!Icouldntsmile,ordance,mybodywasheavy,andIwasvery tired!IlookedatmyselfinthemirrorandIsawthatIdidnotshineonebit, yes,Iwasugly! That is why I always say: be careful with the feelings and thoughtsthatyoufeed.Youalldoitunconsciously,andlater yougetsick,orsomethingterriblehappensandyoudonteven know why! The answer is very simple: you are completely responsiblefortheenergybalancewithinyourselves.Ifyouare fine,ifyouarestrong,ifyouthink,vibrateandliveinahealthy way, this creates an energy shield for you and around you. Insidethebodythatiscalledimmunity.Andoutsidethebodyit worksinasimilarway!Ifyouloseyouremotionalbalance,you soondosillythings,soonthebodyfeelsit,soonthedefenses arelowered,andthevirusesandthebacteriathatarealways insideandaroundyouwillreproduce,attackyouandhurtyou. Inlifethingshappenthesameway!Thatiswhyitssaidthatan evil never surfaces alone! Because, opening the energy defenses,byfeedingthoughtsoffear,weakness,beingdown, sadness, you become susceptible to this kind of energy, you literallyattractthiskindofenergy!Atthesametimethat,you believeinyourownstrength,youdoeverythingtobewell,if you work with this positive energy, living with enthusiasm, influencetheenergyfieldaroundyouandinsideofyou.Weare talkingabouttheconceptofwhiteandblackmagic,whichare nothingmorethanthewaystomanagetheScienceforgoodor evil. Youtoldmethatyesterdayyousawyourselfinthemirrorand didntseeanyshine,youthoughtyouwereugly.Andthatis whatreallyhappenswhenyouarewithoutenergy!Beautyisnot somethingphysical,beautyisastateofthespirit,beautyand

204

theshineofenergyvibrationsarethethingsthatreflectthewell being of a person. Many times a person that has common physical features could seem beautiful and a person that is beautifulphysicallycouldseemgross,andthishasalltodo withhowonedirectstheirenergy! This idea of maintaining the balance to defend oneself reminds me of capoeira.Oneofthebasicelementsofcapoeiraistoalwayskeepthearmsin adefensiveposition.Nomovementcanbedonewiththebodyopen,and thisobviouslyavoidsthestrikefromtheadversary. AsIsaidbefore,theWorldisagreatreflectionofMyself,and ineverythingyoucanlearnspirituallessons.So,allthemartial artshavephilosophicalprinciplesthatareusefulinthedayto day life. The fighter knows that during the fight, every movementthathemakes,everygesture,everystepcounts!The fighterknowsthevalueofattentionandknowsthatthepriceof lack of attentioncanbefatal!So,observelife,andyouwill noticethatthereisaspiritualfightgoingoninsideeachoneof you.Itdealswiththefightthatisfororagainstyourselves. AndIsaytoyou:maintainyourdefenses,maintainthebody closedinonlife,butthatdoesntmeanthatyouhavetoclose yourselvesoffemotionally.Whileyouareinafightthething thatdefendsyouareyourarms,inlifethatwhichwilldefend youislove.Yes,love!Butwearenttalkingaboutfallingin love or being blinded by passion. We are talking about elevatingoneselfinlove,tousepassiontoseefarther!Because passion, like anyother energy,canbeused inanegativeor positiveform. Thepassionthatelevatesistheonewhichloveandconscience isonlyone.Whenwetalkaboutpassionwearetalkingabout the most potent energy in the universe. In order for you to understandwhatImean,Iamgoingtocompareittoanenergy thatyoucallradioactivity.Radioactivityisaverystrongenergy that is neither positive nor negative, and youhave plenty of powerinwhichwaytouseit.Youcancreatebeautifulthings withitoryoucanuseittodestroyeverything!Thesamething happenswiththeenergyofloveandpassionthateachoneof youcarriesinside.Understandthis!Allofyoucarrythisenergy

205

andthisimmensepowerinsideyourselves!Andthisenergycan be a blessing or a curse, it can be used to cure and create happiness or it couldbeusedas aweapontokill andmake unhappiness, depending on how you manage it. So: live out your energies ina conscious form! Searchthe conscience in each one of your acts! Be cautious and maintain awareness! Anddontforget:Passionispositivewhenitelevates. Themoreyoufeedthisenergy,themoreyoufeelit,themore youthinkofit,themoreyouliveitout,themoreyousearchit outconsciouslyineachact,themoreyouwillflow,themore youwillbeprotectedfromharm,andnotonlythat,butmore fortune and beauty you will find in your path! So: live for passion,livepassion,thinkpassion,feelpassion,makepassion, anddontsettleforless. Andhowdoweknowweareontherightpath? Each one of you has a thermometer of passion inside yourselves.Beobservant!Itsverysimple.Ifyouarewell,if you are vibrating, if you are full of energy, if you feel enthusiastic,ifyouhavemomentsofsadnessbutarenotswept upbyit,andfinally,ifyouarelivinginahappyway,itmeans thatyouarewalkingtherightway. ItstruethateversinceIstartedtoobserveandtrytounderstandwhatgives andwhattakesawayenergyinthelongterm,myqualityoflifeincreaseda lot.Iamreallybetterabletomanagemyenergy! Yes,becauseyoustoppedconsideringyourvariousemotional states as chances or as caused by exterior influences. You understoodthateverythingisconnectedandthatifonething happens, it has to do with your interior posturing, your perspective,theworkyouhavewithyourself. Yes. And every day I am astonished tolearnmoreand morethat itsa scienceandanart!Orrather,tobevibratingatthehighestpossibilitiesalot ofstudyisnecessary,aworkthatisconstantandcomplex,morethanany othersportorsciencerequires!Therearenovacations;thereisnorestfrom thespiritualwork!Evenrestisamovementinconsciousness,awaytodirect attention,awaytoemptythemindanddevelopintuition.

206

Yes,wearetalkingaboutabeautifulandgreatstudy,thestudy onhowtolive.Youhavegonefarinthisstudyandyouwillget evenfarther,becausewhenitbegins,itwillnotevenstopat death.Thevoyageofknowledgeisatrueandinfiniteadventure. Andthelinesthathavebeenwrittenherewillbereadbymany peoplewillfurtherdeveloptheScienceevenmorethanyou,the samewayyoudevelopedtheideasofthosebeforeyou. Bymanagingyourenergies,deconditioningyourself,orrather, reprogramming your internal computer, you improve the genetic information of all those beside you! Or rather, by reaching higher energylevels, youcanpush theenergyof those that have an energyconnection with you,tofamilyto friends. If a person can significantly elevate their own vibrations,s/hewillbeabletoenergeticallytouchtheentire world! Wow!Thatisincredible! Yes.WhoeverstartstopracticetheSciencelivesthroughmore magicalprocesses,or,surprisingcoincidences,andincredible events... Truly My energy, when released, does crazy and wonderfulthings. ThereisasongbythebandU2thatIfindmarvelousbecauseithasalotof impact.ItscalledElevationandinitthereisaphrasethatsays:Ineed youtoraisemysoul....Thatalwaysremindsmeofourtalksaboutenergy. Tellmesomething:sowereallycanraiseourenergiesandtheenergiesof thosearound?Doesthisgoforlovingencounters? Yesandhow!Payverycloseattention!Becausewhathasbeen happening generally is that people have been stealing each othersenergieswhileinarelationshiporlivingtogether.You havetounderstandthattolivetogetherisonlyworthwhilewhen youcanachieveahighvibrationwiththeoneyoulive,andif youcanraisetheenergyallthetime,youshouldbeabletokeep ithighthemajorityofthetime.Observewellyourenergiesand theenergyofothersandtakenoteiflivingtogetherraisesyou bothornot.Thisisveryimportant!Manypeoplegetusedto livingwithpeoplethatarevampiresorpeoplethatdrainthem oftheirenergyandthisisahardenergybrake.Idontmeanthat

207

youcant interactwithpeoplethatdontvibrateinthesame way. Do interact with many kinds of people because every encounter that you have in the road of life will make you advanceinsomeway,itwillteachyousomethingifyoupay closeenoughattention.Interactbutdontwasteenergy.Dont spendmoretimetogetherthannecessary,dontgetattachedor createbondsunlessthosebondsareenergeticallycompatible. Ivenoticedthisrecently.IhadfollowedallthestepsoftheSciencebutI still couldnt vibrate the way that I wanted. I still had to experience something that I was alwaysafraidof.InawayIwaslivinginagreat conflictbecauseIcouldntunderstandhowitcouldbethatthelovehadnt endedbutIhadreachedapointthatlivingtogetherwassuperfluous.Rather, livingtogetherdidntrepresentwhatImostlongedforatthatmoment!It wasverypainfultobecomeawareofthis,probablybecause,withoutbeing conscious,Igotveryattachedtoourlivingtogetherandtohim...Itsvery hardtocomprehendthis,becauseeventhoughweweretrulyinlove,still hadgreatsex,theenergythatweachievedbylivingtogetherwasntmaking mefly,itwasntmakingmevibrate...SoIstillhadtotakethisstepinthe dark,Ihadtoonceagaintotakeanunknownpath.Anditwasworthit!Ever sinceIchallengedmyselfandwenttolivebymyselfIvibratemuchmore! ThatiswhyIexplainedtheimportanceofnotgettingattached, especiallyinloverelationships.WhenintheBibleitiswritten whatGodunitedmencannotseparateitsaysthatthetruthof God, or love, doesnt end. But he can change the form and direction.Intruth,noonecanbeseparatesinceyouallare made of the same energy; you are one and the same!!! In practice, to truly love is to comprehend that the other is an individualenergypathandonemustfollowtheirheartsbefore anythingtobeabletovibrateandrealizethemselvesashuman beings. And you will only be able to achieve this kind of detachmentwhenyoubegintorealizethatyouyourselvesare energyuniversesandthateachonehastheirownpathtobe followedbythesoul. Butisntthattooindividualistic? No,onthecontrary.Thesooneryouallfindyouownpaths,the sooner you are energetically well, the better you will love

208

yourselves,andyouwillhavethosefullyrealizedrelationships thatyoudreamabout.Buttogettothiskindofrelationshipits necessarytobefreetofollowthecriesoftheheartwhereverit takesyou. Youmustcomprehendthatthegreatestloveisthe onethatwishestheonelovedthattheybehappy,independently of whether you are together with that person. In it lies the beautyofthatphrasefromtheLordsPrayerthatsaysThy willbedone.Whenyoubegintounderstandthatthebestthing youcandoistoseek,followandlivethewillofGod,orthe energyofLifethatyoucarryinsideyourselves,everythingwill bebetter.ThewillofLifeisnothingmorethantheprofound willinsideyourselves.Studyyourselvesandyouwilldiscover that. Youhavecitedtwobiblicalphrasesintheselastlines,andthisremindsme ofatopicthatwehaventcoveredmuch:adultery.Whatwastheline?You shallnotcovetyour neighborswife...Thisisatrulygreatculturalcross andpeoplefeelmuchguiltandweightontheirconsciousnessbecausethey believethattheyaresinningbybeingadulterousortoprovokeadultery. Howshouldwefacethis? Regardless, wheneverlove,admirationanddesirecomeup,Ialwaysask myselfwhattheharmisinshowingit,evenforafewminutes.AndIalways wentwithacalmconsciencethatIwouldneverstopaboyfriendorhusband frombeinglovedbyotherwomenwheneverhewishedit.Faranyharmthat itwas,Ialwayssawmyselfinthewomenthatgotclosetomyman!Not rivals,notenemies,simplywomenthatwerefeelingthesamethingIwas feelingaboutthatmarvelousman,thesamethingIkeptfeeling!Andwith goodreason,becausewomenlikemealwayshavegreattaste...Afterwards, theproblemthatIhadtoresolvewasntwiththem,itwaswithwhathe wantedandintheendthebiggestproblemwaswithmyself,andthebiggest challengeofthosesituationsputinfrontofmeishowIshouldreactinthat situation.Ihadtounderstand:whattothink?Whattowant?Whattodo?I knewthatIshouldntfollowanysortofformulaonhowtoreact.Iknewthat everynewsituationrequiresanewreaction.Atlast,Icantcomplainabout theresults.LookingthefreedomthatIgavemyselfresultedinme living through many beautiful, difficult, comic, painful, unusual and interesting situations.

209

Well,thetruthisthattheproblemthatrevolvesaroundadultery isthatitsanenergeticallyheavyword,andalotofpeople linkthingsthatareincompatiblewithmoralruleswhenthey cantadmittothemselvesorotherswhattheydesire.Andthis causesgreatsuffering. You all decide to carry these useless burdens. You make yourselvessuffer;makingyourselvesprisonersofsentimental games,andjustcausesaheavykarmiccycletorollonandon! Thetruth,realitycanbeassimpleasabutterflyflappingits wings in the breeze! If no one belongs to anyone else its impossibletowishforthemanorwomanofanother.Andatthe moment that a woman or man is energetically the other persons,whichnaturallymeansthattheirpassionateenergyis concentrated on that specific person, its a waste of time to desirethembecauseitsanemptydesirethatwillleadnowhere. Ibelievethatanswerseverythingaboutadultery. Astothemoralaspectitsjustbullocks.Theimmoralityis nottolovewhenyouhavetheneedtolove,beitabaker,a milkman or the president of the republic, and the second immoralityisnottohavethecouragetoconfesstooneselfand toothersyouwanttolovebecauseitsnothingtobeashamed of.Apersonthatconsidersanykindofloveimmoral,thatis worriedwithwhattheotherpersondoeswiththeirloveortheir body,actsassuchbecausetheyarenotwellresolvedwiththeir bodyortheirownlife.Apersonlikethatisbadlylovedor rather,isapersonthatdoesnotlovethemselvesandinturn cannotloveorbeloved.Orworseyet,itsapersonthatloves themselvessolittlethattheydependontheloveofamanor womanandgetsterriblyjealouswhentheydividetheirenergy of love with people other them! Perhaps you should stop pointing the finger of adultery and start thinking about the pointinginthedirectionofjudgmentandjealousy!Iamkidding ofcourse...Dontpointyourfingeratanyone.Notbecauseits bad or immoral but because its energetically useless and idiotic.

210

Becausewheneverwepointatanotherwealwayshavethreefingerspointing atourdirection...WowGoddess,Youaresomodern!Ireallydidntexpect suchrevolutionaryenergyfromYou! EvenJesusspokeinMynamesomethingclosetowhatIwill saynow:Icametoseparateparentsandchildren,womenand men... Of course this can be interpreted incorrectly, because there are always those that claim to be the retainer of the supreme truth. But, without giving room for hairy interpretations,thiscansimplymeanthatwhentheenergyof Love and Passion starts to flow, many false structures and formsfail.WhenapersonstartstofeelMeitcanfeeldrastic, causing intense changes which to an outside observer could seemasacatastrophe.Inyourcasetheselastyearsitwasan ulcerinthecornea,arecentseparation,theendoflovewith Daniel,amongotherharshevents.ButyouunderstoodthatI separate,tobetterunite.ThatIkilltohaveitrebornbetter.And soforth. Toelevateyourselfenergeticallyispainfulforallofyou,but whenyoubegintounderstandthemagicofwhatishappening youbegintoenjoythatpainhoweveritcomes!Itslikewhena childbeginstogrowandtheyfeelaterriblepainintheirbones, andparentscalmthembytellingthemthatitsnormal,andthat itsaninherentpartoftheprocess.Thatdoesntmakethepain anymorepleasurable,butinthebackoftheminditstartsto developcourageandafeelingofadventureinthechild.They becomeawarethattheyarepartofalargerprocess,thattheyare growing,andthatonedaytheywillbeadultsliketheirparents. Itsatthesametimefascinatingandscary,givesonefearand makes one dream. Or rather, everything is part of a greater magicalprocesstoemotionallyawaken.SoIwillnevertireof saying: follow the Heart, follow My will because its the deepestwillinallofyou. Well,IthinkthatIhavereallytriedtofollowYourwill.AndIbelievethat wehaveagaindeviatedfromwhatweweretalkingabout... Youknowthatyouneverstopdeviating...

211

..becauseeverythingisinterconnected.Yes,Iknow.ButwhatisYourwill formenow? That you study the Science and know your deepest desires. Whatarethey? Yeah,Iknowthem. Whatarethey? Wait a minutetherelittle Goddess!IdontthinkthatIhavetokeepon repeatingmydreamsandpersonalissues! Howcome?YouaredoingthistobethepathofLight;youare anexampleofsomebodywholivestheScience!Thatiswhy youhavetoopenlyshowwhoyouare;talkaboutthegood,the rottenandofyourdreams.Ifyoudonttalkaboutit,howare peoplegoingtoknowthattheScienceworks? Yeah, whatifItalktoomuchaboutmydreamsandthenIcantrealize them?HowwillIlook? ListenAntonella,youarenotontheTonightShow,youare notheretosayIwillrealizemydreamsorthingsofthatkind. Nooneisheretoguaranteeanyonesdreams!Itmaybethat theyarerealized,butIthinkthatwevemadeitclearafterall wehavesaidthatthemostimportantisnotthegoalbuttheroad takenthere.Howyoumakeandhowyoulivethatpath! After all, theaccomplishment ofyour dreamsdependonthe interactionoftheconsciouswill ofeachoneofyouwiththe deepestwill,rathersaying,withMywill.. DoesthatmeanthatitspossiblethatIwontrealizemydreams? Anythingispossible.Butwhatdoyouthinkisgoingtohappen? WellIknowthatforbetterorfornaught,Ihavetobelieveinmydreamsand goforward. Thatseemsterriblyfatalistandlacksenthusiasm...Itevenmakes meyawn.Ibelievethatwecanwaitafewlivestorealizeyour dreams...

212

FortheloveofYou!!!IlldowhateverYouwant!Whatdoyouwant?ThatI shoutfromtherooftops,thatIperformastripteaseinthestreets? Ithinkthatwouldmakesomemenhappy...Wecantalkabout thatpossibility...Ithinkitsagoodidea!Youmakeastriptease andIrealizeyourdreams!Thatsgood!!! Butdontwaittoolongtomakeupyourmind,littleGoddess,becauseina fewyearstheLawsofGravitywillhaveagreatereffectandifIrunnakedI amgoingtofrightenpeople! Iamreallygoingtothinkaboutit,mydarling. Now,tobeserious,YouaskedmewhatIwant.Afterwards,Isaidthatwhat counts for you to realize your dreams is an interaction between my consciouswillandyourdeepdesires.BeingthattheseareYourdesires.So wecanswitchroles,whatdoYouwantfromme? WhatdoyouthinkIwant?IfyoudontknowwhatIwantthen itsbecauseyoudontknowwhatyouwant,soIstillcanthelp you... Idontknowwhatyouwant! u Yes, thatsa whitelie.Iknow.YouwantmetofeellikeJuliaRoberts characterinPrettyWomanwhereshemeetsthegoodlookingguythatis crazyaboutherandIamcrazyabouthim!YouwantmetofeellikePaulo Coelho,whousedtobeahippyandbecameawriterknownthroughoutthe world! Aretheseyourdreams? Yes.Imean...Alright,Youwin.IamgoingtoexplaintoYoumydreams. Mydreamofloveistofindthattranscendentallove,strongerthananything, thatpassionate,romantic,withoutdoubtandinevitablethatyoufindinthe movies.Akindoflovethatissostrongthatitisbeyondtimeandspace,that leadsbothtodocrazythingsandlivewildlyforoneanother,thatissoright thatitdoesntmatterifheorIamwithsomeoneelse,wherewebothknow thatnothingcouldbestrongerthanthemeetingofourenergies.We never

213

loseourcenter,weneverletthewilloftheGoddesspassbecauseoffear, evenifHerwillbeitthatwebeseparatedandloveothers. Youwrotesomethingaboutthisawhileagodidntyou? Yes... Transcribeithere,please. ButGoddess...Ithurtstoomuchtodreamlikethis,andithurtsevenmoreto talkaboutthistotheworld!Whatifitdoesntworkout? Antonella,thisisveryserious!Dreams,ascrazyastheymight be, are childish, as extraordinary as they might seem, are a deeperrealityofeveryone.Youmuststarttoconfessthem,you havetostopbeingembarrassed,youmuststopbeingafraidof thepaintheymightcause,youmusthavethecouragetofight forthem,nomatterthedefeats!Theapparentdefeatsareonly waystoimproveyourselves.Itsspeciallythedefeatsthatteach youwhatsneededitandprepareyouenergeticallyforallthat youdesire! (DeepBreath)Letsgo.

TheEnchantedPrince

TheenchantedprinceveneratesmeasagoddessandIreverehimasa god.Wesensuallycharmandgiveourselvestooneanother.Andeachtime thathiseyescrossmine,hefeelspleasureandpaintremblingwithemotion, andImakehimhappy;IlookathimandIfeelpleasureandpain,trembling inside,andhemakesmehappy.Helovesmewithmyimperfectionsand helpsmeovercomethem,andIdothesameforhimandafterGodthereis onlyeachotherinourheartsandIwanttolovehim,hughim,makehim smile,makehimvibrate,tocreatelovesmusicwithhim,todancewithjoy andfeelGodwithinourselves.Heisstronginlifeandalsoknowshowtobe fragileinlove,heneverfearstofollowGodorIandourpresencefillsthe otherwithwarmthevenwhentheotherisnotpresent.Andeverytimethat

214

wemeetagain,evenwhenitsjustwakingupinthemorningorwhenwe return again at night, its like a party. We never let the opportunity to inundate the other with our gratitude or our enthusiasm for the others existence.Wealways,always,alwayshugwithfeeling,lookateachother withpassionandlaughandcrytogether.Neverdoubtingthatweweremade foroneanother. Everytimehegoesinsideofmeitsbecausethedesireisunbearable, itsbecauseheisfeelingmybodyandIamfeelinghistoo.Henevertouches meautomatically,neverkissesmewithoutknowingwhoIamandIhim, andwheneverheactswithme,hedoessowithreligiousness,attentionand withacrazedlove.AndsowillI.Heisalwaysstudyingme,discoveringme, uncoveringmeandIdothesame.Andhebelievesinthissomuchthatit willbeanarttohim,wherehewilltraineverydaytolovemewitheven morepassionandsowillI,andevendeathwontseparateus.Andwewill neverimprisononeanother,becauseourgreatestdesireistoseetheother soareverhigherintheskiesofloveandfreedom.Andtosoarwiththem,if Goddesires. Andwelearnfromoneanother,cook,livetogetherandenjoyevery day,withitschoresanditspleasures.Andwhenwemakeasonordaughter, itwillbebecausewefeelatthesametimethatthisisthewillofGodandof passion. Thatisbeautiful. Yes.Itsmydream. Andyoudiditrighttowriteitinthepresenttense.Ifitisareal dream,youhavetofeellikeitsalreadyarealityandthatyou areonlywaitingfortherightmomenttomakeithappen.Itsin suchawaythatallofyoushouldinformyourdreamstoLife andtheUniversesothatImightreflecttoreallifethatwhich youcreateinyourthoughts... Ibelievethatthisisadeepdream,adreamIalwayshadbutthatIonlynow feelpresentinsideofme.OnlynowamIconsciousofit!AndIcantdenyit anymore.Iamlikethat,Iamterriblyromantic! Whichofcourse,doesnt stop me from having various little boyfriends, to flirt, to play and to interact...?ButIknowthat,ifthismanexists,itwillbeinevitable.Ialso knowthatevenifIfindhimorifIhavealreadyknownhimandIstilldont

215

knowwhoheis,everytimethatheisorisntbymyside,Iwillhavethe responsibilitytolivethebestwayinthepresent. Infact,thisleadsmeagaintoaquestion.Yousaidthatnobodybelongsto nobodyelse,thatsexualfidelityshouldneverbeahindrance.Butwhenis sexualfidelitypositive?Aretheretimeswhenitcouldbeharmfultosleep withapersonthatisnttheonethatcreatesmostlove? Ifyourenergyisnotfullyconcentratedonwhatyouaredoing, yes, it could be harmful. If you sleep with someone while thinkingofsomeoneelseyoufeelpassiontowards,ifyouare notgivingyourselfentirelyattheexactmoments,inthiscase theenergieswouldmix,andthatisntgoodatall.Inthiscase its better to be loyal, because your sensual energy is naturally tied to the energy of the missing loved one. Not because its bad to sleep with another, but because vibrationwise its not the best. In fact, when the energy connectioninaloveisverystrong,youmustbetwiceascareful becauseallthatyoudowillbedonetothelovedone.Shewill feelit. Ontheotherhand,ifyouarecrazyforaman,ifyouknowthat he is the man of your life and you are his and you have a relationshipoffreedom,ifheisnotwithyouatthemoment,if heistravelingorwantnot,andyoufeelacrazydesireandgreat careforsomeonethatfeelsthesameforyou,livethemoment withthepersonthatyouarewithnow!Dontbepettywithlove, begenerous,loveeachotherandbesincereandbecarefulnot tohurteachotherfornoreason.IshallrepeataLatinphrase thatIinventedandthatIlikeverymuch:CarpeDiem!Seizethe day!Liveeachmomentasifitwereyourfirstandlast,because thatisrealityandliveouteachmomentwithlove.Theonly thingthatisbadistodosomethingyoudontfeel.Andwhen youdecidetodosomething,doitfully,andfeelwhatyouare doing!Itseasytobehappylikethis. Nowtalktousaboutyourothergreatdream... Yes.IknowIhavenochoice...

216

Nomaam.Youdowhatyouwish!Letsmakethatveryclear. Iffact,youhavetodowhatyouwantwithalotofenthusiasm otherwiseitslikenotdoingitatall. Yes,boss!Iwantit!!!IwanttotalkaboutmycrazydreamsbecauseIknow thatIamcrazyandbecauseIknowthatofthatgoodinsanityeveryonehasa littlebitandifIhavecouragetobecrazymaybethepeoplearoundmewill getthecouragetobealittlecrazytoo...Andmaybe,intheend,theWorld willlittlebylittlebecomewhatIreally,butsincerely,thinkwhatitshould be. Agreat,insaneandbeautifullovestory.Enoughofuselesswarsand suffering!Letsmakelove! Thatsitgirl!!!Ilikethat. Well,IunderstoodthatwithYouthethingistoletitrip.Yes,Life,my othergreatdreamis...Tobeawriterandtobereadtheworldover!!!Simple, uh?Butitsjustlikethat!ItslikeIhaveacertaintythatIhavetolivethis outinordertofulfillmydestiny,tobecomewhatIamsupposedtobe.Now, ofcourse,everytimethatIwalkintoabookstoreIbecomeawareofmy insanity...Andsowhat?IacceptthefactthatIamcrazy.AndeverytimeI feelthisdreamevermorepresentandmorerealandstrongerinsideofme. Anditscuriousbecausemydreamdoesntseemtohaveanythinglinear aboutit!Howmanytimesdidthepeoplethatlovemewantedtoconvince methat,ifIwantedtoreachmydreamIhadtodothisorthat.Ihadtostudy inauniversity,Ihadtoreadtheclassics,Ihadtobethisorthat...Butmy heartsaidthatno,thatIdidntfeelnoneofthat;Ididntwantnoneofthat. AndhowdoIwrite?Iendedupfindingthatwhichreallymotivatedme: spirituality. I discovered thatIdidntwanttobethatkindofwriterthat perfectlydominatedthewrittenlanguagewhotrainsforhours,days,months andyearstofindthemostbeautifulphrases.No,mycommitmenttowriting isnotlinguistically.Iunderstoodthat,eventhoughIhadtowritebetter,the mostimportantthingwastolearntodevelopandraisemyenergy!Because itwasaboutthatmatterthatIwanted,orneededtowriteaboutifIwantedto riseevenhigher!Ittookawhile,butIfinallyunderstood... Andwhatelsedidyoudiscover? IdiscoveredthatIwantedtobereadtheworldovernotbecauseIwantedto be known, to be rich or famous,eventhoughthat isnt abadidea.The

217

biggestreasonIwantitisbecauseIhavesomethingtotransmit.Itsjustthat inordertotransmitIhavetoliveitoutfirst.AnditswhatIhavebeendoing alltheseyears. Andyouhavedonewell. Yes,Ithinksotoo.Evenmymistakesandfalls,whichwerentfew,ended uphelpingme! Itstrue,butitsnotapretexttogoaroundmakingmistakes... Iknow,Iknow. Doyoureallyknow? DontconfusemelittleGoddess!Alright,nowIhavetalkedaboutwhatI wanted,andofthelongpaththatIhavetakentotheendofthismarvelous book.Trulymarvelous,see,andIthankYouveryveryverymuch,becauseI neverenjoyedwritinganythingelseasmuch!Andnow???Thepineappleis inmyhandanditsgorgeous,deliciousandIhavenoideaonhowtopeel andeatit!WhatshouldIdo?Ialwaysenduptyingmyselfupwiththedevil onthepracticalside! Thedevilisnotinthepracticalsideoranyotherspecificplace. Its inside your own heads! Ill tell you: dont make the practical side a 6 headed monster, because you are making thingsmorecomplicatedthattheyreallyare.Whathaveyou beenlearningaboutapparentlyimpossiblethings? Well,IhaveobservedthroughthesmalldreamsthatIhaverealized,likethe trip to Paris for example, that the strength of the mind is something extraordinary.InfactIhavelearnedmuchaboutthisinmycapoeiraclass, becauseinthisartyouseesomemovesthatseemcrazyandimpossiblebut the master ( hurray to my master Neri, by the way!) can achieve them, through the strength of mind and will, making the body do what is apparentlyimpossible.OrratherIhaveobservedthattheenergyofthemind, combinedwithfaithandperseverance,andabovealllove;turnthephysical worldsimpossibletothepossible. Yes.Letsgobacktoyourgreatimpossibledream.Youhave alreadyspokenofthemagicalprocessthatledyoutowritethis bookandgettoitsend,butyouforgottotalkaboutsomething

218

practicalandatthesametimemagicalthathappenedtoyouthat gotyoutowritesoquickly!Youhavetotellit! Itstrue.WhenIreturnedtoBrazillastyear,Ifeltstronglythatmypathwas towrite.ButIdidnthaveacluewhattowriteabout.Imetupwithafriend whoisaphotographer,andsheaskedmethatifIcouldperchancehelp herwriteherautobiography.ShelentmeherlaptopsothatImightwork someonherstory.AtthistimeIbecamefamiliarwiththeuseofacomputer and understood that with this little machine I could write much faster becauseithelpedmecorrectmistakes.SinceIamapersonthatwritesfrom thegut,whichmeansthatwhenIwriteitsveryintenseandfast,likeIam inatrance,IrealizedthatIneededacomputertowrite.Iendedupusingmy friendscomputerallsummerinexchangeforhelpingwithherbook,Iwrote astoryandIstartedsayingtoYouthatIneededacomputer. Yes.Andofcourse,Ilistened. Yeah,butwithYourusualbehaviorofsuspenseandmysteryweneverknow ifyouarelisteningorevencare... Iamalwayslistening,Iamalwayspresent.ButIhaveanatural filter...WhatImeantosayis,sinceIamEnergy,Icanonly absorb those wishes and thoughts which are in a particular vibrationalfrequency,beitpositiveornegative.Orrather,its yourstrengthofwillandfaiththatgetsanythoughtordesireto Me.Ifyoufeedandpersevereonathoughtforawhile,itstarts togrowrootsor,ifyoulike,itstartstochangeitsvibration frequency and becomes another kind of energy. If they are negativethoughtsunitedwiththoseoffear,forexample,many timestheybecomediseasesorproblems.Iftheyaredreamsor desires, united with positive thoughts, they could become reality... Its exactly this process that occurs to many scientists and inventors.Obsessedbytheideaofaformulaorinventionwhich theybelievetobepossiblebutdontknowhowtogetto,they followitfeverishlythroughtheyears,alwaystryingtofinda pathtoexpressit.Thenadaycomeswhentheysuddenlyawake duringthenightortheyareintheshoweroranyotherplaceand theideabecomescleartothem.Orrather,thealchemythat

219

they practiced through the years in their minds transformed theirsearchtoreality. Thatisincredible! Yes,butitsaveryscientificandlogicalprocess,eventhough itsdeeplycreative.Itslikeaseedthatisthrownintothesoil, inwhich,dependingoftheseed,thewayitwasthrown,the timethatitwasthrown,afterafewmonthspass,istransformed. Itbecomeswhatitcarriedasitsenergypotentialbutneededthe right conditions to thrive. Its something close to this case, wherethestrengthwithinthoughtscantransformintocertain vibrationfrequencies. Inthecaseofthoughts,itsimportantthatyourealizethatthis process happens with yourselves. You receive daily, even beforeyouwereborn,alotofemotionalinformation;andyour brains are like a computer that processes this information, interprets the information and transforms it into positive or negative thoughts. The majority of you have not come to understandthatyoucanreorganizethisprocess,thatyoucan reprogram the computer so that it runs according to specific necessities. Well, we have tried to explain this through this book. At the time you begin to study this, you will end up discovering your own intrinsic nature, something similar to whataseedcarriesinside.Somethingthatyouhavetoliveout orbeinordertobefullyrealized;likeaseedthathastobreak outandbecomeaplanttofeedLife.Yes,becausethemoment that you becomeyourselves, youfeedMe,andyoufeedthe energyofLifeandbecome,inyourownright,moreLife,more EnergyandmoreLightandyoubecomeMe.Irepeat:themore you awaken the conscience and attention in yourselves, the moreyoupracticetheScienceofPassion,themorepassionate youlive,themoreyouwillbeconnectedtoMeandthemore youwillfeelMe.Andofcoursethisisalongprocessthatwont happenovernight.Natureitselfhasfollowedalongcourseto beingwhatitistodayandthesamethingwillbetrueaboutyour consciousness. In the meantime there are those things you could call evolutionary steps, or rather, minute accelerations in the

220

evolutionaryprocessthatcomewithgainingconscience.Atthe moment that energy hits the conscience of many people it suddenlymanifestsitselfnaturallythroughoutthewholeplanet. Toexplainthiswecanusetheexampleoflearningtoridea bike. In the beginning it seems hard, almost impossible and suddenly,afteranxamountoftimeofinformingthebodyand throughtheforceofwillandpractice,thepersoniscapableof making those new movements, absorbing the movement and expressingthemthroughthemselves! What I mean with this is that I encourage you all to really believe that itspossibletolivepassionately, itspossible to change theworld,itspossibletorealizeyourdreams,andI encourageyou,Iaskyoutodoanythingforthese!Becausethe more and more you believe, the faster this energy will be absorbedbyMe,thefasterthatitwillbemanifestedinreality. Sooneday,asitsrealityinotherdimensions,youwillbeable topracticetelepathy,andtelekinesisandothermarvelsthatyou have dreamed about. The possibilities to be uncovered are unlimited,andlifeisagreatadventure.Theessentialthingis for you to be happy, that you vibrate, so that we may play togetherandinteract. Wow.Youalwaysleavemestunned. Itsbecauseyouarenaturallystunned... Veryfunny... Well,sothenmylove,howdoesthestorywithcomputerend? YoutoldMemanytimesthatyouneededacomputer,andyou explainedtoMewhyandyouinsisted,andthen...bam! Yes.IspoketoYou...Ispoke,alone,outloudandIprayedforit.Isaid:Life, YouhavetofindmeacomputerbecauseIhavetowriteanincrediblebook! AnditstruethatIdidntknowwhatthatbookwasgoingtobeabout... Thatsalie;youknewitwasgoingtobeaboutLove. Yes...Well,thatwasagivensinceIdontthinkaboutanythingelse!!!ButI didnthaveanyclueabouthowthebookwasgoingtobe!AtthattimeIwas

221

writingabeautifulstorythatinacertainwayservedtodigestthepainthatI feltwithDaniel.ButIbelievedverymuchinthebook,justasIbelieved verymuchinanythingIhadwritten,IfeltitstillwasntthatmagicalthingI wasexpecting,itwasntthatenergythatflowsallthetime,understand?Its liketheexampleofafaucetthatisblocked,whichdoesntflowmuch.Ina certain way such undertaking was like that, the water flowed but it got blockedmanytimes... AtthattimeithadbeenacoupleofyearsthatIstartedtounderstandthatI had to be a writer. But to behonest thereisagreat difference between understanding and believing and taking a risk... I was ready to take the plunge.Butthebiggestproblemwaspractical.Howtobeawriter?Howto write thebook that was insideofme,somewhere?Howtosurviveuntil then?HowtobuyacomputerifIambroke?Itwasnteasy! No,itwasnt. Surewas!ButIwasdeterminedtobetonYouandwithallmystrength.Yes, Iunderstoodthateverythought,everygesture,everymovementcounted.Of course,IwasfarandstillamfarfrompracticingtheSciencewithperfection, butIbegantocreatemyownritualstocommunicatetoYoumywill.I kissedthegrass,IpeedontheearthwhenIhadmyperiod,IdancedforYou, ItalkedtoYou,IopenedmyarmstofeelYou,Ilitincenseandcandlesat home,Ididawholebunchofcrazythingsthatpoppedupinmyheadto showyouthatIwasstudyingmyemotionsandatthesametimestudying You,sothatourenergieswouldmeetbeyondthedominionofreason. Withoutbeingaware,youweredoingwithMewhatyouwould dowithalover,youwereusingyourcreativity,andIfeltthat, andlikedit!Thatislove;itscrazy,boundless,andtrue,beyond shameandego.Andthatconnectedourenergies. Yes!BecauseIknowthatalongtheseyears,eventhoughIhadfacedmany challenges,IhavetosaythatIreceivedmanyincrediblegifts.Unbelievable moments,smallandgreatluckthatseemedtoappearfromnowhere... Orfromeverywhere... Or from You...Because for as crazy as I am, I knew that the things happening were You talking, flattering me, sometimes censuring me,

222

sometimesprotectingme...Sometimesallatthesametime.Whatabeautiful thing! Trulybeautiful.Likeyou,likeMe. And so, a daycame, whenmysister calledfromGermany.Shelivesin GermanyandismarriedtoaGerman man;sheworksinaMultinational Corporation.She,likeallthepeopleclosetome,knewofmydream.Of course,atthesametime,noonehadthemoneytogivemeacomputerasa present,andIdidntevenwantthat,becauseitwasmyproblemwithLife, andwasntmyfamiliesproblem,theyhaddoneenoughforme. Mysistersaidthatshehadincrediblenewsforme.Ididntevenguesswhat it was about. She explained to me that she went to ask her boss if the companysoldusedcomputers.Shewantedtoknowabouttheirpricessoshe couldeventuallybuyoneforme.Herbosssaidthattheydidntsellused computersbutthatonceinawhiletheydonatedcomputerstoschools.And that by chance, there was alaptopthat was not usedand if her sister wantedit,shecouldhaveit!!!!! Little Goddess! That was awesome! What a trip! Wow! It was a head spinningsurprise! Thankyou,Iknow. Tellmesomething:howisamangoingtocompetewithYou,Imean,how amIevergoingtofallforaman?HehastobeasincredibleasYou! Andhedoes!Dontsettleforanythingless!Becauseeveryman andeverywomancarriesMeinside,andthemeetingbetween you two is an immense opportunity to experience Me, to celebrateMeandtofeedMe.Dontmissthisopportunity!That iswhyyoushowcarefullystudyyourencounters,becausein order forMetomanifest myself youhavetobeattheright vibration! It has to be the right encounter, the perfect connection, the right energy, and suddenly the magical and incrediblewillmanifestitself...Themostbeautifulloveisthe onlyonewhereIcanmanifestMyself. Andwhendoweknowthatwearedealingwiththatkindoflove? Whentheloveisthepurest,thestrongest,themostsublime,the craziest, the most surprising, the most persistent, the most

223

enthusiastic,themostreal,themostvibrating,themostintense, thedeepestandmostunconditionalthatyoumayfind.Youcan alwayslove likethat!Themost importantthingsoyoumay lovelikethatistoreconnecteachdayandeverymomentata divine well of energy, or with Me. Begin to understand the importanceofyourrelationshipwithLifeinsideyourselvesand aroundyou!Andwhenyoulove,loveaboveallelsetheLife that leads you and makes you meet someone, the Life that manifestsintheother,theLifethatdecidesuponeachstepof bothofyou.Observethis,veneratethis,andadmirethisprocess thathappensbeyondreason.TwopeoplethatloveLifeabove allandmanifestthisloveaboveallwillreceivethegiftofalove that is glorious and marvelous, like the ones you see in the moviesandbooksandevenbetter. So,Illtellyou:loveeachotherwithpassion,loveinsanely, loveinfriendship,withrespect,withfraternity,lovedeeplyand withtrust.Declareit,singit,reciteit,shoutit,inventcraziness, donthesitatetodemonstrateyourloveandfightforithowever youcan.Dontbeafraidtogiveitall,evenifyoudontknowif itsaloveforadayorforoneforever.Theimportantthingis thatitbeastronglove,magicalandincredible.Anddontstay together if you loveless thanthat! Not because its badbut becauseyoucanlovemuchmore! Well, I will believe that...I will because I decided it, because I want it, becauseIamcrazytoloveandbetrulyloved,thatkindoflovethatmakes yourpantieswetandmakesyoudaydream... Youandyoufixationwithwetpanties... ButLife!Whenamanhasthecapacitytomakeyourpantieswetitsan importantsignal,isntit?Itmeansthattheyexcite,makeusemotionaland crazy...Unfortunatelyitsrarewhenacouplethatistogetherforawhilecan maketheirunderwearwet... Lack of creativity, lack of romance, lack of passion...But sometimesitcouldbethattheyjustdontliketouseunderwear! Its true, that could be it as well. Little Goddess, the World is in a matrimonialcrisis,andweareheretostraightenthisout.Thatiswhywe

224

have been recounting the story of love, and the importance of everyone livingouttheirstoryoflovewithLife... Yes,weareheretorecruitloversforMe! Ah,Goddess,youaregreat! Iamgreat!Iamlove,andwithinlovefitsall,goodsex,some greatfoolingaround,somelaughsandtearsandcrazinessand beautyandallkindsofgoodstuff... Speaking of love, it was thanks to this crazy energy and magic that I receivedthisbeautifulcomputerwithwhichIwritetheselines! Thatwasgood,wasntit? Good?!Itwasmarvelous,sensational,transcendental...OnlyLoveorYouor Lifecouldcomeupwith surpriseslikethat,onlylovecanmakeonefeel suchemotion. Then,mydarling,whydoyoucontinuetogiveMegriefabout yourfearsandkeepondoubtingofMe? LittleGoddess,dontforgetthateventhoughIamalittlebitofYou,Iam also this ephemeral and fragile animal called a human being! And understandthatIamscared,Iamveryscared,Iamtheworstofthefearful ones!IcametounderstandthatintheSantiagosJourney. Ah!Youhaventtoldusthatstoryyet... DoYouthinkitsnecessary? Ithinkthatyouvejusttalkedaboutsomethingveryimportant. Youhaveunderstoodthatyouarescared,veryscared.Andits onlybecauseyouunderstoodthatyouhadthecouragetowrite thisbook,andthatyouhavethecouragetobelieveinloveand youhavethecouragetotakerisks.Becauseyouveunderstood thatmanyofthenegativethoughtsthatyouhaveareonlyfears thatarisetotestyourwill,yourcourageandyourpersistence. Whatsonsof.... No!Thankyourfears!Sincethankstothemyoufeeleverystep youtake,evenifthefearsarethereasaconquest.Andtheyare!

225

Everysteponthepathtoyourdreamsisamomentoffaith,of courageandofloveoverallthefearsandpains.Inthisgame,in this fight between love and fear, with this complicated mechanismthatoccurswithineachofyou,Icanexpressinthe physicalworldthevastandincrediblestrengthofLove.AsI explainedinthebeginningofthebook,fearisagoodvillainof thestory.Hecankillyou,butifyourecognizeit,understandit andbestrongerthanhim,itwilltakeyoutonewheights. Butwearedealingwithanunmovableenemy!WhenIhadthataccessto fearaftertheSantiagosJourney,Ialmostlostmylefteye!Dontyouthink thatthisfightcouldbealittlesofter? Ifthefightwasalittlesofterthenlifewouldbesoft,lifewould nothaverealstrength,itwouldnothavebeauty,itwouldnotbe anadventure;itwouldnotbewhatitis.Alovethatdoesnot hurt,thatcantkill,thatdoesntdriveemotionstothedeepest parts of the soul, is not true love. You had elevated your vibrationalotintheSantiagosJourney,andwhenyoufeelinto fear,youliterallyhadanenergyfall.Thehigheryouclimb, the bigger your fall can be. Youve experienced this. And youveunderstoodthat,evenso,evenwiththenastyfalls,its worthclimbing. Andhowworthwhileitis!Idontregretanything!Ofcourse,ifIcouldsee well again, it would be nice... But I understood that everything was necessaryinorderformetofeelYoubetter,formetounderstandthatYou areaforcebeyondtheproblems,thediseasesandthetragediesandabove all,aboveeverything. Itwaswithoutadoubtthebiggestproofinyourpersonalpath, andwentthroughitwell.Illtellyouthis:thebestthingthat youcandowhenthefightgetstoughistodoeverythingto regainthedoubleperspective.Inthemomentofhardshipdont identifywiththeproblemsthatyouarelivingwith,lookatit fromtheoutside,trytounderstandthewebofeventsinthepast intothefutureinwhichtheproblemisinvolved.Seeeverything with the eyes of an eternal being incarnated in a temporary body,andifyoucant,takeitasatemporaryeventthatcameto testyourstrength...

226

Thatmakesmethinkthat,whentheulcerinthecorneaemerged,Ionly allowedmyselftocryonce.ItwasafterIleftthedoctor.AtthatmomentI ranintoagreatfriendofmine,Fran,whoaskedmehowmyeyewas.Idid notwanttocrybecauseIknewthatitcouldmakethingsworse,makemy eyemoreswollenandred.ItoldFranthatthedoctorsaidthatImightlose my vision, and I ran into hisarms.Franthensqueezed meandtoldme somethingtrulybrilliant:Antonellabehappythatithappenedtoyoureye! Sinceyouhavetwo!Imagineifitwasyourheart!Thenthingswouldget ugly...AtthatmomentIhadtolaughbetweentears!Itwastrue! Yes, without knowing Fran acted in My name, he was My vehicle,asallofyouhavetheopportunitytobeeveryday.He showedyouthedoubleperspective,theperspectiveofLove.It alwaysexists!Seekandyoushallfind. Okay, IthinkthatIhavetorecountmyencounterwithmyfearsonthe SantiagosJourney... Yes,please. InawayIknewIhadanappointmentsetwiththem,butIdidntknowif theyweregoingtoshow...Butofcourse,theywerethere.Howwerethey goingtomissoutontheopportunitytoannoyme?Theencounterwasina placecalledValleDelSilencio,ValleyofSilence,ofwhichIhavespoken before.ThereIspentthenightinagrottowhereasaintcalledGenadio(who Idiscoveredwasawriter). Beforethat,manysignshadremindedmethatIwantedtospendanight aloneinthewilderness.Andtheyspokealsooftheimportanceofourfears inourlives,whichIhadnoknowledgeofbefore.BeforeIthoughtIwasa littlescared,likeeveryone,butIhadnoideahowmyfearscommandeda partofmyactions,myfeelingandmythoughts!IbecameawareofthisasI walked. OnedayIremembertohavespokenwithawomanaboutthepainthatthe back pack caused on my shoulders. At that time I became aware of the symbolofthebackpack.Thebackpack,whichduringtheJourneyseemsto becomeheavierandheaviereachday,tellsustotakeonlywhatisnecessary andnottobecomeattachedtomaterialthings.Italsoteachesusthatwecan survivewithverylittle...

227

ThewomanthatIwastalkingtoalsoexplainedthatshehadobservedthat every pain and disease also brought a symbolic message, a spiritual message,thatthepainthatwefeelonourshouldersareduetouselessand unconsciousemotionalweightsthatwecarryinourlives. ItriedtoreflectanddiscovertheuselessweightthatIwascarrying.Littleby littleIstaredtobecomeawarethatIwascarryingmanyfearsandsadness. Fearofthefuture,fearofbeingwithoutmoney,fearofloneliness,fearof death,fearofsomanythings! AndIalsocarriedsadness,animmensesadnessfortheworldbeingwhatit is,agreatmelancholyforseeingthatloveisnotgoingright,thatmyparents and my parents parents and my friends and me also did not find the fulfillmentoflove.Likethis,manyweekslater,Iwasaloneinthatbeautiful valley,Ithoughtthatitwouldbeanightspentinnatureanditwouldbevery easy.Notso!Thesilencecauseditalltofallonmelikeanavalancheof thoughts,offearsandsadness.Ispokeoutloud,complained,cried,andwas desperate.Itwassomuchsadnessandfear,myGoddess! Yes,Iknowmydarling.You,orenergy,weretrulyblocked... Reallyblocked!Iwasstuckanddidntevenknowit!IthinkIspentanentire afternoonmentallyvomitingabunchofnegativethoughts.AndthenIgotto a point, a beautiful moment... A moment...Wow! A sensation that I still carrywithme.Amomentofsilence. SilenceintheValleyofSilence. FinallyIhadabitofsilenceinsideofmeaswell!AndatthatmomentIhad the strangest feeling. I stopped crying and I had a new feeling that Everything around me was staring at me, that there was a protecting presencethere!AndIfeltthatthispresencewasverysadforallthesadness thatIhadwithin,andthatShetoldmethatIdidnothavetoworryanymore, thatSheexistedandwouldprotectme.IbelievethatwasthefirsttimethatI feltYouinthatmanner,Goddess. Yes.ItwasamarvelousmomentbecauseIfelt,thankstoall thatpainthatwastossinginsideofyou,youweregettingcloser toMe.ItwaspainfulforMeaswell!Ifeltallthatimmensepain youfeltinside,andevenIhadfearthatyouwerenotgoingto beabletocrossthatpainandreachMe.Butyoudidit.

228

Yeah.SuddenlyeverythingwasquietandIfellasleep.Iawokeduringthe nightwithafewdropsofrainfallingonme.Iwenttoacoveredplaceand complainedoutlout,wonderingiftherainwouldgoaway.Iwasafraidthat itwouldrainsomuchthatthegroundwouldbecometooslipperytoleave. Whatmademelaughatmyselfwasmyfears...Butsoon,asifIwereheard, thecloudswentawayandtheskywasfilledwithstars.Iheardthenoiseof micescurryingandbatsflying,butIwentbacktosleep. And I dreamed. I dreamed that I was sleeping ina chapel and I awoke startledbecauseIheardanoise.InthedreamIwenttothedoortoseewhat itwasallabout,andIsawachildspairofshoesoutsidethechapel.And lookingforwardIbecameawareofabunchofchildrenlookingatme.A little boy asked me: Do youlivehere?Andisthisyour house?and I answered simply Yes. And then all of them began to sing a beautiful choruswhichsaidThankyoumyLord,ThankyoumyLord. Iawokeduringthenightinmarvel.Thefearshadleftmecompletely!I knewthattheywouldbebacktotestme,butthatmomentwasonewhereI understoodthatforonceIhadwon.InthemorningImadealittlefireandin itIburnedapaperinwhichIhadwrittenallthatIdidnotwanttosufferin mylife:Fears,vertigo,andlackoffaith. Whatabeautifulstory... Anditdoeswonderstorememberit... So...whatwereyoutellingMeaboutyourfearsinrelationto yourpracticalsideandtherealizationofyourdreams? Well...I...Alright.You wonagainlittleGoddess!Igotthemessage! Yes, faithhastobestrongerthanfear.Yes,lovehastobestrongerthanfear.And itsuptometobetonfaithandloveortobetonfear!Iunderstand... Paycloseattentiontothis:nothingissafe.Lifeisnotsomething safe.Therearenotanycertaintiesbesidestheenergyoflife,no certaintiesbesideslove.So,dontwaitonexteriorcertaintiesto bet on what you feel. Dont wait for money that is never coming,dontdespairwhenapparentlytheredoesntseemtobe awaytomakedreamscometrue.Ifyoubelieve,ifyouhavea lotoflove,muchfaith,muchperseveranceandenthusiasm,love always,Irepeat,ALWAYSwillfindaway.Theonlythingyou havetodoisbeattentiveandbefreeenoughtotakeadvantage

229

ofanopportunitywhenitarises.Anditalwaysarisesforthose thatbeteverythingonwhattheyfeel.Always!!!Foraslongas ittakes! Well, Life, without complainingI will explainmycurrent situation. The Europeansummerisending,inthreeweeksIwillprobablybewithoutajob. Iwasabletosavelittlemoneytobeabletopayforatickettogoandstartin someother place. Besides thatIambroke.Ionlyhavetwosuitcases of clothes,alittleradiowhoseantennaisbrokenandthiswonderfulcomputer. Nowwhat? WhatdoesyourHeartsay? Besidesthefears,which alwaysannoymewith...No,Iamsorry,Heart!!! Youtellmeofthemtomakemestronger,right?... Uff!Manythingsasalways.Well,besidesthem,hetellsmethatthisbookis delirious,thatthisbookmustbepublishedatanycost,andthatitisvery important.ButitsbeentwoyearsalreadyoftryingtopublishbooksIhave writtenandnosuccess!Ineverknowwhattodo,withwhomtotalktoor whattobeton!WhatIasktheeditors,theyonlytellmetosendthemthe bookandtheywillgivemeananswerinthreetosixmonths.Andaftera time, the book is sent back, without any commentary. Its impossible to knowifitwasreallyreadoritjustsatrottinginapileofbooksofother frustratedwriters! Wellthesearethechallengesofthepathyouhavechosenand nowyouknowthatitsnoteasy.Thatisthestrengthtrainingof yourdream,anditisbecomingstronger.Continuetolistento yourHeartwithalotofattentionandintimeitwillgiveyouan ideaonhowtoproceed.Butyoudidnotsayallthathehassaid toyou... Well, besides that, which is my great professional dream, there is an emotionaldream:thedreamoflovinggreatlyandbeinggreatlyloved.But, ifnothingaboutbeingawriterislinear,imaginethenthepathforthis!Ever since I started freeing my energyIseem reallylikeateenager.Igetso passionately involved!Ilivepassionatelyandhavebeautifulmomentsof love.Butitsnevermorethanmoments. Lifeismadeofmoments...Livethem!

230

Yes, I know.Meanwhile it exists; IknowthatitexistsbecauseIfeelit within,akindoflovesodeepandintensethatitcouldextendbeyondthe moments... Its the fundamental love, the kind you cant avoid, the one stronger then time and space, the onethat is written, that is Maktub,asPauloCoelhoalwayswrites,andthat,ifyoudeserve it,youwilllive.Butuntilyouaresurewhatyouarelivingby, lovealot,loveinsanely,butdontgettooattached. Howdoesthisbeenwrittenhappen?Yousaythatateverymoment,every choice,everymovement,everythoughtdecidesourcourse.Howisitthen thatitswritten,thatthereisadestiny? Itsverysimple.Youfindyourselvesinadimensionwheretime andspaceexist;yoursoulscomefromadimensionbeyondtime andspace,adimensionwhereallpossiblefuturesarewritten... Thishastodowiththefactthat,foreverymovement,eachone ofyouhaveaninfinitenumberofpossibilitiesofaction,but each choice is automatically cause and effect, every choice createsakindofwebofeventsthatinalevelabovedimension isperfectablypredictableandbyconsequenceiswritten.Thisis justassureaswhenyoumultiplytwobytwotheresultwillbe four. So, it doesntmatter what choiceyoumake,inalevel withouttimeweareconcernedwiththebestchoice,theonethat fitsperfectlyintheinfinitepossibilitiesoftheGreaterPlan.But, ofcourse,thegreatfunhereinthegameiswhenthisprocess becomes conscious andyoustart todiscover that among the bestchoicestherearealwaysbetterones!Andthebestchoiceis alwaystheonewhereyouarealwaysconsciousofthecreation ofthewebofyourowndestinies,whereyouchoosethewebof destinytoliveout! Whenyouareinyourdimension,space,timeandforgetfulness oftheoriginandthedestinyarenecessaryfactorsinthegame you are playing. Lets say you are living inside a sort of vibrational bubble that separates you from the higher frequencies,orrather,thegreaterrealityoreternity.Thisbubble isformedbytheillusionoftimeandspace.Onlytherearelittle holes in this mechanism and suddenly you have intuitive

231

accesstotheotherdimensionorinsightsofwhatyouwilllive throughinthefuture,whatyouwilllivethroughinotherlives, or when you meet someone new and you have a strange sensationthatyouhavemetthembeforeandsoforth. ThatremindsmethatImetanItalianguyafewdaysago.Wewenttothe beach together;wetalkedandwenttohavedinnerwithsomefriends.And eversinceIsawhimmyattentionhasbeenonalert.So,itwasonlyduring dinnerthatIunderstoodwhy!Iwasstunned!IrememberedthatwhenIwas twelveorthirteenyearsold,aboutsixteenyearsago,Ialwaysdrewinmy notebooksafaceofapersonthatwasthesameasthisItalian! Thats it. I was talking about these magical holes. Coincidencesthatarebeyondrationalcomprehensionandthat reveal,incertaininstances,thespiritualoriginofallofyou; however, be careful! Do not be quick to interpret the holes whentheyhappen!Beforeyoucaninterpretwhattheymean, waituntilyouseewhatyoufeelinrelationtothem.Theholes manytimesareonlysignalsthatwillhelpyouadvance,likeso manyotherthingsthathappentoeverybody. Thisconceptofthebubbleisinteresting,anditremindsmethatthewoman thatIfinishedthe SantiagosJourneywithalsoalludedtoametaphorical bubble.However,shewasreferringtoapassionforaman,thatstatein whichawomanandamanfindthemselvesinwhenbotharecrazyforthe other... Yes,passionisalsoanenergeticholewhichgivesaccessto theenergytothedimensionbeyondwhereyoulive,thetimes where you live inthisholeyoureallyhavethesensation of beinginsideabubble,orratherabubbleinsideabubble!The strongerthepassion,themoreelevatedisthevibrationalenergy andthischangesthevibrationalfieldthatsurroundsthepeople whoarelivingthoughit!Thenthesensationcausespeopleto become bright, becomingmorebeautiful,andtheyfeelmore protected,lighter,andmorealiveasiftheywerefloating...

232

Yeah,butspeakingofthat,thisbusinessofpassionforamanisnoteasy,be itwrittenornot! Atleastyouhaveunderstoodtheimportanceofthatinyourlife. Withoutthelovethatyoulivedoutwithmenyouwouldnotbe writingtheselines... No,itwouldbeimpossible. Very well. Observe this. Open yourself to this reality. Understandthatthistypeoflovehasledyoutobethatwhich youaretoday,liketheloveyouhaveforMe.Continuelivingit withoutfearofgivingyourselftothemoments,withoutgetting lostinthem,andbeawarewheretheriverofLoveandLife carriesyou. WhatdoYoumeanbythat? WhatImeanisthateverythingisconnected. Whomeverdoes notlivefullyallthattheyhavetoliveinlovecannotbefully realizedprofessionallyorviceversa,whomeverdoestrytodo whattheyarecalledtodocannotberealizedinlove.Solive withlove,livethelove,andpayattention.Inthesamewaythe loveforMeandmenbroughtyoutothisbook,itcantakeyou whereyoudreamofbeing.Themostimportantthingisneverto forgettofollowyourHeart,sincewhereyourHeartis... Therewillbemytreasure... Thatsitgirl. Goddess!Ibelievewearegettingtotheendofthisbook! Iseemsthatway. Itwassoquick! Thisisonlythebeginningofalongstoryoflove... ButbeforethatIhavetotalkaboutmybigdream,theonethatisabovemy biggestdreams! Tellusthen!

233

Allright.WhenIwassmall,Ialreadyfeltveryaffectedbythesufferingin theworld.IfeltrealpainwhenforexampleIwatchedtelevisionandIsaw allthosepicturesofwar,whenmyfamilyandIateChristmasdinnerandthe constructionsitenextdoorworkersatetheirpoorlunchesamongtherats... OrwhenIheardmyparentsfightingandyellingwitheachother,orwhenI heardsomeonehadbeenthevictimofamisfortune,andwhenIobservedthe infinite forms of suffering that parade across our eyes. In addition, that, besidesmakingmesad,revoltedmeverymuch.Howtochangeallofthis? It was a constant and desperate question inside of me. I saw that while religionandpoliticsdidalotofgooditalsocausedmuchharm.Whattodo then? Ittookalongtimeformetounderstandthatthebiggestchangestartswhen westarttochangeourselves,whenwedecidetoendthesufferingofthe worldwithin,whenwedecidetobehappyatanycost,webelieveinLife andloveabovemoneyandabovethecircumstances ButIrememberthatwhileIwasalittlegirl,allthatsufferinghurtmealot andIdidnthaveaclueaboutwhattodoagainstit.AndIrememberaswell thatIwasalwaystoldthat,whenyouwalkintoanewchurch,itwasgoodto comeinontherightfootandcreatethreementalwishes.Likeanychild,I believedinthepowerofwishes,IbelievedthatwhenIaskedforsomething whenenteringachurch,orwettingmyfeetintheoceanoruponseeinga shootingstart,itwouldcometrue.Thatiswhythatstoryofwishesalways createdaconflictwithin.Whattowishfor?Therewassomuchtowishfor! And,ifthewishescametrue,howcouldIonlywishthemformyselfandnot others?Therefore,Iendedupintimatelypronouncingthesamethreewords thatservedmeasitdidothers:Health,Love,andHappiness. Today,attwentynineyearsold,Iamawarethatthisisstillmybiggestwish, aboveallwishes.ThatiswhatIwishforothersandmyself.BecauseYouare verybeautiful,Life!BecausewehavetostopfightingagainstYou,wehave tostopfightingamongourselvesandaboveallstopfightingwithourselves! TodayIaskLifeandIaskallofustobehappysothatwemayallcelebrate together,sowecandance,andvibrateandloveoneanotherandgoforward handinhand...Itsimportanttobehappy,itsimportanttomakehappiness andthemostimportantistobehappytogether! Yes,mylove.Wishallofthat,andgetotherstowishitaswell, to believe it, to liveit each moment of their lives. Amen! I repeat:sing,write,work,danceandscreamitout!Thelouder

234

thescreamyouallmake,themoreIwillbelistening,themoreI willbepresent,themoreIwillbeabletosinganddancewith you.Iblessandloveyouall.VeryMuch!Very,VeryMuch!!!!! Amen.

235

Sensualidade

Umtom,umsom,umdom amarmais movimentoeolhar paralisiaequerer fazerenoesperar amarmais vinhobomnasentranhas odesejodetebeber avontadedetefumar Vidapurapuravida querotecantar eamarmais vibrarvibrarvibrar rirdetantosofrer chorardetantorir seperdertanto todesesperadamente seachar Semnexocomsentido semrumocomdireo sentirsentirsentir eamarmais

236

ThisbookwasprintedinthecityofRiodeJaneiro,inthespringof2002for thefirsttimebyMarkgraphGrficaeEditoraLtda.forFissusEditora. GaramonDalai11.5typologywasusedinthebody andthepaperusedwasPlenSoftNatural80g/m2.