Вы находитесь на странице: 1из 18

Медицинская Иммунология

2006, Т. 8, № 4, стр 483500


Обзоры
© 2006, СПб РО РААКИ

ИММУНОГЛОБУЛИН А (IgA) И ЕГО РЕЦЕПТОРЫ


Климович В.Б., Самойлович М.П.
Центральный научноисследовательский рентгенорадиологический институт МЗ РФ, СанктПетербург

Резюме. Общий объем продукции IgA в организме человека составляет 35 г в сутки и превышает вы
работку Ig остальных классов, вместе взятых. IgA представлен в организме девятью структурными вари
антами. Его молекулы относятся к двум подклассам, IgA1 и IgA2, второй имеет два аллотипа. В сыворотке
крови человека преобладают мономеры IgA1, синтезируемые клетками костного мозга. Лимфоидные тка
ни, ассоциированные со слизистыми, продуцируют димерные молекулы IgA1 и IgA2. В состав их входит
дополнительная полипептидная Jцепь. При переносе через слой эпителия на поверхность слизистой к
димерному IgA ковалентно присоединяется внеклеточный участок рецептора полимерных Ig (pIgR), ко
торый становится секреторным компонентом, частью молекулы секреторного IgA (sIgA). Основной функ
цией sIgA является связывание бактерий и вирусов на поверхности слизистых оболочек, препятствующее
попаданию патогенов во внутреннюю среду организма (иммунное исключение). При переносе через эпи
телий IgA может нейтрализовать проникшие в клетки вирусы, а также связывать и выносить на поверх
ность слизистых, т. е. экскретировать белки и иные антигены. Лейкоцитарный рецептор IgA (FcαRI, CD89)
экспрессирован на нейтрофилах, эозинофилах, моноцитахмакрофагах, дендритных и купферовских клет
ках. Цитоплазматический домен FcαRI лишен активационного ITAMмотива. Для передачи сигнала ис
пользуется ассоциированная с FcαRI γцепь Fcγрецептора, благодаря которой связывание IgA приводит к
активации фагоцитоза, эндоцитоза, презентации антигена, синтеза провоспалительных медиаторов и дру
гих функций. Рецептор Fcα/µR структурно гомологичен pIgR, способен связывать IgA и IgM, но экспрес
сируется только на мембране зрелых Влимфоцитов и макрофагов. Описано взаимодействие IgA с рецеп
торами асиалогликопротеинов, трансферрина (CD71) и некоторыми другими молекулами, роль которых
в иммунной защите и в развитии патологических процессов пока не определена. Работа выполнена при
поддержке РФФИ (грант № 050448860).

Ключевые слова: IgA, рецепторы.

Klimovich V.B., Samoilovich M.P.


IMMUNOGLOBULIN A (IgA) AND ITS RECEPTORS
Abstract. Daily IgA production in human organism comprises 3 to 5 g, thus exceeding total synthesis of other Ig
classes. IgA in human body is presented by 9 structural variants. Its molecules belong to two subclasses, IgA1 and
IgA2, the latter represented by two allotypes. In human serum, IgA1 monomers predominate, that are produced by
the bone marrow cells. Mucosaassociated lymphoid tissues produce dimeric IgA1 and IgA2 molecules containing
an accessory polypeptide Jchain. When transported across epithelial layer to the mucosal surface, an extracellular
segment of polymeric IgA receptor (pIgAR) is joining the dimeric IgA1, which becomes a ‘secretory’ component
being a part cesretory IgA (sIgA) molecule. The main function of sIgA is to bind bacteria and viruses at the mucosal
surfaces, thus preventing pathogens to invade the internal spaces of the organism (immune exclusion). If transferred
across epithelium, IgA may neutralize the viruses penetrating the cells, like as bind and deliver proteins and other
antigens to the mucosal surface. The leukocyte IgA receptor (FcαRI, CD89) is expressed on the neutrophils, eosino
philes, monocytes/macrophages, as well as dendritic and Kupffer cells. The cytoplasmic domain FcαRI is devoid of
an activation ITAM motif. To transduce signal, an FcαRIassociated chain of Fcγ receptor is used. Due to this
mechanism, IgA binding leads to activation of phagocytosis, endocytosis, antigen presentation, synthesis of proin
flammatory mediator and other immune functions. Fcα/µR receptor is a structural homologue of pIgR, and it is able
to bind IgA and IgM, being, however, expressed only at
Адрес для переписки:
the surface of mature B lymphocytes and macrophages.
Климович Владимир Борисович,
Interaction of IgA with asialoglycoprotein and transfer
ГУ НИИ рентгенорадиологический институт,
rin (CD71) receptors, like as with some other molecules,
лаборатория гибридомной технологии.
that have yet undetermined role in immune defense and
197758, СПетербург, Песочный, д.2,
development of pathological events. (Med. Immunol.,
Ленинградская ул., д. 70/4.
2006, vol.8, № 4, pp 483500)
Email: vklim@sertolovo.ru

483
Климович В.Б., Самойлович М.П. Медицинская Иммунология

Открытие в конце 50х годов ХХ века антител Несмотря на обилие фактических данных и раз
нового изотипа, названного IgA [53], и обнаружение нообразие теоретических представлений, многие
их в секретах слизистых оболочек и экзокринных проблемы, касающиеся природы молекулярных
желез [96] сыграло значительную роль в развитии форм IgA и Fcαрецепторов, их взаимодействия и
фундаментальной и клинической иммунологии. физиологических функций, до настоящего времени
Прежде всего оно создало базу для трансформации остаются неясными и требуют дальнейшего изуче
ранних представлений П.Эрлиха [6] и А.Безредки ния.
[33] о местном иммунитете в современное учение об
иммунитете слизистых, в котором секреторный IgA
играет одну из главных ролей [99]. Кроме того, кос 1. Молекулярные формы IgA
венным образом оно способствовало развитию ал В отличие от изотипов иммуноглобулинов (Ig),
лергологии, т.к. основной вид реагиновых («аллер существующих исключительно как мономеры
гических») антител, IgE, был впервые обнаружен как (IgG, IgE и IgD) или преимущественно в форме
примесь к IgA, выделенному из молозива женщины полимеров (IgM), молекулы IgA встречаются в
с тяжелым атопическим дерматитом [64]. той и другой форме с характерным распределени
В течение последних пяти лет исследования, ка ем в жидкостях организма. В сыворотке крови че
сающиеся IgA, дают ежегодно 1200 – 1300 научных ловека основную массу составляет мономерный
публикаций, регистрируемых в базах данных IgA (mIgA), построенный из двух тяжелых и двух
PubMed [59] и Science Direct [60]. легких цепей (рис.1). Во внешних секретах mIgA
Интерес к изучению IgA и связанных с ним ме присутствует в небольших концентрациях, а до
ханизмов иммунитета диктуется рядом обстоя минирующими являются димеры, в которых две
тельств. мономерные субъединицы соединены короткой
1. В отличие от антител остальных классов за полипептидной Jцепью, характерной для поли
щитные функции IgA реализуются главным обра мерных IgA и IgM [53, 161, 162]. Значительная
зом не во внутренней среде организма, а на поверх часть (5090%) димерных молекул содержит еще
ностях слизистых, контактирующих с окружающей одну полипептидную цепь, секреторный компо
средой. нент (СК). Такие молекулы носят название сек
2. Общий объем продукции IgA в организме че реторного IgA (sIgA). Наряду с димерами в сек
ловека превышает выработку антител всех осталь ретах обнаружены также тетрамеры IgA, в соста
ных классов, вместе взятых, и составляет 66 мг в ве которых находится одна Jцепь, а число моле
сутки на 1 кг веса тела, что при массе тела 75 кг близ кул СК пока не определено.
ко к 5 г в сутки [150]. Большинство обнаруживае Разнообразие молекулярных форм IgA существен
мых в тканях плазматических клеток являются про но различается у животных разных видов.
дуцентами IgA [52]. Это дает основания считать IgA У мышей известен лишь один класс IgA, у человека –
основным классом антител, образующихся в орга 2, а у кролика –13 [151]. У большинства лаборатор
низме млекопитающих. ных животных в циркуляции преобладает sIgA [67].
3. В отличие от остальных классов антител IgA
свойственно необычное многообразие молекуляр
ных форм. Некоторые из них уникальны по своей
структуре или происхождению, каждая характер
ным образом представлена в различных тканях и
жидких средах организма [98].
4. Не менее разнообразны связывающие IgA ре
цепторы и их экспрессия на клетках разного гисто
генеза. Число известных рецепторов в последние
годы увеличилось по меньшей мере до пяти [107].
Структура и функции некоторых из них четко
определены, другие охарактеризованы недостаточно.
5. Проникновение антигена через слизистые мо
жет вести к синтезу протективных антител класса
IgA, и это внушает надежды на создание вакцин,
вводимых перорально [35, 140]. В то же время изве
стен феномен перорально индуцированной толеран Рис.1. Схема строения молекулы мономерного IgA1.
тности, который может ограничивать эффектив 1 – участки Огликозилирования в шарнирной области,
ность вакцинации, но в то же время может быть по 2 – дисульфидные связи,
лезным при лечении аутоиммунных заболеваний 3 – участки Nгликозилирования,
[158]. 4 – «хвостовой» участок с лабильной дисульфидной связью.

484
2006, Т. 8, № 4 IgA и его рецепторы

На электронных микрофотографиях молекулы Специфичная для подкласса IgA2 α2цепь (мо


IgA были выявлены в форме палочкообразных час лекулярная масса 52 кДа) гомологична α1цепи на
тиц с разветвлением на одном или двух полюсах, что 95%, но имеет ряд важных структурных отличий
дало повод представлять их, подобно IgG, в виде [100, 167]. Помимо уже упомянутой делеции 13 ами
Yобразных структур [46, 114]. В более поздних ис нокислотных остатков в области шарнира, в первом
следованиях было показано, что молекулы IgA1 константном домене α2цепи обнаружено семь за
имеют Тобразную форму. Угол между Fab и Fc мен аминокислот, из которых особенно важны две.
областями IgA близок к 90° [8], а расстояние между Остаток глицина в положении 166 заменен аспара
связывающими центрами равно 23 нм, тогда как у гином, к которому присоединена углеводная глюко
IgG оно не превышает 1617 нм. заминовая группа.
Определяющие изотип тяжелые αцепи постро В положении 133 вместо остатка цистеина нахо
ены из вариабельного и трех константных доменов дится аспарагиновая кислота, что делает невозмож
(рис. 1). Они кодируются двумя генами, альфа1и ным образование в этом месте SSсвязи с легкими
альфа2. Соответственно класс молекул IgA разде цепями.
ляют на два подкласса (субизотипа), IgA1 и IgA2. В области шарнира α2цепи нет галактозамино
Главное различие между ними состоит в делеции 13 вых углеводных групп. Отсутствует также свой
аминокислотных остатков в области шарнира моле ственный α1цепи дуплицированный участок, со
кулы IgA2 [30]. Субизотип IgA2 представлен двумя держащий серин, треонин и пролин. Поэтому в от
аллельными вариантами. Ген альфа2m(1) характе личие от IgA1 молекулы IgA2 более устойчивы к
рен для кавказской и монголоидной рас, американ действию протеаз ряда бактерий, способных инфи
ских индейцев, аборигенов Австралии и эскимосов. цировать слизистые покровы [18,127].
Ген альфа2m(2) – более распространен среди пред Молекулы IgA2 подразделяются на два аллоти
ставителей негроидной и афроамериканской рас пических варианта, IgA2m(1) и IgA2m(2). В отли
[83, 169]. чие от всех остальных разновидностей Ig в молеку
лах IgA2m(1) ковалентная связь между тяжелыми
и легкими цепями отсутствует (рис. 3). Последние
1.1. Мономерный IgA соединены между собой дисульфидным мостиком
Молекулы mIgA в основном относятся к под между Сконцевыми цистеинами, а их связь с тяже
классу IgA1, имеют массу около 160 кДа и констан лыми цепями обеспечивают сильные нековалентные
ту седиментации 7S [100]. Определяющие субизо взаимодействия [47].
тип α−1цепи содержат 472 аминокислотных остат В молекуле IgA2m(2) дисульфидная связь меж
ка (рис. 2) и имеют молекулярную массу 56 кДа. ду тяжелой и легкой цепями образуется за счет од
Дисульфидные связи, соединяющие тяжелую цепь ного из двух цистеинов, находящихся в пределах
с легкой, образуют остатки цистеина в положении Сα2домена (241 или 242) [3, 4]. Тяжелые цепи
133. В пределах первого константного домена име α2(m)2 отличаются от α2m(1) заменами аминокис
ются две внутрицепьевые дисульфидные связи, во лот в шести положениях. IgA2m(2) отличается от
втором и третьем – по одной (рис. 2). Дисульфид аллотипа IgA2m(1) строением участка, расположен
ные связи между тяжелыми цепями расположены ного в непосредственной близости от области шар
на границе СH1 и СH2доменов (Cys241) и в пре нира. Пролин в положении 212 заменен на серин,
делах Сα2домена (Cys299 и Cys301) [74]. Шар благодаря чему соседний остаток аспарагина досту
нирная область молекулы IgA1 находится между пен для гликозилирования, и к нему присоединена
Сα1 и Сα2доменами, состоит из 26 амиокислот дополнительная глюкозаминовая группа.
ных остатков и имеет две особенности [19, 42]. Во Следует отметить, что одна из структурных осо
первых, она содержит пять галактозаминовых бенностей альфацепей состоит в необычно высоком
групп, что необычно для структуры шарнира, а во для Ig содержании остатков цистеина, которые уча
вторых – содержит дуплицированный участок Ser ствуют в образовании внутридоменных и межцепь
ThrProProThrProSerPro, напоминающий евых дисульфидных связей. Что касается последних,
структуру муцина [43]. положение некоторых из них в молекулах IgA2m(2)
Карбоксильный конец альфацепей имеет «хво до сих пор окончательно не определено (табл. 1).
стовой участок» (tailpiece) – последовательность из В мономерных формах IgA1 и IgA2 предпослед
13 аминокислот, содержащую остаток цистеина в ние остатки цистеина в Сконцевом домене альфа
предпоследнем положении (Cys471). В молекулах цепей, формируя межцепочечную SSсвязь [37,
mIgA эти остатки образуют дополнительную меж 102], остаются доступными для спонтанного восста
цепочечную SSсвязь [37, 102], об их роли в обра новления и ковалентного присоединения других
зовании димерных молекул будет сказано позднее. сывороточных белков, имеющих свободные сульф
Такой же Стерминальный участок имеется в струк гидрильные группы. Среди белков, которые таким
туре мюцепей. образом вступают в комплексы с IgA, идентифици

485
Климович В.Б., Самойлович М.П. Медицинская Иммунология

рованы альбумин, альфа1антитрипсин и компо 1.2. Димерный и секреторный IgA


ненты, родственные альфа1макроглобулину [166,
152]. В результате популяция молекул IgA приоб Клетки лимфоидных тканей, ассоциированных
ретает дополнительную гетерогенность по заряду и со слизистыми покровами и экзокринными железа
антигенным свойствам, что существенно осложня ми, синтезируют преимущественно димерные моле
ет разработку иммунохимических систем выявле кулы IgA, построенные из двух m IgA, соединенных
ния IgA. между собой в области хвостовых участков (рис.4А).

120 140 160


| | |

α1 ASPTSPKVFPLSL C STQPDGNVVIA C LVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS


α2m(1) ASPTSPKVFPLSLDSTPQDGNVVVA C LVQGFFPQEPLSVTWSESGQN VTARNFPPSQDAS
α2m(2) ASPTSPKVFPLSLDSTPQDGNVVVA C LVQGFFPQEPLSVTWSESGQN VTARNFPPSQDAS
CH1
>I< ШАРНИР
180 200 220
| | |

α1 GDLYTTSSQLTLPATQ C LAGKSVT C HVKHYTNPSQDVTVP C PVPS T PP T P S P S TPPT PSP


α2m(1) GDLYTTSSQLTLPATQ C PDGKSVT C HVKHYTNPSQDVTVP C PVPPPPP - - - - - - - - - - - -
α2m(2) GDLYTTSSQLTLPATQ C PDGKSVT C HVKHYT N SSQDVTVPC RVPPPPP - - - - - - - - - - -
-

>I< CH2
240 260 280
| | |

α1 S CC HPRLSLHRPALEDLLLGSEA N LT C TLTGLRDASGVTFTWTPSSGKSAVQGPPERDL C
α2m(1) - CC HPRLSLHRPALEDLLLGSEAN LTC TLTGLRDASGATFTWTPSSGKSAVQGPPERDL C
α2m(2) - CC HPRLSLHRPALEDLLLGSEAN LTC TLTGLRDASGATFTWTPSSGKSAVQGPPERDL C

>I<
300 320 340
| | |

α1 G C YSVSSVLPGC AEPWNHGKTFT C TAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEEL


α2m(1) G C YSVSSVLPGC AQPWNHGETFT C TAAHPELKTPLTA N ITKSGNTFRPEVHLLPPPSEEL
α2m(2) G C YSVSSVLPGC AQPWNHGETFT C TAAHPELKTPLTA N ITKSGNTFRPEVHLLPPPSEEL
CH3
360 380 400
| | |

α1 ALNELVTLTC LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV
α2m(1) ALNELVTLTC LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV
α2m(2) ALNELVTLTC LARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRV
>I<
хвостовой участок
420 440 460
| | |

α1 AAEDWKKGDTFS C MVGHEALPLAFTQKTIDRLAGKPTHV N VSVVMAEVDGT C Y


α2m(1) AAEDWKKGDTFS C MVGHEALPLAFTQKTIDRLAGKPTHV N VSVVMAEVDGT C Y
α2m(2) AAEDWKKGETFS C MVGHEALPLAFTQKTIDRLAGKPTIV N VSVVMAEADGT C Y

Рис.2. Сравнение первичной структуры альфа414 и альфа424цепей. Подчеркнутыми символами отмечены


отличия IgA1 от IgA2m(1) и IgA2m(2), двойным подчеркиванием 4 отличия IgA2m(2) от IgA2m(1).
N – участки Nгликозилирования, S, T – участки Огликозилирования.
C – остатки цистеина, участвующие в образовании внутрицепьевых дисульфидных связей (Cys145Cys204, Cys196Cys220, Сys266
Сys323, Cys369Cys432).
C – остатки цистеина, участвующие в образовании дисульфидных связей между полипептидами, входящими в состав молекул IgA.

486
2006, Т. 8, № 4 IgA и его рецепторы

В димерном IgA две альфацепи связаны напрямую мономеры IgA, а IgM формирует не пентамерные,
дисульфидной связью между предпоследними цис а гексамерные молекулы [174].
теинами (cys 471). Две другие соединены такими же Вторая функция Jцепи состоит в формировании
связями с Jцепью, отрицательно заряженным по лигандных участков молекул полимерных Ig, взаи
липептидом (15 кДа), построенным из 137 амино модействующих с мембранным рецептором поли
кислотных остатков [51, 69]. Jцепь содержит 20% мерных Ig (pIgR), экспрессированным на базолате
остатков аспарагина и восемь остатков цистеина, ральной поверхности эпителиальных клеток [77].
образующих внутри и межцепьевые дисульфидные Димерные молекулы IgA, выйдя за пределы плаз
связи. До настоящего времени ее не удалось отнес матической клеткипродуцента, вступают в комп
ти к какомулибо из известных белковых семейств лекс с pIgR. Комплекс подвергается эндоцитозу и
[14, 70]. переносится к апикальной поверхности клетки. При
Jцепь играет важную роль в сборке полимерных переносе комплекса через цитоплазму [5] внеклеточ
Ig. В лимфоидных и плазматических клетках, ли ный участок рецептора протеолитически отщепля
шенных гена Jцепи, образуются преимущественно ется и превращается в секреторный компонент (СК),

1 2

Рис.3. Схема строения молекул IgA2m(1) и IgA2m(2). Обозначения те же, что на рис. 1.

А Б
Рис.4. Схемы молекул димерного (А) и секреторного (Б) IgA. J – J4цепь.

Таблица. ПОЛОЖЕНИЕ МЕЖЦЕПЬЕВЫХ ДИСУЛЬФИДНЫХ СВЯЗЕЙ В МОЛЕКУЛАХ IgA


IgA1 IgA2m(1) IgA2m(2)
Легкие цепи
Cys133 --- Cys241 или Cys242
Cys241-Cys241 Cys241-Cys241 Cys241-Cys241 или Cys241-Cys301
Cys242- Cys242 Cys242- Cys242 Cys242-Cys242 или Cys242-Cys299
Альфа цепи Cys299-Cys299 Cys299-Cys299 Cys299- Cys242
Cys301-Cys301 (?) Cys301- Cys301(?) Cys301 (?)
Cys471-Cys471 (mIgA) Cys471 (mIgA) Cys471 (mIgA)
Секреторный
Cys311 Cys311 Cys311
компонент
J-цепь Cys471 (sIgA) Cys471 (sIgA) Cys471 (sIgA)
Внутридоменые дисульфидные связи: CH1 – C145C204, C196C220
CH2 – С266С323
CH3 – C369C432

487
Климович В.Б., Самойлович М.П. Медицинская Иммунология

структурный элемент молекулы секреторного IgA В отличие от IgM молекулы IgA лишены участка свя
(sIgA) [22, 118]. зывания С1q и потому могут активировать компле
Молекулы sIgA (рис. 4Б) представляют собой мент только по альтернативному пути [55].
комплексы с молекулярной массой 400 кДа и кон Таким образом, семейство антител класса IgA
стантой седиментации 10S, состоящие из двух мо объединяет молекулы девяти разновидностей: мо
номерных субъединиц, Jцепи и СК [56]. Последний номерные IgA1, IgA2(m1) и IgA2(m2), их димерные
является полипептидом с молекулярной массой формы, содержащие Jцепи, и секреторные IgA1,
70 кДа, содержащим пять Igподобных доменов. IgA2(m1) и IgA2(m2), содержащие Jцепи и СК.
Каждый домен построен из 100115 аминокислот Возможно также образование полимерных форм IgA
ных остатков и имеет внутридоменную дисульфид с константой седиментации 15S, однако их состав
ную связь. СК ковалентно соединен с αцепями с по пока точно не установлен.
мощью дисульфидных мостиков в области, близкой Создан ряд моноклональных антител, распознаю
к шарнирному участку. Углеводные боковые цепи щих изотипические, субизотипические и аллотипичес
составляют около 20% массы СК. sIgA функциони кие детерминанты IgA, а также эпитопы СК, свобод
рует в средах, богатых пищеварительными фермен ного или находящегося в составе sIgA [7, 26, 97, 133].
тами, которые выделяют клетки организма. Присут
ствие СК в составе молекулы sIgA связывают с ре
зистентностью последнего к протеолитическим фер
ментам, которая появляется вследствие экраниро 2. Рецепторы IgA
вания доменами СК чувствительных к протеолизу 2.1. Рецептор полимерных иммуноглобулинов (pIgR)
участков [68, 164]. С другой стороны, бактериаль Исследования молекулы pIgR началась с наблю
ная флора слизистых оболочек также является ис дения, согласно которому антисыворотка, специ
точником ферментов, среди которых обнаружены фичная в отношении СК и sIgA, реагировала также
протеазы, способные преодолевать защитное дей с клетками эпителия слизистых оболочек [163].
ствие секреторного компонента и, разрушая IgA, Дальнейшие исследования показали, что свободный
снижать эффективность механизмов иммунной за СК выявляется в аппарате Гольджи и на базолате
щиты от инфекций [127]. ральной поверхности эпителия, тогда как ассоции
Иммунохимически секреторный IgA, выделенный рованные с IgA и IgM молекулы СК локализованы
из молозива, желчи или иных секретов, обладает ря в апикальной части клеток. Это позволило предпо
дом особенностей, связанных с полимерной структу ложить [11], что СК является не только частью мо
рой молекулы и наличием четырех и более центров лекулы sIgA, но и мембранным рецептором поли
связывания антигена. В опытах in vitro он опсонизи мерных IgA и IgM, который обеспечивает их пере
рует и агглютинирует бактерии, нейтрализует виру нос через слой эпителия на поверхность слизистых
сы и преципитирует растворимые антигены, не усту оболочек. К настоящему времени эта гипотеза пол
пая по эффективности антителам класса IgM [53]. ностью подтверждена и обогащена рядом деталей.

Рис.5. Схема строения рецептора полимерных иммуноглобулинов (pIgR).

488
2006, Т. 8, № 4 IgA и его рецепторы

Как было сказано ранее, pIgR экспрессирован на Предшественник pIgR с молекулярной массой
базолатеральной поверхности эпителиальных кле 90100 kDa синтезируется в эндоплазматическом ре
ток слизистых покровов и выводных протоков эк тикулуме, проходит стадию созревания и присоеди
зокринных желез. Анализ мРНК из органов челове нения углеводов в аппарате Гольджи и затем встра
ка показал, что наиболее высокий уровень экспрес ивается в мембрану на базолатеральной поверхнос
сии pIgR наблюдается в тонком и толстом кишеч ти клеток эпителия [87].
нике, менее значительный  в поджелудочной желе Дальнейшие превращения молекул pIgR прохо
зе, почках, легких и эндометрии [73]. pIgR называ дят в три стадии: (1) связывание лиганда и эндоци
ют «жертвенным» рецептором в том смысле, что при тоз, (2) перенос в эндосомах к апикальному полюсу
переносе к апикальной части клетки он расщепля клетки и (3) выход на апикальную поверхность клет
ется протеолитически вне зависимости от связыва ки с последующим отщеплением внеклеточной час
ния лиганда [5]. В результате на поверхность сли ти в виде СК, связанного с sIgA или IgM, либо в виде
зистой выводятся либо содержащие СК молекулы свободного СК. Стадия эндоцитоза зависит от двух
sIgA, либо свободный СК [87]. тирозинсодержащих сайтов в цитоплазматическом
Трансмембранный СК, или pIgR, принадлежит домене pIgR [119]. Трансцитоз зависит от динами
к числу белков суперсемейства Ig. Он содержит пять ки микротрубочек и регулируется фосфорилирова
внеклеточных доменов (620 АКО), стабилизирован нием остатков серина [17, 63]. Протеолиз осуществ
ных дисульфидными связями (рис. 5), трансмемб ляется связанной с мембраной эндопептидазой
ранный и цитоплазматический участки. Все внекле [115]. В процессе переноса через цитоплазму между
точные домены имеют сходную структуру (73% по рецептором и связанным с ним IgA возникает кова
добия) и гомологичны вариабельному домену Ig лентная связь в виде дисульфидного мостика меж
[111]. Им свойственна также высокая степень меж ду цистеином в положении 467 в D5 СК и цистеи
видовой гомологии [126]. Ген pIgR человека лока ном 311 второго константного домена альфацепи
лизован в хромосоме 1 (область 1q31q42). Он содер [13]. При переносе молекул IgM подобного превра
жит 11 экзонов, из которых три кодируют отдель щения не происходит [12]. Процесс образования
ные домены (D1, D4 и D5). Домены D2 и D3 коди sIgA является уникальным примером объединения
руются одним экзоном [71, 72]. молекул рецептора и лиганда и образования едино
Лигандсвязывающий участок pIgR находится в го комплекса из молекул, синтезированных клетка
наиболее удаленном от мембраны домене (D1). ми двух разных линий дифференцировки.
Между этим и следующим доменом расположен ко Установлено, что часть молекул рецептора не
роткий шарнироподобный сегмент. Второй гибкий разрушается на апикальной поверхности, а возвра
сегмент находится между D3 и D4 [130]. Ближай щается на базолатеральную часть клетки [2]. Такой
ший к мембране участок D5 содержит последова «оборот» рецептора позволяет использовать его в
тельности, обеспечивающие, вопервых, его гиб качестве мишени моноклональных антител для на
кость, а вовторых  чувствительность к протеоли правленного внедрения генетического материала
зу, который происходит на апикальной поверхнос как в культивируемые клетки, так и in vivo [38, 39].
ти клетки и приводит к освобождению sIgA или сво В секретах слизистых оболочек и экзокринных
бодного СК [61]. Число остатков цистеина в моле желез СК присутствует как в составе sIgA, так и в
куле pIgR человека равно 20. Они распределены виде свободных молекул. Установлено, что свобод
между доменами таким образом, что обеспечивают ный СК может связывать токсин Clostridium difficile
формирование одной (в D2) или двух (в D1, D3, D4 [24] и ограничивать распространение энтеротокси
и D5) дисульфидных связей. При ассоциации pIgR генных Esherichia coli путем связывания фимбриаль
с IgA одна из SS связей в D5 разрывается и SH ных факторов колонизации [120]. Это позволяет ду
группа цистеина участвует в образовании дисуль мать, что свободный СК может в качестве перехват
фидной связи с альфацепью. Молекула pIgR силь чика микробов функционировать как фактор неспе
но гликозилирована, доля углеводов может состав цифического иммунитета [125].
лять до 25% ее массы [55, 148]. Состав углеводов
довольно вариабелен, однако лигандсвязывающая
способность pIgR от этого не зависит [5]. Опубли 2.2. Миелоцитарный рецептор IgA (FcαRI/CD89)
кованы данные рентгеноструктурного анализа кри Впервые связывание миеломного IgA с нейтро
сталлической структуры Nтерминального (IgAсвя филами крови было описано в 1975 году [82]. По
зывающего) домена pIgR. зднее при использовании тестов розеткообразова
Описан ряд моноклональных антител, распозна ния было обнаружено связывание IgA с другими
ющих экстраклеточные и цитоплазматические уча клетками гранулоцитарного ряда [36], а также с мо
стки pIgR кролика [149]. Одно из них реагирует с ноцитами, Т и Влимфоцитами [49, 85, 86]. Эксп
мембранной и со свободной формами СК, но не рас рессия FcαRI/CD89 ограничена клетками миелоид
познает СК, ассоциированным с димерным IgA. ной линии дифференцировки (нейтрофилы, эози

489
Климович В.Б., Самойлович М.П. Медицинская Иммунология

α RI/CD89).
Рис.6.Структура миелоцитарного рецептора IgA (Fcα

нофилы, большинство моноцитовмакрофагов, ден мосомы 19 (19q13.4) [75]. Ген содержит около 12 ты
дритные и клетки Купфера). Культивируемые кле сяч пар оснований и состоит из 5 экзонов [171]. В пер
точные линии, соответствующие перечисленным вых двух локализован сайт инициации трансляции и
типам клеток, также экспрессируют FcαRI /CD89 последовательность лидирующего пептида. Два сле
[31, 45, 54, 105]. дующих экзона кодируют внеклеточные домены (206
Экспрессия FcαRI начинается на стадии проми АКО). Последний экзон кодирует трансмембранный
елоцита, она конститутивна и не зависит от присут и цитоплазматический участки, построенные из 19 и
ствия лиганда, т.к. одинаковый уровень ее наблю 41 АКО соответственно. Интересно, что FcαRI имеет
дают у нормальных людей и у пациентов с дефици более высокую степень гомологии (около 35%) с дру
том IgA [20]. Количество молекул FcαRI составля гим семейством рецепторов, так называемым класте
ет 57000 на один моноцит и 66000 на один нейтро ром лейкоцитарных рецепторов, в число которых вхо
фил [76, 104]. дят иммунорецепторы естественных киллеров (KIR/
Экспрессия FcαRI на нейтрофилах и эозинофи KAR) и лейкоцитарные Igподобные рецепторы (LIR)
лах усиливается под влиянием IL8 и TNFα. На мо [92]. Анализ кристаллической структуры этих белков
ноцитах усиление экспрессии FcαRI вызывают фор показал наличие сходной гидрофобной структуры в
боловые эфиры, липополисахарид, TNFα, GMCSF междоменных участках молекул и позволил заклю
и IL1 [108, 58, 57, 117, 91, 143]. чить, что FcαRI эволюционно ближе к LIR, чем к KIR
По молекулярной структуре FcαRI относят к [28]. Обнаружено также, что FcαRI структурно род
суперсемейству Ig [90]. Он построен из трех белко ственен тромбоцитарному рецептору коллагена и ре
вых субъединиц (рис. 6), одна из которых цептору Fcγ2R быка [65]. Полагают, что FcαRI и Fcγ2R
(αцепь) обеспечивает связывание IgA, а две другие можно рассматривать как отдельную группу рецепто
(γцепи) ответственны за внутриклеточное проведе ров, происходящую от общего генапредшественника
ние сигнала. Альфацепь (не смешивать с αцепью [176]. Многочисленные попытки найти аналог чело
IgA!) состоит из двух внеклеточных Igподобных до веческого рецептора CD89 у мышей до сих пор не дали
менов, трансмембранного участка и цитоплазмати результатов. Предполагают, что кодирующий ген был
ческого «хвоста», лишенного сигнального мотива утрачен в результате транслокации [172].
[97]. Участок, связывающий IgA, локализован в наи FcαRI существует в виде двух изоформ. Изофор
более удаленном от мембраны домене [110]. Альфа ма a1 представлена на циркулирующих моноцитах,
цепь имеет молекулярную массу 30 кДа, содержит гранулоцитах и перитонеальных макрофагах, тогда
пять сайтов Nгликозилирования и несколько мест как вариант а2 обнаружен только на альвеолярных
возможного Огликозилирования [106]. На молеку макрофагах [123]. FcαRIa.2 имеет меньшую моле
лах IgA1 и IgA2 участок, комплементарный связы кулярную массу белковой части 28 кДа за счет де
вающий области FcαRI, находится границе между леции 22 АКО в экстраклеточном домене [143].
C2 и C3 доменами [16, 128]. Описаны растворимые формы FcαRI двух типов.
Альфацепь FcαRI структурно родственна (>20% Первая возникает путем протеолиза и представля
гомологии) альфацепям FcγR и FcεRI [170]. Однако ет собой слабо гликозилированный белок с молеку
гены последних двух находятся у человека в едином лярной массой 30 кДа, ковалентно связанный с по
кластере на хромосоме 1 (1q21–23), тогда как ген лимерным IgA, который в низких концентрациях
FcαRI локализован в дистальной части qплеча хро циркулирует в крови здоровых индивидов. Моле

490
2006, Т. 8, № 4 IgA и его рецепторы

α /µ
Рис. 7. Гомология структуры IgA связывающих доменов IgR и Fcα µ.

кулы второго типа сильно гликозилированы и име ков аминокислот с четырьмя потенциальными уча
ют массу 50–70 кДа [10, 175]. стками гликозилирования [145, 138]. Рецептор име
FcαRI обладает низким аффинитетом в отноше ет единственную внеклеточную петлю, содержащую
нии свободного мономерного IgA (Ka близка к 106 консервативный мотив протяженностью в 23 АКО,
M/1). Более высокую авидность CD89 проявляет общий с pIgR мыши, быка и человека, что предпо
при связывании полимерного IgA и содержащих IgA лагает их общее происхождение. Установлено, что
иммунных комплексов [170]. Fcα/µR способен, подобно pIgR, связывать c умерен
Проведение сигнала от FcαRI зависит от ассоци ной аффинностью как IgA, так и IgM. Гомолог гена
ации альфацепи рецептора с гомодимером γцепи, Fcα/µR обнаружен у человека в хромосоме 1 (1q
субъединицы, входящей также в состав рецепторов 32.3) поблизости от ряда генов, кодирующих дру
FcεR и FcγR [132]. Сильное взаимодействие FcαRI гие Fcα рецепторы [146].
с γцепью обусловлено противоположно заряженны Fcα/µR конститутивно экспрессируется на боль
ми аминокислотными остатками в трансмембран шинстве мышиных Влимфоцитов и макрофагов.
ных участках [109]. γцепь содержит тирозиновый Перекрестное связывание Fcα/µR молекулами ра
активационный мотив (ITAM) [134]. Перекрестное створенного или связанного с частицами IgM инду
связывание двух молекул FcαRI с иммунным комп цирует интернализацию рецептора. Fcα/µR способ
лексом или полимерным IgA приводит к перерас ствует эндоцитозу Влимфоцитами клеток St.aureus,
пределению молекул рецептора в липидном слое покрытых IgM [110]. Предполагают, что Fcα/µR иг
мембраны [79], включает реакцию фосфорилирова рает основную роль на первых этапах иммунных ре
ния остатков тирозина, ассоциацию фосфоITAM с акций против бактерий. Fcα/µR, обильно экспресси
протеинкиназой р72syk и вовлечение мультимоле рован на зрелых Влимфоцитах вторичных лимфоид
кулярного адаптерного комплекса, состоящего из ных органов, таких как лимфатические узлы, аппен
ряда тирозинкиназ [48, 80], в процесс активации дикс и лимфоидных образованиях кишечника. Он
эффекторных клеточных функций. приобретает способность связывать IgA и IgM только
Известно несколько моноклональных антител после активации этих клеток. Из этого может следо
против CD89. Одни из них распознают неполимор вать, что он участвует как в локальных, так и в систем
фные детерминанты FcαRI [89], другие  внеклеточ ных иммунных реакциях слизистых. Экспрессия Fcα/
ные домены FcαRI [110]. Одно из антител (A62) µR была обнаружена на миелиновых мембранах и оли
выявляет субпопуляцию молекул FcαRI с молеку годендроцитах центральной нервной системы мышей
лярной массой 55–65 кДа, другие антитела связы [116]. Транскрипты гена Fcα/µR в недавнее время
вают изоформы с массой 65–75 кДа, что, возможно, были также выявлены в клетках почечного мезангия
обусловлено различиями в гликозилировании раз человека. В ответ на стимуляцию IL1 количество их
ных форм CD89 [144]. увеличивалось, что может указывать на участие этих
молекул в регуляции воспалительных процессов [95].

2.3. Рецептор Fcα/m


У мышей недавно был обнаружен рецептор, обо 2.4. Рецептор асиалогликопротеинов (ASGPR)
значенный как Fcα/µR, который представляет собой Печень играет важную роль в поддержании гоме
трансмембранный белок, построенный из 503 остат остаза системы иммунитета слизистых посредством

491
Климович В.Б., Самойлович М.П. Медицинская Иммунология

регулирования катаболизма IgA. Рецептор асиало рецептор, специфичный для СК [78]. Поскольку
гликопротеинов (ASGPR), экспрессированный на sIgA служит мощным стимулятором активности
гепатоцитах [155, 160], распознает концевые остатки этих клеток, он более эффективно, чем мономерные
галактозы на сывороточных гликопротеинах, в том молекулы, активирует процессы дегрануляции и
числе и на IgA, и обеспечивает эндоцитоз этих моле продукции супероксидных радикалов. Рецептор для
кул и их внутриклеточную деградацию. Исследова СК до сих пор полностью не охарактеризован. Од
ния, выполненные на приматах, показали, что толь нако данные, полученные с помощью иммунопреци
ко малая часть белков, связанных ASGPR, избегает питации и аффинной хроматографии, указывают на
деградации и переходит в желчь в неизмененном виде то, что он является белком с молекулярной массой
[139]. Поглощение IgA печенью резко снижено у 15 kDa [78]. Возможно, в рецепции СК принимают
мышей с отсутствием ASGPR, поэтому предполага участие молекулы интегринов, поскольку установ
ют, что ASGPR обеспечивает удаление IgA из крови лено, что антитела против CD18 (бета2 субъедини
[154]. Показано, что у человека в печени разрушает ца интегринов) ингибируют продукцию окислитель
ся преимущественно IgA2, но не IgA1. Установлено, ных радикалов эозинофилами [112].
что мутантный IgA1, лишенный шарнирной области
и связанных с ней Оуглеводных цепей, разрушается
в печени в больших количествах, чем IgA1 дикого
3. Роль IgA и его рецепторов в иммун
типа. Быстрый клиренс IgA2 в печени, вероятно, яв ной защите
ляется одной из причин того, что в крови преимуще Многообразные аспекты участия sIgA в иммун
ственно присутствует IgA1, но не IgA2 [135]. ной защите отражены в ряде обзоров [99, 158, 67,
30, 172, 116, 1, 21], что позволяет в настоящей пуб
ликации ограничиться изложением принципиаль
2.5. Рецептор трансферрина (CD71) ных положений.
Белок с молекулярной массой 180 kDa, состоя Поверхность слизистых человека, составляющая
щий из двух связанных дисульфидным мостиком около 400 м2, постоянно контактирует со множе
идентичных субъединиц, описанный ранее как ре ством вирусов, микробов, простейших и пищевых
цептор трансферрина (ТфР) и обозначенный CD71, белков. Основную роль в специфической иммунной
избирательно связывает IgA1. Высокоочищенный защите слизистых выполняют dIgA, pIgR и sIgA.
полимерный IgA1, свободный от контаминации Имеются доказательства того, что их защитные фун
трансферрином, связывается с ТфР сильнее, чем кции могут осуществляться на трех уровнях струк
мономерный IgA2. В отличие от FcαRI этот рецеп туры слизистых покровов [165, 94, 101].
тор IgA слабо экспрессирован на зрелых лейкоци 1. На поверхности слизистых sIgA осуществляет
тах крови, но четко выявляется на культивируемых функцию, называемую иммунным исключением.
клетках почечного мезангия [113]. У пациентов с Взаимодействуя с микроорганизмами и вирусами,
IgAнефропатией экспрессия CD71 на мезангиаль sIgA создает вокруг них отрицательно заряженную
ных клетках понижена, что дало повод предполагать, гидрофильную оболочку, удерживает их в покры
что этот рецептор вовлечен в развитие указанного вающем поверхность слое слизи и препятствует при
заболевания [103, 50]. креплению их к поверхности эпителия. Этому спо
Т и Влимфоциты человека связывают гомоло собствуют неспецифические взаимодействия угле
гичный IgA [49, 85, 147, 34]. Установлено, что свя водных компонентов IgA и СК как с поверхностью
зывание IgA зависит от пролиферации Тлимфоци микроорганизмов, так и с углеводными компонен
тов и что ТфР опосредует взаимодействие с IgA тами слизи [124]. sIgA также образует комплексы с
[154]. Возможно, что ТфР участвует в связывании пищевыми антигенами и ограничивает их всасыва
IgA1 с Тлимфоцитами, опосредованном углевода ние в кровоток [157].
ми шарнирной области [137, 159]. Антиген CD71 2. При пересечении путей транспорта IgA и миг
был также идентифицирован на мембране интерсти рации вирусов в цитоплазме инфицированных эпи
циальных дендритных клеток. Показано, что он телиальных клеток взаимодействие антител с про
опосредует интернализацию комплексов антигена с никшими в клетки вирусами может останавливать
IgA c [121]. их репликацию и нейтрализовать их активность [44].
Более того, комплекс вируса с IgA может быть вы
веден за пределы клетки в просвет слизистой. До
2.6. Эозинофильный рецептор секреторного казательства существования этого механизма впер
компонента вые были получены на культуре поляризованных
Эозинофилы играют заметную роль в защите эпителиальных клеток, апикальная поверхность ко
поверхностей слизистых от паразитарных инвазий торых была инфицирована вирусом Сендай. После
и участвуют в развитии аллергического воспаления. добавления специфических антител против вируса
Наряду с FcaRI [1, 105] эти клетки экспрессируют на базолатеральную поверхность клеток наблюда

492
2006, Т. 8, № 4 IgA и его рецепторы

ли колокализацию антител и вируса в цитоплазме IgA происходят только тогда, когда FcαRI ассоции
[93]. Антитела IgA класса против ротавируса обес рован с FcRγ [109, 81].
печивали эффективную защиту только тогда, когда Клетки гранулоцитарного и моноцитарного ряда,
их вводили системно, а не в просвет слизистой, из обработанные IgA антителами, способны лизиро
чего следует, что для инактивации вируса in vivo вать разнообразные мишени, такие как бактерии,
необходим процесс трансцитоза [15]. Димерные IgA личинки гельминтов (Schistosoma mansoni), эритро
антитела, направленные против ВИЧ, блокировали циты и опухолевые клетки [84, 29, 21, 32].
инфекцию эпителиальных клеток. Нейтрализация IgA антитела оказались мощным фактором, спо
вируса происходила внутри локализованных апи собствующим лизису клеток солидных опухолей и
кально эндосом, после чего иммунные комплексы злокачественных лимфом и вовлекающим нейтро
выводились на поверхность слизистой оболочки [9]. филы в процесс повреждения злокачественных кле
3. На базолатеральной поверхности эпителия во ток [62, 25, 88, 27]. Аналогичные явления наблюда
взаимодействие с pIgR могут вступать не только мо ли при использовании биспецифических антител,
лекулы димерного IgA, но и их комплексы с бактери что указывает на большую эффективность FcαR в
альными, вирусными и пищевыми антигенами. При сравнении с FcγR в качестве фактора, нацеливаю
этом pIgR обеспечивает перенос на поверхность сли щего терапевтические антитела на опухолевые клет
зистых растворимых антигенов, включенных в состав кимишени [168, 156].
иммунных комплексов. Такой механизм можно рас
сматривать одновременно как защиту внутренней сре
ды от поступления чужеродных антигенов и как свое Список литературы
образный вариант экскреторной функции [66, 136]. 1. AbuGhazaleh R.I., Fujisawa T., Mestecky J.,
В одном из недавних исследований способность Kyle R.A., Gleich G.J. IgAinduced eosinophil de
sIgA осуществлять все три перечисленные функции granulation // J. Immunol.  1989.  Vol.142. 
была продемонстрирована на модели инфицирова P.23922400.
ния вирусом кори монослойной культуры клеток 2. Apodaca G., Katz L.A., Mostov K.E. Receptor
поляризованного эпителия почки собаки. Монокло mediated transcytosis of IgA in MDCK cells is via
нальные антитела, направленные против разных apical recycling endosomes // J. Cell Biol.  1994 
белков вируса, проявляли различную вируснейт Vol.125.  P.6786.
рализующую активность в зависимости от того, в 3. Baenziger J., Kornfeld S. Structure of carbohy
каком из трех защитных механизмов испытывали их drate units of IgA1 immunoglobulin. I. Composition,
эффективность [173]. glycopeptide isolation and structure of the aspar
Взаимодействие IgA с pIgR обеспечивает функ aginelinked oligosaccharide units // J. Biol. Chem.
ционирование защитных механизмов на поверхно  1974.  Vol.249.  P.72607269.
сти слизистых оболочек и в тканях, находящихся 4. Baenziger J., Kornfeld S. Structure of carbohy
непосредственно под слоем покровного эпителия. drate units of IgA1 immunoglobulin. II. Structure of
В противоположность этому эффекторные функции the Oglycosidically linked oligosaccharide units //
IgA, опосредованные FcαRI, реализуются главным J. Biol. Chem.  1974.  Vol.249.  P.72707281.
образом в органах и тканях, изолированных от внеш 5. Bakos M.A., Kuroski A., Goldblum R. Charac
ней среды. terization of critical binding site for human polymeric
Связывание FcαRI с молекулами IgA активиру Ig on secretory component // J. Immunol.  1991. 
ет ряд эффекторных функций, включая фагоцитоз, Vol.147.  P.34193426.
презентацию антигена и антителозависимую кле 6. Besredka A. De la vaccination contre les etats
точную цитотоксичность [23, 131]. Активация кле typhoides par le voie buccale // Ann. Inst. Pasteur. 
ток через FcαRI зависит от перекрестного связыва 1919.  Vol.33.  P.882903.
ния рецептора на клеточной мембране и приводит к 7. Biewenga J., A. Faber, G. de Lange, F. van Leeu
синтезу провоспалительных цитокинов, медиаторов wen, P. Van Eede, R. Jefferis, J. J. Haaijman, A. Vlug.
воспаления и супероксидрадикалов [122, 40, 41, Monoclonal antibodies against different domains of
129]. Агрегация FcαRI на мембранах эозинофилов human IgA: specificities determined by immunoblot
вызывает реакцию дегрануляции [1] В качестве ли ting and haemagglutinationinhibition // Mol. Im
гандов CD89 могут выступать секреторный IgA, munol.  1986.  Vol.23.  P.761767.
моноклональные антитела против CD89 или агре 8. Boehm M.K., Woof J.M., Kerr M.A., Perkins
гированный сывороточный IgA [142, 153, 89, 141]. S.J. The Fab and Fc fragments of IgA1 exhibit a dif
Функции, включаемые FcαRI, более всего зави ferent arrangement from that of IgG: a study by X
сят от опосредованной γцепью активации тирозин ray and neutron scattering and homology modelling
киназ. В этой связи можно указать на работы, в ко // J.Mol. Biol.  1999.  Vol.286.  P.14211447.
торых установлено, что высвобождение IL2 и ионов 9. Bomsel M., Heyman M., Hocini H., Lagaye S.,
кальция, дегрануляция базофилов или деградация Belec L. Intracellular neutralization of HIV transcy

493
Климович В.Б., Самойлович М.П. Медицинская Иммунология

tosis across tight epithelial barriers by antiHIV en 24. Dallas S.D., Rolfe R.D. Binding of Clostridi
velope protein dIgA or IgM // Immunity.  1998.  um difficile toxin A to human milk secretory com
Vol.9.  P.277287. ponent// J. Med. Microbiol. 1998.  V.47.  P.879
10. Boog van der P.J., van Zandbergen G., de 888.
Fijter J.W., KlarMohamad N., van Seggelen A. 25. Dechant M., Valerius T. 2001. IgA antibodies
FcαRI/CD89 circulates in human serum covalently for cancer therapy // Crit. Rev. Oncol. Hematol. 
linked to IgA in a polymeric state // J. Immunol.  Vol.39.  P.6977.
2002.  Vol.168.  P.12521258 26. Delacroix D. L., J. van Snick, J. P. Vaerman,
11. Вrandtzaeg P., Structure, synthesis and exter M. E. Conley, F. MascartLemone. Monoclonal an
nal transfer of mucosal immunoglobulins // Ann. Im tibodies against isotypic and isoallotypic determi
munol. (Paris) .  1973.  Vol.124.  P.417438 nants of human IgA1 and IgA2: fine specificities and
12. Brandtzaeg P.Human secretory immunoglob binding properties // Mol. Immunol.  1986.  Vol.23.
ulin M. An immunochemical and immunohistochem  P.367375.
ical study // Immunology.  1975.  Vol.29.  P.559 27. Dijk van M.A., van de Winkel J.G. 2001. Hu
570. man antibodies as next generation therapeutics //
13. Brandtzaeg P.Human secretory component. Curr. Opin. Chem. Biol.  Vol.5.  P.368374.
VI. Immunoglobulinbinding properties // Immu 28. Ding Y., Xu G., Yang M., Yao M., Gao G.F.,
nochemistry. 1977.  Vol.3.  P.179188. Wang L., Zhang W., Rao Z. Crystal Structure of the
14. Brewer J.W., Randall T.D., Parkhouse R.M.E., Ectodomain of Human FcαRI // J. Biol. Chem. 
Corley R.B. IgM hexamers? // Immunology Today. 2003.  Vol.278.  P.2796627970.
 1994.  VOL.15.  P.165168. 29. Dunne D.W., Richardson B.A., Jones F.M.,
15. Burns J.W., SiadatPajouh M., Krishnaney Clark M., Thorne K.J.I., Butterworth A.E. The use
A.A., Greenberg H.B. Protective effect of rotavirus of Mouse/Human chimaeric antibodies to investigate
VP6specific IgA monoclonal antibodies that lack the roles of different antibody isotypes, including
neutralizing activity // Science.  1996.  Vol.272.  IgA2, in the killing of Schistosoma mansoni schisto
P.104107. somula by eosinophils // Parasite Immunol.  1993. 
16. Carayannopoulos L., Hexham J.M., Capra J.D. Vol.15.  P.181185.
Localization of the binding site for the monocyte im 30. Egmond van M., Damen C.A., van Spriel A.B.,
munoglobulin IgAFc receptor (CD89) to the domain Vidarsson G., van Garderen E., van deWinkel J.G.
boundary between Cα2 and Cα3 in human IgA1 // IgA and the IgA Fc receptor // Trends Immunol. 
J. Exp. Med.  1996.  Vol.183.  P.15791586. 2001.  Vol.22.  205211.
17. Casanova J.E., Breitfeld P.P., Ross S.A., Mos 31. Egmond van M., van Garderen E., van Spriel
tov K.E. Phosphorylation of the polymeric immuno A.B., Damen C.A., van Amersfoort E.S. FcaRIposi
globulin receptor required for its efficient transcy tive liver Kupffer cells: reappraisal of the function of
tosis // Science.  1990.  Vol.248.  P.742745. immunoglobulin A in immunity // Nat. Med.2000.
18. Cederblad G., Johansson B.G., Rymo L. Re  Vol.6.  P.680685.
duction and proteolytic degradation of immunoglo 32. Egmond van M., van Spriel A.B., Vermeulen
bulin A from human colostrum // Acta Chem. Scand. H., Huls G., van Garderen E., van de Winkel J.G.
 1966.  Vol.20.  P.23492357. Enhancement of polymorphonuclear cellmediated
19. Chapius R.M., Koshland M.E. Linkage and as tumor cell killing on simultaneous engagement of Fcγ
sembly of polymeric IgA immunoglobulins // Bio RI (CD64) and FcαRI (CD89) // Cancer Res.  2001.
chemistry.  1975.  Vol.14.  P.13201325.  Vol.61.  P.40554060.
20. Chevailler A., Monteiro R.C., Kubagawa H., 33. Ehrlich P. Ueber Immunitat durch Vererbung
Cooper M.D. Immunofluorescence analysis of IgA und Saugung // Zeitschr. fur Hyg. und Infekt
binding by human mononuclear cells in blood and Krankh. 1892.  Vol.12.  P.183203.
lymphoid tissue // J. Immunol. 1989.  Vol.142.  34. Endoh M., Sakai H., NomotoY.,TominoY.,
P.22442249. Kaneshige H. IgAspecific helper activity of Ta cells
21. Clark D.A., Dessypris E.N., Jenkins D.E. Jr, in human peripheral blood // J. Immunol.  1981. 
Krantz S.B. Acquired immune hemolytic anemia as Vol.127.  P.26122613.
sociated with IgA erythrocyte coating: investigation 35. Eriksson K., Holmgren J. Recent advances in
of hemolytic mechanisms // Blood.  1984.  Vol.64. mucosal vaccines and adjuvants // Current Opinion
 P.10001005. in Immunology.  2002.  Vol.14.  P.666672.
22. CunninghamRundles C., Lamm M.E. Frank 36. Fanger M.W., Shen L., Pugh J., Bernier G.M.
lin E.C. Human secretory component // J. Biol. Subpopulations of human peripheral granulocytes
Chem.  1974.  Vol.249.  P.56545657. and monocytes express receptors for IgA // Proc.
23. Daeron M. Fc receptor biology // Annu. Rev. Natl. Acad. Sci. USA.  1980.  Vol.77.  P.3640
Immunol.  1997.  Vol.15.  P.203234. 3644.

494
2006, Т. 8, № 4 IgA и его рецепторы

37. Feinstein A., Munn E.A., Richardson. The 50. Haddad E. Enhanced expression of the CD71
threedimensional conformation of γM and γA glob mesangial IgA1 receptor in Berger disease and
ulin molecules // Ann. N. Y. Acad. Sci.  1971.  HenochSchonlein nephritis: association between
Vol.190.  P.104121. CD71 expression and IgA deposits // J. Am. Soc.
38. Ferkol T., Kaetzel C.S., Davis P.B. Gene trans Nephrol.  2003.  Vol.14.  P.327337.
fer into respiratory epithelial cells by targeting the 51. Halpern M.S., Koshland M.E. The stoichiom
polymeric immunoglobulin receptor // J. Clin. In etry of J chain in human secretory IgA // J. Immu
vest.  1993.  Vol.92.  P.23942400. nol.  1973.  Vol.111.  P.16531660.
39. Ferkol T., Perales J.C., Eckman E., Kaetzel 52. Hejden van der P.J., Stok W., Bianchi A.T.
C.S., Hanson R.W., Davis P.B. Gene transfer into the Contribution of immunoglobulinsecreting cells in
airway epithelium of animals by targeting the poly the murine small intestine to the total “background”
meric immunoglobulin receptor // J. Clin. Invest.  immunoglobulin production // Immunity.  1987.
1995.  Vol.95.  P.493502. Vol.62.  P.551555.
40. Ferreri N.R., Howland W.C., Spiegelberg H.L. 53. Heremans J.F. Immunoglobulin A. (Chapter
Release of leukotrienes C4 and B4 and prostaglan 6) // The Antigens.  Vol.2. / ed. M.Sela , N. Y. 
din E2 from human monocytes stimulated with ag SanFracisco, London.  1974.  P.365522.
gregated IgG, IgA, and IgE // J. Immunol.  1986.  54. Heystek H.C., Moulon C., Woltman A.M., Ga
Vol.136.  P.41884193. ronne P., van Kooten C. Human immature dendritic
41. Foreback J.L., Remick D.G., CrockettTorabi cells efficiently bind and take up secretory IgA with
E., Ward P.A. Cytokine responses of human blood out the induction of maturation // J. Immunol. 2002.
monocytes stimulated with Igs // Inflammation.   Vol.168.  P.102107.
1997.  Vol.21.  P.501517. 55. Hiemstra P.S., Biewenga J. Gorter A. et al. Ac
42. Frangione B., Prelli F., Michaesco C. et al // tivation of complement by human serum IgA , secre
Structural studies of immunoglobulin G, M and A tory IgA and IgA1 fragments // Mol. Immunol. 
heavy chains. Ann. N. Y. Acad. Sci.  1971.  Vol.190. 1988.  Vol.25.  P.527533.
 P.7182. 56. Hong R., Pollara B., Sood R. A model for co
43. Frangione B., WolfensteinTodel C. Partial lostral IgA // Proc. Nat. Acad. Sci. USA.  1966. 
duplication in the «hinge» region of IgA1 myeloma Vol.56.  P.602607.
proteins // Proc. Nat. Acad. Sci. USA.  1972.  57. Hostoffer R.W., Krukovets I., Berger M. En
Vol.12.  P.36733676. hancement by tumor necrosis factoralpha of Fcα re
44. Fujioka H., Emancipator S.N., Aikawa M., ceptor expression and IgAmediated superoxide gen
Huang D.S., Blatnik F., et al. Immunocytochemical eration and killing of Pseudomonas aeruginosa by
colocalization of specific immunoglobulin A with polymorphonuclear leukocytes // J. Infect. Dis. 
Sendai virus protein in infected polarized epitheli 1994.  Vol.170.  P.8287.
um // J. Exp.Med.  1998.  Vol.188.  P.12231229. 58. Hostoffer R.W., Krukovets I., Berger M. In
45. Geissmann F., Launay P., Pasquier B., Lepel creased FcαR expression and IgAmediated function
letier Y., Leborgne M. A subset of human dendritic on neutrophils induced by chemoattractants // J. Im
cells expresses IgA Fc receptor (CD89), which me munol.  1993.  Vol.150. P.45324540.
diates internalization and activation upon crosslink 59. http://www.pubmed.com
ing by IgA complexes // J. Immunol.  2001.  60. http://www.sciencedirect.org
Vol.166.  P.34652. 61. Hughes G.J., Frutiger S., Savoy L.A., Reason
46. Green N.M., Dourmashkin R.R., Parkhouse A.J., Morris H.R., Jaton J.C. Human free secretory
R.M.E. Electron microscopy of human and mouse component is composed of the first 585 amino acid
myeloma serum IgA // J. Mol. Biol.  1971.  Vol.56. residues of the polymeric immunoglobulin receptor
 P.203208. // FEBS Lett.  1997.  Vol.410.  P.443446.
47. Grey H.M., Abel C.A., Yont W.J., Kunkel H.G. 62. Huls G., Heijnen I.A., Cuomo E., van der Lin
A subclass of γA globulin (αA2) which lacks the dis den J., Boel E., et al. 1999. Antitumor immune effec
ulfide bonds linking heavy and light chains // J. tor mechanisms recruited by phage displayderived
Exp.Med.  1968.  Vol.128,  P.12231236. fully human IgG1 and IgA1 monoclonal antibodies /
48. Gulle H., Samstag A., Eibl M.M., Wolf H.M. / Cancer Res.  Vol.59.  P.57785784.
Physical and functional association of FcαR with 63. Hunziker W., Whitney J.A., Mellman I. Se
protein tyrosine kinase Lyn // Blood.  1998. Vol.91. lective inhibition of transcytosis by brefeldin A in
P.383391. MDCK cells // Cell.  1991.  Vol.67.  P.617627.
49. Gupta S., Platsoucas C.D., Good R.A. Recep 64. Ishizaka K. Immunoglobulin E // Methods in
tors for IgA on a subpopulation of human B lympho Enzymol.  1985.  Vol.116.  P.7688.
cytes // Proc. Natl. Acad. Sci. USA: 1979.  Vol.76. 65. JandrotPerrus M., Busfield S., Lagrue A.H.,
 P.40254028. Xiong X., Debili N. Cloning, characterization, and

495
Климович В.Б., Самойлович М.П. Медицинская Иммунология

functional studies of human and mouse glycoprotein a receptor for secretory component. Role in secreto
VI: a plateletspecific collagen receptor from the im ry IgAdependent activation // Eur. J. Immunol. 
munoglobulin superfamily // Blood.  2000.  Vol.96. 1995.  Vol.25.  P.117125.
 P.17981807. 79. Lang M.L., Chen Y.W., Shen L., Gao H., Lang
66. Kaetzel C.S., Robinson J.K., Chintalacharuvu G.A. IgA Fc receptor (FcαR) crosslinking recruits
K.R., Vaerman J.P., Lamm M.E. The polymeric im tyrosine kinases, phosphoinositide kinases and
munoglobulin receptor (secretory component) me serine/threonine kinases to glycolipid rafts // Bio
diates transport of immune complexes across epithe chem. J.  2002. Vol.364. P.517525.
lial cells: a local defense function for IgA // Proc. 80. Launay P., Lehuen A., Kawakami T., Blank U.,
Natl. Acad. Sci. USA.  1991.  Vol.88.  P.87968800. Monteiro R.C. IgA Fc receptor (CD89) activation
67. Kerr M.A. The structure and function of hu enables coupling to syk and Btk tyrosine kinase path
man IgA // Biochem. J.  1990.  Vol.271.  P.285296. ways: differential signaling after IFNgamma or phor
68. Kobayashi K. Studies of human secretory IgA; bol ester stimulation // J. Leukoc. Biol.  1998. 
Comparative studies of IgAbound secretory piece Vol.63. P.636642.
and the free secretory piece protein // Immunochem 81. Launay P., Patry C., Lehuen A., Pasquier B.,
istry.  1971.  Vol.8.  P.785800. Blank U., Monteiro R.C. Alternative endocytic path
69. Koshland M.E. Structure and function of the way for immunoglobulin A Fc receptors (CD89) de
J chain // Adv. Immunol.  1975.  Vol.20.  P.4167. pends on the lack of FcR° association and protects
70. Koshland M.E. The coming age of Jchain // against degradation of bound ligand // J. Biol. Chem.
Ann. Rev. Immunol.  1985.  Vol.3.  P.425453.  1999.  Vol.274.  P.72167225.
71. Krajci P., Grzeschik K.H., Geurts van Kessel 82. Lawrence D.A., Weigle W.O., Spiegelberg
AH, Olaisen B, Brandtzaeg P.The human transmem H.L. Immunoglobulins cytophilic for human lympho
brane secretory component (polyIg receptor): mo cytes, monocytes and neutrophils // J. Clin. Invest.
lecular cloning, restriction fragment length polymor  1975.  Vol.55.  P.368372.
phism and chromosomal sublocalization // Hum. 83. Longhem van E., Biewenga J. Allotypic and
Genet.  1991.  Vol.87.  P.642648. isotypic aspects of human immunoglobulin A // Mol.
72. Krajci P., Kvale D., Tasken K., Brandtzaeg Immunol.  1983.  Vol.20.  P.10011007.
P.Molecular cloning and exonintron mapping of the 84. Lowell G.H., Smith L.F., Griffiss J.M., Brandt B.L.
gene encoding human transmembrane secretory com IgAdependent, monocytemediated, antibacterial activ
ponent (the polyIg receptor) // Eur J Immunol.  ity // J. Exp. Med.  1980.  Vol.152.  P.452457.
1992.  Vol.22.  P.23092315. 85. Lum L.G., Muchmore A.V., Keren D., Decker
73. Krajci P., Solberg R., Sandberg M., Oyen O., J., Koski I. A receptor for IgA on human T lympho
Jahnsen T., Brandtzaeg P.Molecular cloning of the cytes // J. Immunol.  1979.  Vol.122.  P.6569.
human transmembrane secretory component (poly 86. Lum L.G., Muchmore A.V., O’Connor N.,
Ig receptor) and its mRNA expression in human tis Strober W., Blaese R.M. Fc receptors for IgA on hu
sues // Biochem. Biophys. Res. Commun.  1989.  man B, and human nonB, nonT lymphocytes // J.
Vol.158.  P.783789. Immunol. 1979.  Vol.123.  P.714719.
74. Kratzin J., Altevogt P., Ruban E. et al. Die Pri 87. Luton F., Mostov K.E. Transduction of baso
marstruktur eines monocklonalen IgA immunoglo lateraltoapical signals across epithelial cells: ligand
bulins (IgATro). II. Die Aminozauresequenz der H stimulated transcytosis of the polymeric immunoglo
Kette. atyp subgruppe III Struktur des gesammten bulin receptor requires two signals // Mol. Biol. Cell.
IgAmolekul // HoppeZeiler’s Z. Physiol. Chem.  1999.  Vol.10.  P.14091427.
1975.  Vol.356, 13371342 88. Ma J.K., Hikmat B.Y., Wycoff K., Vine N.D.,
75. Kremer E.J., Kalatzis V., Baker E., Callen D.F., Chargelegue D., et al. 1998. Characterization of a re
Sutherland G.R., Maliszewski C.R. The gene for the combinant plant monoclonal secretory antibody and
human IgA Fc receptor maps to 19q13.4 // Hum. preventive immunotherapy in humans // Nat. Med.
Genet.  1992.  Vol.89. P.107108.  Vol.4.  P.601606.
76. Kubagawa H., Shimada T., Shimo K., Lassou 89. Mackenzie S.J., Kerr M.A. 1995. IgM mono
ed K., Monteiro R.C., Cooper M.D. CD89 Workshop clonal antibodies recognizing FcαR but not Fcγ RIII
Panel Report // Leucocyte Typing VI.  1997.  trigger a respiratory burst in neutrophils although
P.10281029. both trigger an increase in intracellular calcium lev
77. Kuhn L.C., Kraehenbuhl J. The membrane re els and degranulation // Biochem. J.  Vol.306. 
ceptor for polymeric immunoglobulin is structurally P.519523.
related to secretory component // J. Biol. Chem.  90. Maliszewski C.R., March C.J., Schoenborn,
1981.  Vol.256.  P.1249012495. M.A., Gimpel S., Shen L. Expression cloning of a hu
78. Lamkhioued B., Gounni A.S., Gruart V., Pierce man Fc receptor for IgA // J. Exp. Med.  1990. 
A., Capron A., Capron M. Human eosinophils express Vol.172. P.16651672.

496
2006, Т. 8, № 4 IgA и его рецепторы

91. Maliszewski C.R., Shen L., Fanger M.W. The 104. Monteiro R.C., Cooper M.D., Kubagawa H.
expression of receptors for IgA on human monocytes Molecular heterogeneity of Fcα receptors detected
and calcitriol treated HL60 cells // J. Immunol.  by receptorspecific monoclonal antibodies // J. Im
1985.  Vol.135. P.38783881. munol.  1992.  Vol.148. P.17641770.
92. Martin A.M., Kulski J.K., Witt C., Pontarotti 105. Monteiro R.C., Hostoffer R.W., Cooper
P., Christiansen F.T. Leukocyte Iglike receptor com M.D., Bonner J.R., Gartland G.L., Kubagawa H. Def
plex (LRC) in mice and men // Trends Immunol.  inition of immunoglobulin A receptors on eosinophils
2002.  Vol.23.  P.8188. and their enhanced expression in allergic individu
93. Mazanec M.B., Kaetzel C.S., Lamm M.E., als // J. Clin. Invest. 1993.  Vol.92.  P.16811685.
Fletcher D., Nedrud J. G. Intracellular neutralization 106. Monteiro R.C., Kubagawa H., Cooper M.D.
of virus by immunoglobulin A antibodies // Proc. Cellular distribution, regulation, and biochemical na
Natl. Acad. Sci. USA.  1992.  Vol.89.  P.69016905. ture of an Fcα receptor in humans // J. Exp. Med. 
94. Mazanec M.B., Nedrud J.G., Kaetzel C.S., 1990.  Vol.171.  P.597 613
Lamm M.E. A threetiered view of the role of IgA in 107. Monteiro R.C., van de Vinkel J.G.J. IgA Fc
mucosal defense // Immunol. Today.  1993.  Vol. receptors // Ann. Rev. Immunol. 2003.  Vol.21. 
14.  P.43035. P.177204.
95. McDonald K.J., Cameron A.J., Allen J.M., Jar 108. Monteiro R.C.,Kubagawa H., Cooper M.D.
dine A.G. Expression of Fcα receptor by human me Cellular distribution, regulation, and biochemical na
sangial cells: a candidate receptor for immune com ture of an Fcα receptor in humans // J. Exp.Med. 
plex deposition in IgA nephropathy // Biochem. Bio 1990.  Vol.171.  P.597 613.
phys. Res. Commun.  2002.  Vol.290.  P.438442. 109. Morton H.C., van den HerikOudijk I.E.,
96. Mestecky J., Bienenstock J., McGhee J.R., Vossebeld P., Snijders A., Verhoeven A.J. Functional
Lamm M.E., Strober W., Ogra P.L. Historical as association between the human myeloid immunoglo
pects of mucosal immunology // Mucosal Immunol bulin A Fc receptor (CD89) and FcRγ chain. Molecu
ogy, 2nd edn. / ed. Ogra P.L., Mestecky J., Lamm lar basis for CD89/FcR gamma chain association //
M.E., Strober W., Bienenstock J., McGhee J.R.  J. Biol. Chem.  1995.  Vol.270.  P.297812987.
Amsterdam, ElsevierAcademic Press.  1999.  110. Morton H.C., van Zandbergen G., van
P.xxiii  xliii. Kooten C., Howard C.J., van de Winkel J.G.,
97. Mestecky J., Hamilton R.G., Magnusson C.G., Brandtzaeg P.Immunoglobulin binding sites of hu
Jefferis R., Vaerman J.P.Evaluation of monoclonal man FcαRI (CD89) and bovine Fcγ2R are located in
antibodies with specificity for human IgA, IgA sub their membranedistal extracellular domains // J.
classes and allotypes and secretory component. Re Exp.Med.  1999.  Vol.189.  P.17151722.
sults of an IUIS/WHO collaborative study // J Im 111. Mostov K.E. Transepithelial transport of im
munol Meth.  1996.  Vol.193.  P.103148. munoglobulins // Annu. Rev. Immunol.  1994. 
98. Mestecky J., McGhee J.R. Imunoglobulin A Vol.12.  P.6384.
(IgA): molecular and cellular interactions involved 112. Motegi Y., Kita H. Interaction with secreto
in IgA biosynthesis and immune response // Adv. Im ry component stimulates effector functions of human
munol.  1987.  Vol.40.  P.153245. eosinophils but not of neutrophils // J Immunol. 
99. Mestecky J., Moro I., Kerr M.A., Woof .JM. 1998.  Vol.161.  P.43404346.
Mucosal immunoglobulins // Mucosal Immunology, 113. Moura I.C., Centelles M.N., ArcosFajardo
3rd edn./ ed. Mestecky J., Bienenstock J., Lamm M.E., M., Malheiros D.M., Collawn, M. D. Cooper, R. C.
Mayer L., McGhee J.R., Strober W. Amsterdam Monteiro. Identification of the transferrin receptor
Elsevier/Academic Press.  2005.  P.153181. as a novel immunoglobulin (Ig)A1 receptor and its
100. Mestecky J., Russel M.W. IgA subclasses // enhanced expression on mesangial cells in IgA neph
Basic and Clinical aspects of IgG subclasses. Basel et ropathy // J. Exp.Med.  2001.  Vol.194.  P.417
al.  1986.  P.277301. 425.
101. Mestecky J., Russell M.W., Elson C.O. In 114. Munn E.A., Feinstein A., Munroe A.J. Elec
testinal IgA: novel views on its function in the de tron microscope examination of free IgA molecules
fence of the largest mucosal surface // Gut.  1999.  and their complexes with antigen // Nature.  1971.
Vol.44.  P.25.  Vol.231.  P.527529.
102. Mestecky J., Scrohenloher R.E., Kulhavy R. 115. Musil L.S., Baenziger J.U. Cleavage of mem
et al. Site of J chain attachment to human polymeric brane secretory component to soluble secretory
IgA // Proc. Nat. Acad. Sci. USA.  1974.  Vol.71.  component occurs on the cell surface of rat hepato
P.544548. cyte monolayers // J. Cell. Biol.  1987.  Vol.104. 
103. Monteiro R.C. Pathogenic significance of IgA P.17251733.
receptor interactions in IgA nephropathy // Trends 116. Nakahara J., Seiwa C., Shibuya A,. Aiso S.,
Mol. Med.  2002.  Vol.8.  P.464468. Asou H. Expression of Fc receptor for immunoglob

497
Климович В.Б., Самойлович М.П. Медицинская Иммунология

ulin M in oligodendrocytes and myelin of mouse cen CH3 domain interface of IgA essential for interac
tral nervous system // Neurosci. Let.  2003.  tion with the human Fcα receptor (FcαR) CD89 //
Vol.337.  P.7376. J. Biol. Chem.  1999.  Vol.274.  P.2350823514.
117. Nikolova E.B., Russell M.W. Dual function 129. Polat G.L., Laufer J., Fabian I., Passwell J.H.
of human IgA antibodies: inhibition of phagocytosis Crosslinking of monocyte plasma membrane Fcα,
in circulating neutrophils and enhancement of re Fcγ or mannose receptors induces TNF production /
sponses in IL8stimulated cells // J. Leukoc. Biol.  / Immunology.  1993.  Vol.80.  P.287292.
1995.  Vol.57. P.875882. 130. Pumphrey R.S.H. Computer models of hu
118. Norderhaug I.N., Johansen F.E., Schjerven man immunoglobulins // Immunol. Today.  1986. 
H., Brandtzaeg P. Regulation of the formation and Vol.7.  P.206210.
external transport of secretory immunoglobulins // 131. Ravetch J.V., Bolland S. IgG Fc receptors //
Crit. Rev. Immunol.  1999.  Vol.19.  P.481508. Annu. Rev. Immunol. 2001.  Vol.19.  P.275290.
119. Okamoto C.T., Shia S.P., Bird C., Mostov 132. Ravetch J.V., Kinet J.P.Fc receptors // Annu.
K.E. Roth M.G. The cytoplasmic domain of the poly Rev. Immunol.  1991.  Vol.9.  P.45792.
meric immunoglobulin receptor contains two inter 133. Reimer C.B., Phillips D.J., Aloisio C.H.,
nalization signals that are distinct from its basolat Black C.M., Wells T.W. Specificity and association
eral sorting signals // J. Biol. Chem.  1992.  Vol.267. constants of 33 monoclonal antibodies to human IgA
 P.99259932. epitopes // Immunol. Lett.  1989.  Vol.21.  P.209
120. Oliveira de I.R., Araujo de A.N., Bao S.N., 215.
Giugliano L.G. Binding of lactoferrin and free secre 134. Reth M. 1989. Antigen receptor tail clue //
tory component to enterotoxigenic Escherichia coli. Nature .  1991.  Vol.338.  P.383384.
FEMS Microbiol Lett. 2001  Vol.203.  P.2933. 135. Rifai A., Fadden K., Morrison S.L., Chintala
121. Pasquier B., Lepelletier Y., Baude C., Her charuvu K.R. The Nglycans determine the differen
mine O., Monteiro R.C. Differential expression and tial blood clearance and hepatic uptake of human im
function of IgA receptors (CD89 and CD71) during munoglobulin (Ig)A1 and IgA2 isotypes //
maturation of dendritic cells // J. Leukoc. Biol.  J. Exp.Med.  2000.  Vol.191.  P.21712182.
2004.  Vol.76.  P.11341141. 136. Robinson J.K., Blanchard T.G., Levine A.D.,
122. Patry C., Herbelin A., Lehuen A., Bach J.F., Emancipator S.N., Lamm M.E. A mucosal IgAmedi
Monteiro R.C. Fca receptors mediate release of tu ated excretory immune system in vivo // J. Immu
mour necrosis factorα and interleukin6 by human nol.  2001. Vol.166.  P.36883692.
monocytes following receptor aggregation // Immu 137. Rudd P.M., Fortune F., Patel T., Parekh R.B.,
nology.  1995.  Vol.86.  P.15. Dwek R.A., Lehner T. A human Tcell receptor rec
123. Patry C., Sibille Y., Lehuen A., Monteiro R.C. ognizes ‘O’linked sugars from the hinge region of
Identification of Fcα receptor (CD89) isoforms gen human IgA1 and IgD // Immunology.  1994. 
erated by alternative splicing that are differentially Vol.83.  P.99106.
expressed between blood monocytes and alveolar 138. Sakamoto N., Shibuya K., ShimizuY., Yotsu
macrophages // J. Immunol.  1996.  Vol.156.  moto K., Miyabayashi T. A novel Fc receptor for IgA
P.44424448. and IgM is expressed on both hematopoietic and non
124. Phalipon A., Cardona A., Kraehenbuhl J.P., hematopoietic tissues // Eur. J. Immunol.  2001. 
Edelman L., Sansonetti P.J., Corthesy B. Secretory Vol.31.  P.1310316.
component: a new role in secretory IgAmediated im 139. Schiff J.M., Huling S.L., Jones A.L. Recep
mune exclusion in vivo // Immunity.  2002.  Vol.17. tormediated uptake of asialoglycoprotein by the pri
 P.107115. mate liver initiates both lysosomal and transcellular
125. Phalipon A., Corthesy B. Novel functions of pathways // Hepatology.  1986.  Vol.6.  P.83747.
the polymeric Ig receptor: well beyond transport of 140. Shalaby W.S.W. Development of oral vac
immunoglobulins // Trends Immunol.  2003.  cines to stimulate mucosal and systemic immunity:
Vol.24.  P.5558. barriers and novel strategies // Clin. Immunol. and
126. Piskurich J.F. Blanchard M.H. Youngman Immunopathol.  1995.  Vol.74.  P.127134.
K.R. France J.A. Kaetzel C.S. Molecular cloning of 141. Shen L. A monoclonal antibody specific for
the mouse polymeric Ig receptor. Functional regions immunoglobulin A receptor triggers polymorphonu
of the molecule are conserved among five mammali clear neutrophil superoxide release // J. Leukoc. Biol.
an species // J Immunol.  1995.  Vol.154.  P.1735 1992.  Vol.51.  P.373378.
1747. 142. Shen L., Collins J. Monocyte superoxide se
127. Plaut A.G. Microbial IgA proteases // N. cretion triggered by human IgA // Immunology. 
Engl. J. Med.  1978.  Vol.298. P.14591463. 1989.  Vol.68.  P.491496.
128. Pleass R.J., Dunlop J..I, Anderson C.M., 143. Shen L., Collins J.E., Schoenborn M.A., Mal
Woof J.M. Identification of residues in the CH2/ iszewski C.R. Lipopolysaccharide and cytokine aug

498
2006, Т. 8, № 4 IgA и его рецепторы

mentation of human monocyte IgA receptor expres 157. Stokes C.R., Soothill J.F., Turner M.W. Im
sion and function // J. Immunol.  1994.  Vol.152. mune exclusion is a function of IgA // Nature.  1975.
P.40804086. Vol.255.  P.745746
144. Shen L., Lasser R., Fanger M.W. My 43, a 158. Strober W., Kelsall B., Marth T. Oral toler
monoclonal antibody that reacts with human mye ance // J. Clin. Immunol.  1998.  Vol.18.  P.130.
loid cells inhibits monocyte IgA binding and triggers 159. Swenson C.D., Patel T., Parekh R.B., Tam
function // J. Immunol.  1989.  Vol.143.  P.4117 ma S.M., Coico R.F. Human T cell IgD receptors re
4122. act with Oglycans on both human IgD and IgA1 //
145. Shibuya A., Sakamoto N., Shimizu Y., Eur. J. Immunol.  1998.  Vol.28.  P.23662372.
Shibuya K., Osawa M. Fcα/µ receptor mediates en 160. Tomana M., Kulhavy R., Mestecky J. Recep
docytosis of IgM coated microbes // Nat. Immunol. tormediated binding and uptake of immunoglobu
 2000.  Vol.1.  P.441446. lin A by human liver // Gastroenterology.  1988. 
146. Shimizu Y., Honda, S., Yotsumoto K. et al. Vol.94.  P.762770.
Fc(alpha/mu) receptor is a single genefamily mem 161. Tomasi T.B., Bienenstock J. Secretory immu
ber closely related to polymeric immunoglobulin re noglobulins // Adv. Immunol.  1968.  Vol.9.  P.1
ceptor encoded on Chromosome 1 // Immunogenet 97.
ics.  2001.  Vol.53.  P.709711. 162. Tomasi T.B., Grey H.M. Structure and func
147. Sjoberg O. Presence of receptors for IgA on tion of immunoglobulin A // Progr. Allergy.  1972.
human T and nonT lymphocytes // Eur. J. Immu  Vol.16.  P.81213.
nol.  1980.  Vol.10.  P.226228. 163. Tomasi T.B., Tan E.M., Solomon A., Pren
148. Sletten K., Christensen T.B., Brandtzaeg dergast R.A. Characteristics of an immune system
P.Human secretory component. III. Carbohydrates, common to external secretions // J. Exp. Med.  1965.
amino acids and Nterminal sequence // Immu  Vol.121.  P.101124.
nochemistry.  1975.  Vol.12.  P.783785. 164. Underdown B.J., Dorrington K.J. Studies of
149. Solari R., Kuhn L., Kraehenbuhl J.P. Anti structural and conformational basis for the relative
bodies recognizing different domains of the polymeric resistance of serum and secretory immunoglobulin A
immunoglobulin receptor // J. Biol. Chem.  1985.  to proteolysis // J. Immunol.  1974.  Vol.112. 
Vol.260.  P.11411145. P.949959.
150. Solomon A. Monoclonal immunoglobulins as 165. Underdown B.J., Schiff J.M. Immunoglobu
biomarkers of cancer // CancerMarkers. 1980.  lin A: strategic defense initiative at the mucosal sur
Vol.1.  P.5787. face // Annu. Rev. Immunol.  1986.  Vol.4.  P.389
151. SpiekerPolet H., Yam P.C., Knight K.L. Dif 417.
ferential expression of 13 IgA heavy chain genes in 166. Vaerman J. P., K. Hagiwara, K. Kobayashi
rabbit lymphoid tissues // J. Immunol.  1993.  and M. Rits. Complexes of albumin and α1antit
Vol.150.  P.54575465. rypsin with Fcfragment of IgA monomer are disul
152. Stanworth D.R., I. Lewin and R. A. Crock fidebound to penultimate Cterminal cysteine in the
son. Measurement of IgGα1 antitrypsin (α1AT) Cα3domain // Immunology Letters.  1987.  Vol.15.
complex in the sera of patients with IgA myelomato  P.6772.
sis // Immunol. Lett., 1985.  Vol.11.  P.277280 167. Vaerman J.P., Heremans J.F. Subclass of hu
153. Stewart W.W., Mazengera R.L., Shen L., man immunoglobulin A based on differences in the
Kerr M.A. Unaggregated serum IgA binds to neutro alpha polypeptide chain // Science.  1966.  Vol.153.
phil FcαR at physiological concentrations and is en  P.647655.
docytosed but crosslinking is necessary to elicit a 168. Valerius T., Stockmeyer B., van Spriel A.B.,
respiratory burst // J. Leukoc. Biol.  1994.  Vol.56. Graziano R.F., van den HerikOudijk I.E. FcαRI
 P.481487. (CD89) as a novel trigger molecule for bispecific an
154. Stockert R.J. The asialoglycoprotein receptor: tibody therapy // Blood.  1997.  Vol.90. P.4485
relationships between structure, function, and expres 4492.
sion // Physiol. Rev.  1995.  Vol.75.  P.591609. 169. Wang A.C., Fudenberg H.H. IgA and evolu
155. Stockert R.J., Kressner M.S., Collins J.C., tion of immunoglobulins // J. Immunogenet.  1974.
Sternlieb I., Morell A.G. IgA interaction with the  Vol.1.  P.331.
asialoglycoprotein receptor // Proc. Natl. Acad. Sci. 170. Wines B.D., Hulett M.D., Jamieson G.P.,
USA.  1982.  Vol.79.  P.62296231. Trist H.M., Spratt J.M., Hogarth P.M. Identification
156. Stockmeyer B., Dechant M., van Egmond M., of residues in the first domain of human Fcα recep
Tutt A.L., Sundarapandiyan K. Triggering Fcαre tor essential for interaction with IgA // J. Immunol.
ceptor I (CD89) recruits neutrophils as effector cells 1999.  Vol.162. P.21462153.
for CD20directed antibody therapy // J. Immunol. 171. Wit de T. P, Morton H.C., Capel P.J., van de
 2000.  Vol.165.  P.59545961. Winkel J.G. Structure of the gene for the human my

499
Климович В.Б., Самойлович М.П. Медицинская Иммунология

eloid IgA Fc receptor (CD89) // J. Immunol.  1995. noglobulin assembly and association with J chain //
 Vol.155.  P.12031209. J. Biol. Chem.  1999.  Vol.274.  P.3377133777.
172. Woof J.M., Kerr M.F. IgA function  varia 175. Zandbergen van G., Westerhuis R., Moham
tions on a theme // Immunology.  2004.  Vol.113.  ad N.K., van De Winkel J.G., Daha M.R., van Kooten
P.175177. C. Crosslinking of the human Fc receptor for IgA
173. Yan H., Lamm M.E., Bjorling E., Huang Y.T. (FcαRI/CD89) triggers FcR αchain dependent
Multiple Functions of Immunoglobulin A in Mucosal shedding of soluble CD89 // J. Immunol.  1999. 
Defense against Viruses: an In vitro Measles Virus Mod Vol.163 P.58065812.
el // J. Virology.  2002.  Vol.76.  P.1097210979. 176. Zhang G.,Young J.R.,Tregaskes C.A., Sopp,
174. Yoo E.M., Coloma M.J., Trinh K.R., Nguyen P., Howard C.J. Identification of a novel class of
T.Q., Vuong L.U., Morrison S.L., Chintalacharuvu mammalian Fc gamma receptor // J. Immunol.  1995.
K.R. Structural requirements for polymeric immu  Vol.155  P.15341541.

поступила в редакцию 23.01.2006


принята к печати 14.02.2006

500

Оценить